Your browser is old and dusty. Try Google Chrome!

Details for sml0002

ORF sml0002
Accession NP_442241.1
Symbol psbX
Category Photosystem II
Definition photosystem II PsbX protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -246 -260 14.7492 0.0392
NP_441061.1_2 Forward -356 -342 7.57108 0.101
NP_441061.1_2 Reverse -370 -384 -1.18038 0.252
NP_441061.1_2 Reverse -252 -266 -2.45868 0.293
NP_440795.1_7 Forward -253 -246 14.6904 0.0123
NP_440795.1_7 Reverse -246 -253 14.6904 0.0123
NP_441418.1_6 Reverse -245 -264 -20.65 0.121
NP_441453.1_1 Reverse -238 -256 13.1947 0.0938
NP_441453.1_4 Reverse -245 -253 16.539 0.00633
NP_441453.1_4 Forward -254 -246 16.539 0.00633
NP_441453.1_4 Forward -48 -40 4.73931 0.252
NP_441453.1_4 Reverse -24 -32 3.95266 0.275
NP_441453.1_7 Reverse -205 -212 11.6422 0.298
NP_442151.1_6 Reverse -245 -259 16.8142 0.0138
NP_442151.1_6 Forward -254 -240 15.7325 0.0214
NP_442151.1_6 Forward -54 -40 6.78443 0.221
NP_440226.1_1 Forward -254 -235 3.53937 0.221
NP_442623.1_3 Forward -178 -159 -18.6834 0.263
NP_442744.1_8 Reverse -296 -315 -3.73712 0.297
NP_442287.1_1 Reverse -185 -195 14.6309 0.256
NP_442655.1_1 Reverse -330 -349 1.57275 0.238
NP_442173.1_1 Forward -253 -245 15.4574 0.00633
NP_442173.1_1 Reverse -246 -254 15.4574 0.00633
NP_442752.1_4 Forward -254 -247 13.8055 0.0199
NP_442752.1_4 Reverse -245 -252 13.8055 0.0199
NP_442752.1_4 Forward -37 -30 12.4288 0.0388
NP_442752.1_4 Forward -48 -41 4.26735 0.293
NP_443027.1_4 Reverse -243 -253 15.3197 0.0437
NP_441812.1_3 Forward -255 -241 15.0442 0.106
NP_442975.1_10 Reverse -241 -255 10.8154 0.0516
NP_442975.1_10 Forward -222 -208 9.53707 0.068
NP_442975.1_10 Forward -258 -244 2.65393 0.269
NP_440784.1_7 Forward -253 -246 15.9687 0.0123
NP_440784.1_7 Reverse -246 -253 15.9687 0.0123
NP_442909.1_7 Reverse -246 -260 11.4053 0.131
NP_442000.2_10 Reverse -321 -339 5.23069 0.286
NP_440061.1_9 Forward -256 -242 10.0287 0.131
NP_441054.1_1 Forward -261 -247 18.7808 0.129
NP_441054.1_4 Reverse -235 -253 7.29564 0.0945
NP_442062.1_8 Reverse -245 -255 17.3846 0.00193
NP_442062.1_8 Forward -254 -244 10.3048 0.0493
NP_442062.1_8 Forward -37 -27 3.91327 0.243
NP_440761.1_4 Reverse -240 -259 -4.13045 0.132
NP_441859.1_3 Reverse -244 -263 9.24175 0.13
NP_440304.1_4 Reverse -243 -253 18.9579 0.00406
NP_440304.1_4 Forward -35 -25 4.3066 0.271
NP_440304.1_4 Forward -256 -246 1.84832 0.299
NP_442242.1_1 Reverse -66 -85 16.6052 0.28
NP_442242.1_4 Forward -253 -246 14.3954 0.0124
NP_442242.1_4 Reverse -246 -253 14.3954 0.0124
NP_441208.1_9 Forward -257 -243 18.2892 0.0647
NP_441594.1_6 Reverse -248 -267 12.5858 0.109
NP_441594.1_6 Forward -263 -244 9.93088 0.134
NP_442196.1_10 Reverse -333 -352 11.7008 0.224
NP_440370.1_10 Forward -42 -23 9.73422 0.217
NP_442110.1_7 Reverse -245 -259 10.3243 0.0684
NP_441082.1_10 Reverse -316 -329 12.409 0.236
NP_441083.1_5 Reverse -245 -255 20.3345 0.00053
NP_441083.1_5 Forward -254 -244 11.2881 0.0159
NP_442827.1_8 Forward -262 -243 -0.492971 0.228
NP_441141.1_4 Forward -264 -245 9.24257 0.292
NP_441738.1_2 Forward -252 -245 15.28 0.0102
NP_441738.1_2 Reverse -247 -254 15.28 0.0102
NP_441558.1_5 Reverse -243 -262 16.5191 0.0291
NP_441558.1_5 Forward -256 -237 11.0125 0.0879
NP_441558.1_5 Reverse -333 -352 5.30933 0.254
NP_440209.1_1 Reverse -245 -253 18.1123 0.00295
NP_440209.1_1 Forward -254 -246 18.1123 0.00295
NP_442889.1_8 Reverse -242 -256 17.6002 0.0162
NP_441713.1_1 Reverse -239 -258 -4.81876 0.113
NP_441713.1_1 Forward -260 -241 -16.8151 0.286
NP_439953.1_1 Reverse -279 -298 18.584 0.163
NP_441716.1_1 Reverse -245 -259 3.8345 0.259
NP_442111.1_4 Forward -49 -35 17.2075 0.0109
NP_442111.1_4 Forward -255 -241 11.8976 0.0469
NP_442111.1_4 Reverse -244 -258 9.34103 0.0609
NP_441163.1_1 Reverse -86 -103 6.72462 0.254
NP_440851.1_6 Forward -105 -88 -0.354483 0.296
NP_440906.1_5 Forward -253 -246 15.8704 0.0124
NP_440906.1_5 Reverse -246 -253 15.8704 0.0124
NP_440747.1_10 Forward -257 -245 24.7201 0.00036
NP_440747.1_10 Reverse -242 -254 -2.02597 0.0196
NP_440747.1_10 Reverse -36 -48 -12.3507 0.27
NP_441486.1_1 Reverse -242 -256 -2.45868 0.175
NP_441486.1_1 Forward -257 -243 -2.55701 0.175
NP_441486.1_1 Forward -134 -120 -2.65535 0.175
NP_441880.2_10 Reverse -25 -43 8.86894 0.264
NP_442634.1_4 Reverse -243 -257 6.29277 0.0508
NP_442634.1_4 Forward -35 -21 1.27789 0.149
NP_442634.1_4 Forward -256 -242 -3.24533 0.161
NP_440842.1_10 Reverse -242 -256 0.982901 0.296
NP_441014.1_8 Forward -351 -332 -7.67036 0.281
NP_441014.1_10 Reverse -157 -176 10.2251 0.122
NP_442848.1_1 Forward -260 -246 -1.5737 0.263
NP_442848.1_9 Reverse -343 -362 16.7157 0.0923
NP_443018.1_3 Forward -253 -246 14.8871 0.0123
NP_443018.1_3 Reverse -246 -253 14.8871 0.0123
NP_443018.1_3 Forward -53 -46 10.6589 0.0967
NP_443018.1_3 Reverse -336 -343 10.2655 0.107
NP_443018.1_3 Reverse -46 -53 4.16902 0.278
NP_441316.1_7 Reverse -243 -258 0.176559 0.194
NP_441316.1_7 Forward -256 -241 -1.69173 0.238
NP_441634.1_8 Forward -256 -242 -3.147 0.295
NP_440376.1_1 Forward -254 -245 19.4693 0.000692
NP_440376.1_1 Reverse -245 -254 19.4693 0.000692
NP_440376.1_1 Reverse -321 -330 -0.295266 0.286
NP_441857.1_5 Forward -40 -22 3.46073 0.244
NP_441588.1_4 Reverse -247 -257 9.02648 0.14
NP_442730.1_8 Forward -262 -243 2.06362 0.295
NP_442687.1_7 Reverse -244 -254 9.02648 0.0994
NP_442687.1_7 Forward -255 -245 8.92815 0.0994
NP_442687.1_7 Forward -368 -358 4.89658 0.23
NP_441077.1_6 Forward -121 -105 2.60905 0.276
NP_442485.1_3 Forward -81 -62 -5.99873 0.297
NP_441846.1_10 Forward -205 -186 -21.3384 0.256
NP_442958.1_3 Reverse -234 -253 8.16093 0.152
NP_442583.1_8 Forward -265 -246 7.66927 0.285
NP_441422.1_7 Reverse -243 -260 -2.51776 0.215
NP_440667.1_8 Reverse -94 -113 13.8633 0.222
NP_441950.1_7 Forward -107 -88 -5.70374 0.233
NP_441950.1_7 Forward -375 -356 -6.39206 0.251
NP_442658.1_1 Reverse -243 -253 15.9091 0.00966
NP_442658.1_1 Forward -256 -246 6.76441 0.214
NP_442658.1_1 Forward -35 -25 6.17443 0.235
NP_440141.1_8 Reverse -203 -222 11.1109 0.208
NP_442496.1_5 Reverse -321 -339 13.1955 0.188
NP_442496.1_5 Forward -110 -92 9.65558 0.217
NP_442205.1_9 Reverse -239 -255 -3.8747 0.297
NP_441414.1_9 Forward -254 -235 4.62101 0.0536
NP_442937.1_5 Forward -259 -240 11.6025 0.133
NP_441958.1_5 Reverse -244 -254 21.2195 0.000805
NP_441958.1_5 Forward -255 -245 12.2714 0.00183
NP_442836.1_5 Forward -233 -214 2.55606 0.255
NP_442836.1_10 Forward -195 -185 11.0914 0.269
NP_440203.1_5 Reverse -248 -258 14.2375 0.0886
NP_439905.1_1 Forward -253 -240 14.7689 0.111
NP_440984.1_7 Reverse -240 -254 12.586 0.122
NP_439990.1_5 Reverse -240 -253 15.7522 0.0483
NP_439990.1_5 Forward -259 -246 11.3273 0.128
NP_442376.1_6 Reverse -77 -96 5.30933 0.18
NP_442690.1_1 Reverse -141 -160 -13.8652 0.267
NP_442911.1_2 Reverse -235 -254 7.07928 0.0267
NP_442911.1_2 Forward -264 -245 6.09597 0.03
NP_440153.1_8 Reverse -24 -37 2.87088 0.21
NP_442064.1_4 Forward -330 -311 6.88182 0.246
NP_442536.1_4 Reverse -174 -192 12.4089 0.164
NP_442536.1_7 Forward -260 -241 11.8975 0.273
NP_443055.1_6 Reverse -178 -196 -0.6699 0.265
NP_441129.1_3 Forward -83 -64 -17.7985 0.29
NP_441099.1_5 Reverse -235 -254 -1.08219 0.102
NP_441099.1_5 Forward -264 -245 -9.44032 0.223
NP_441099.1_5 Reverse -35 -54 -9.53865 0.226
NP_442002.1_1 Forward -204 -186 -6.37237 0.249
NP_442002.1_9 Forward -88 -81 9.97054 0.246
NP_440809.1_2 Reverse -57 -76 -3.24547 0.283
NP_440809.1_9 Reverse -236 -254 -8.14232 0.227
NP_442013.1_9 Forward -350 -331 17.8948 0.173
NP_442440.1_7 Forward -361 -342 10.6192 0.215
NP_441646.1_1 Forward -261 -242 13.0775 0.0895
NP_442438.1_10 Forward -259 -245 10.0294 0.0581
NP_442566.1_2 Reverse -376 -395 1.76941 0.289
NP_440879.1_6 Reverse -73 -92 -4.72043 0.29
NP_442771.1_1 Reverse -243 -261 -5.48739 0.166
NP_442771.1_1 Forward -103 -85 -6.66736 0.168
NP_442771.1_1 Reverse -177 -195 -9.71562 0.231
NP_440484.1_3 Reverse -243 -257 8.94771 0.279
NP_440147.1_4 Forward -256 -243 20.1771 0.00228
NP_440147.1_4 Reverse -243 -256 3.75586 0.181
NP_440147.1_4 Forward -369 -356 1.29759 0.233
NP_440147.1_4 Forward -346 -333 -0.669033 0.294
NP_441550.1_8 Reverse -243 -253 17.4824 0.00754
NP_441550.1_8 Forward -256 -246 14.6309 0.0132
NP_441916.1_7 Forward -254 -244 18.9579 0.00144
NP_441916.1_7 Reverse -245 -255 10.3048 0.0261
NP_441916.1_7 Forward -33 -23 4.99491 0.15
NP_441916.1_7 Forward -344 -334 1.06167 0.294
NP_441916.1_10 Reverse -340 -359 0.687771 0.278
NP_440465.1_10 Reverse -242 -261 4.03102 0.237
NP_441041.1_4 Forward -54 -35 5.30933 0.0518
NP_441041.1_4 Reverse -245 -264 0.786102 0.0837
NP_441041.1_4 Forward -378 -359 -11.3086 0.244
NP_441041.1_4 Reverse -122 -141 -13.4719 0.288
NP_441041.1_7 Reverse -242 -254 8.87526 0.128
NP_441041.1_7 Forward -257 -245 8.58373 0.133
NP_442396.1_5 Forward -41 -28 5.52582 0.28
NP_442004.1_6 Reverse -245 -259 15.5359 0.0577
NP_441725.1_4 Reverse -34 -48 3.93223 0.278
NP_441725.1_4 Forward -259 -245 2.8506 0.279
NP_441725.1_5 Forward -253 -243 8.92815 0.0553
NP_441725.1_5 Reverse -246 -256 2.04498 0.115
NP_439966.1_7 Reverse -243 -253 13.8442 0.0234
NP_439966.1_7 Forward -256 -246 7.25606 0.15
NP_439966.1_9 Reverse -243 -252 0.983037 0.253
NP_442941.1_3 Reverse -246 -256 11.0914 0.0116
NP_442941.1_3 Forward -253 -243 10.9931 0.0116
NP_442941.1_3 Reverse -40 -50 0.275027 0.222
NP_440289.1_2 Reverse -242 -255 2.18257 0.102
NP_440289.1_2 Reverse -332 -345 -4.30728 0.286
NP_440983.1_5 Forward -185 -166 -2.16383 0.231
NP_440983.1_5 Reverse -245 -264 -6.29373 0.276
NP_440260.1_8 Reverse -76 -94 4.14905 0.154
NP_440260.1_8 Forward -263 -245 2.57575 0.182
NP_440260.1_8 Forward -394 -376 -6.66736 0.294
NP_441678.1_9 Forward -207 -188 5.60432 0.183
NP_442281.1_1 Forward -259 -245 16.3219 0.00832
NP_442281.1_1 Reverse -330 -344 11.2087 0.0497
NP_442281.1_1 Forward -349 -335 5.99717 0.139
NP_441334.1_7 Reverse -243 -262 -18.9784 0.275
NP_440437.1_1 Reverse -33 -52 -5.21209 0.276
NP_440647.1_9 Forward -256 -238 10.0489 0.188
NP_442012.1_1 Reverse -239 -258 -0.39387 0.259
NP_440723.1_10 Reverse -173 -192 16.8037 0.26
NP_441556.1_10 Forward -259 -245 14.2126 0.178
NP_441644.1_6 Forward -254 -244 19.0557 0.000803
NP_441644.1_6 Reverse -245 -255 17.3841 0.00127
NP_441644.1_6 Forward -351 -341 4.99446 0.216
NP_441644.1_6 Forward -344 -334 3.32285 0.288
NP_440867.1_10 Forward -353 -334 1.86774 0.291
NP_442215.1_2 Reverse -243 -259 4.28677 0.0853
NP_442177.1_5 Forward -263 -249 9.43936 0.239
NP_442247.1_8 Forward -256 -242 9.93102 0.247
NP_440253.1_2 Forward -254 -236 1.39578 0.161
NP_440929.1_8 Forward -254 -245 19.2726 0.000701
NP_440929.1_8 Reverse -245 -254 19.2726 0.000701
NP_441346.1_6 Reverse -253 -271 20.5703 0.22
NP_442933.1_10 Forward -254 -245 17.601 0.00325
NP_442933.1_10 Reverse -245 -254 17.601 0.00325
NP_442933.1_10 Forward -33 -24 4.42462 0.246
NP_441751.2_8 Reverse -246 -260 7.57108 0.0339
NP_441751.2_8 Forward -253 -239 2.75286 0.0759
NP_441751.2_8 Reverse -29 -43 -6.49025 0.269
NP_442926.1_9 Forward -269 -250 18.7807 0.209
NP_442554.1_8 Forward -253 -243 19.1546 0.00369
NP_442554.1_8 Reverse -246 -256 15.3197 0.00882
NP_442554.1_8 Reverse -46 -56 10.5014 0.0454
NP_442554.1_8 Reverse -252 -262 4.3066 0.189
NP_442554.1_8 Reverse -25 -35 3.61828 0.218
NP_442554.1_8 Forward -343 -333 3.12662 0.239
NP_442554.1_8 Reverse -336 -346 2.63497 0.265
NP_441762.1_7 Forward -255 -243 2.59558 0.0676
NP_441762.1_7 Reverse -244 -256 0.530633 0.0747
NP_442142.1_4 Forward -257 -244 12.8017 0.0409
NP_442142.1_4 Reverse -242 -255 3.65697 0.248
NP_442142.1_4 Reverse -254 -267 2.37867 0.294
NP_442292.1_1 Reverse -246 -255 18.486 0.00229
NP_442292.1_1 Forward -253 -244 17.5026 0.00435
NP_442292.1_1 Reverse -46 -55 4.22796 0.181
NP_442476.1_6 Forward -253 -239 6.19444 0.13
NP_440895.1_6 Forward -260 -247 18.8988 0.039
NP_439989.1_10 Forward -265 -246 22.6147 0.0641
NP_443009.1_5 Forward -255 -244 14.5128 0.02
NP_443009.1_5 Reverse -244 -255 10.1862 0.0792
NP_441715.1_4 Reverse -246 -256 7.94484 0.107
NP_441715.1_4 Forward -253 -243 7.25653 0.108
NP_440357.1_3 Reverse -367 -386 8.94757 0.203
NP_441448.1_1 Reverse -67 -86 12.0942 0.178
NP_440183.1_9 Reverse -344 -363 -3.04881 0.176
NP_441198.1_8 Reverse -243 -253 15.4199 0.0427
NP_440379.1_5 Reverse -242 -261 -5.11376 0.219
NP_440464.1_10 Reverse -246 -256 13.0082 0.169
NP_441468.1_1 Forward -253 -246 15.8704 0.0124
NP_441468.1_1 Reverse -246 -253 15.8704 0.0124
NP_441468.1_1 Forward -53 -46 3.97235 0.277
NP_441468.1_1 Forward -32 -25 3.97235 0.277
NP_439939.1_5 Forward -349 -330 12.1925 0.282
NP_441015.1_10 Reverse -240 -259 -6.09707 0.241
NP_441015.1_10 Reverse -252 -271 -10.0303 0.282
NP_441673.1_1 Forward -254 -245 20.8459 0.000698
NP_441673.1_1 Reverse -245 -254 20.8459 0.000698
NP_441826.1_2 Forward -260 -246 6.88276 0.0899
NP_441330.1_1 Reverse -240 -259 -3.83545 0.0857
NP_441637.1_9 Reverse -144 -162 -4.11075 0.296
NP_442490.1_9 Reverse -245 -264 -8.65367 0.293
NP_442868.1_6 Forward -256 -246 9.81313 0.038
NP_442868.1_6 Reverse -243 -253 8.63316 0.0555
NP_442719.1_2 Reverse -170 -188 -9.32298 0.263
NP_442719.1_2 Forward -195 -177 -10.208 0.271
NP_441056.1_1 Reverse -245 -264 -6.09707 0.267
NP_441612.1_2 Reverse -245 -255 8.54929 0.21
NP_441612.1_2 Forward -208 -198 8.25885 0.228
NP_442427.1_8 Reverse -236 -255 10.8159 0.156
NP_442808.1_1 Reverse -244 -254 8.73102 0.0481
NP_442808.1_1 Forward -255 -245 8.63269 0.0481
NP_442808.1_1 Reverse -185 -195 3.22451 0.247
NP_441101.1_10 Forward -92 -73 -7.17871 0.29
NP_442775.1_6 Reverse -252 -271 9.63589 0.296
NP_442718.1_2 Reverse -225 -244 -2.0655 0.266
NP_442050.1_5 Reverse -243 -253 17.1874 0.00812
NP_442050.1_5 Forward -256 -246 7.64939 0.243
NP_442050.1_5 Reverse -37 -47 7.25606 0.265
NP_442342.1_9 Reverse -243 -259 2.71347 0.283
NP_441937.1_5 Reverse -67 -86 14.7491 0.0726
NP_440601.1_7 Forward -385 -371 15.9292 0.278
NP_440558.1_2 Reverse -242 -261 -2.26216 0.225
NP_440558.1_2 Reverse -30 -49 -3.44213 0.236
NP_441878.1_6 Reverse -334 -344 10.5014 0.0176
NP_441878.1_6 Reverse -244 -254 10.5014 0.0176
NP_441878.1_6 Forward -345 -335 10.4031 0.0176
NP_441878.1_6 Forward -255 -245 10.4031 0.0176
NP_441878.1_6 Reverse -91 -101 0.963343 0.128
NP_441878.1_6 Forward -102 -92 -6.41148 0.191
NP_441036.1_8 Reverse -244 -254 15.713 0.00724
NP_441036.1_8 Forward -255 -245 8.33817 0.174
NP_442650.1_2 Reverse -245 -259 17.9942 0.0526
NP_441557.1_5 Forward -254 -245 19.9609 0.000699
NP_441557.1_5 Reverse -245 -254 19.9609 0.000699
NP_441557.1_8 Forward -329 -319 14.5325 0.183
NP_441557.1_8 Reverse -187 -197 11.3859 0.252
NP_441445.1_1 Forward -263 -244 0.58944 0.272
NP_442066.2_9 Reverse -241 -254 21.5538 0.00487
NP_441433.1_8 Reverse -165 -184 13.7658 0.147
NP_442241.1_6 Forward -365 -346 20.1573 0.0686
NP_441308.1_8 Reverse -243 -253 12.4681 0.218
NP_440101.1_3 Reverse -240 -259 5.211 0.202
NP_440101.1_3 Forward -372 -353 3.73603 0.224
NP_441564.1_2 Forward -48 -29 3.44104 0.128
NP_442183.1_1 Forward -254 -240 12.4876 0.0579
NP_442183.1_1 Reverse -245 -259 5.21113 0.226
NP_442397.1_9 Forward -267 -248 6.29264 0.246
NP_442397.1_9 Reverse -245 -264 3.53937 0.264
NP_441574.1_1 Forward -390 -371 -1.37718 0.216
NP_442347.1_2 Reverse -246 -255 12.4878 0.056
NP_442347.1_2 Reverse -29 -38 5.99792 0.201
NP_442347.1_2 Forward -253 -244 3.34298 0.284
NP_442645.1_2 Forward -262 -243 -15.7335 0.209
NP_442645.1_2 Reverse -243 -262 -18.4868 0.274
NP_441037.1_4 Reverse -243 -253 16.5761 0.0168
NP_441037.1_4 Forward -256 -246 7.9999 0.237
NP_442508.1_8 Reverse -163 -180 11.2486 0.256
NP_441633.1_3 Forward -256 -243 10.8357 0.0286
NP_440136.1_2 Forward -253 -246 15.9687 0.0123
NP_440136.1_2 Reverse -246 -253 15.9687 0.0123
NP_442590.1_10 Forward -363 -344 9.43923 0.196
NP_442590.1_10 Reverse -245 -264 3.34271 0.294
NP_442998.1_10 Forward -252 -245 15.5754 0.0102
NP_442998.1_10 Reverse -247 -254 15.5754 0.0102
NP_442998.1_10 Reverse -41 -48 13.5105 0.0225
NP_440899.1_8 Reverse -144 -163 -7.67036 0.246
NP_440299.1_1 Forward -258 -245 22.3398 0.000547
NP_440299.1_1 Forward -52 -39 4.73861 0.201
NP_440299.1_1 Reverse -377 -390 3.46031 0.243
NP_440299.1_1 Reverse -241 -254 3.36198 0.247
NP_440299.1_3 Forward -326 -307 11.7992 0.244
NP_441799.1_1 Reverse -241 -255 13.7653 0.03
NP_441799.1_1 Forward -258 -244 9.83206 0.0838
NP_441007.1_10 Reverse -240 -253 13.0973 0.0499
NP_441007.1_10 Forward -383 -370 7.00078 0.152
NP_441007.1_10 Forward -259 -246 1.29759 0.203
NP_440256.1_1 Forward -40 -21 -8.85033 0.268
NP_441512.1_4 Forward -355 -336 8.16093 0.264
NP_441559.1_8 Forward -259 -245 -6.78525 0.279
NP_441559.1_8 Reverse -240 -254 -7.67023 0.297
NP_440915.1_6 Forward -258 -244 12.7826 0.0206
NP_440915.1_6 Reverse -241 -255 3.44117 0.101
NP_440915.1_6 Forward -199 -185 1.37622 0.141
NP_440915.1_6 Forward -91 -77 -1.77037 0.246
NP_441704.1_8 Forward -265 -246 7.37347 0.242
NP_441464.1_8 Forward -254 -240 6.58777 0.231
NP_440695.1_5 Reverse -245 -264 -0.39387 0.284
NP_441199.1_6 Forward -258 -239 7.66927 0.117
NP_442993.1_1 Forward -254 -238 -11.6429 0.255
NP_442386.1_9 Forward -255 -246 13.8639 0.0289
NP_442386.1_9 Reverse -250 -259 10.2257 0.136
NP_442386.1_9 Reverse -244 -253 6.39082 0.219
NP_442386.1_9 Reverse -185 -194 5.70251 0.241
NP_442386.1_9 Reverse -44 -53 4.62087 0.294
NP_441404.1_8 Reverse -36 -50 11.9953 0.271
NP_441340.1_5 Forward -253 -246 15.6737 0.0124
NP_441340.1_5 Reverse -246 -253 15.6737 0.0124
NP_441340.1_5 Reverse -46 -53 11.3472 0.0526
NP_442484.1_2 Forward -265 -246 0.58944 0.247
NP_440168.1_4 Reverse -82 -101 -5.9004 0.255
NP_440211.1_3 Reverse -186 -205 12.0942 0.298
NP_440586.1_8 Forward -253 -246 13.2151 0.026
NP_440586.1_8 Reverse -246 -253 13.2151 0.026
NP_440586.1_8 Reverse -336 -343 9.08521 0.178
NP_440586.1_8 Forward -53 -46 5.74197 0.283
NP_442251.1_5 Forward -120 -101 15.9291 0.273
NP_442251.1_6 Forward -253 -246 15.2804 0.0124
NP_442251.1_6 Reverse -246 -253 15.2804 0.0124
NP_440684.1_9 Forward -260 -246 15.4376 0.0981
NP_440684.1_9 Reverse -25 -39 8.55439 0.226
NP_441262.1_3 Reverse -245 -252 14.7888 0.0223
NP_441262.1_3 Forward -254 -247 14.7888 0.0223
NP_441262.1_3 Forward -48 -41 5.25066 0.215
NP_443051.1_1 Reverse -244 -253 19.5676 0.00335
NP_443051.1_1 Forward -255 -246 10.4228 0.00754
NP_439937.1_9 Forward -255 -238 -14.5148 0.287
NP_440408.1_7 Reverse -245 -264 12.1925 0.212
NP_440439.1_1 Reverse -242 -255 3.06754 0.121
NP_440439.1_1 Forward -257 -244 0.0192843 0.203
NP_440372.1_2 Forward -253 -246 16.3621 0.0124
NP_440372.1_2 Reverse -246 -253 16.3621 0.0124
NP_440316.1_10 Reverse -341 -351 14.238 0.199
NP_442488.1_7 Reverse -243 -262 13.1758 0.209
NP_441803.1_2 Reverse -343 -362 6.29264 0.155
NP_441803.1_2 Reverse -252 -271 2.0644 0.22
NP_439977.1_5 Reverse -239 -258 9.43923 0.0937
NP_440267.1_2 Reverse -330 -344 6.98048 0.215
NP_442384.1_10 Reverse -245 -258 17.4239 0.00585
NP_442384.1_10 Forward -254 -241 7.78743 0.0743
NP_441018.1_7 Forward -394 -375 9.24257 0.23
NP_441018.1_7 Forward -264 -245 9.14423 0.233
NP_441018.1_7 Reverse -241 -260 7.66927 0.268
NP_442790.1_4 Forward -263 -244 -9.34199 0.183
NP_442262.1_10 Forward -253 -246 14.1988 0.0123
NP_442262.1_10 Reverse -246 -253 14.1988 0.0123
NP_442262.1_10 Forward -53 -46 12.0355 0.062
NP_442262.1_10 Reverse -336 -343 9.18389 0.211
NP_442262.1_10 Forward -47 -40 9.18389 0.211
NP_442262.1_10 Reverse -25 -32 8.10225 0.257
NP_441689.1_5 Reverse -243 -253 8.43603 0.132
NP_441689.1_5 Reverse -22 -32 7.94438 0.18
NP_441689.1_5 Forward -256 -246 5.78111 0.197
NP_442244.1_6 Reverse -72 -91 -1.57384 0.299
NP_440344.1_10 Forward -261 -244 -7.53264 0.118
NP_440344.1_10 Reverse -238 -255 -8.12263 0.123
NP_440282.1_10 Forward -354 -335 -9.047 0.269
NP_440282.1_10 Reverse -247 -266 -10.3253 0.297
NP_440531.1_6 Reverse -114 -133 4.71934 0.122
NP_440531.1_6 Forward -268 -249 1.67108 0.17
NP_442910.1_1 Forward -261 -242 -8.26035 0.289
NP_440562.1_3 Forward -253 -236 4.26707 0.199
NP_441965.1_10 Reverse -242 -258 15.5948 0.061
NP_441640.1_8 Forward -53 -34 6.19431 0.111
NP_441640.1_8 Reverse -252 -271 -0.4922 0.197
NP_442693.1_7 Reverse -244 -263 8.94757 0.262
NP_440297.1_9 Reverse -252 -262 6.17489 0.2
NP_440297.1_9 Reverse -336 -346 -0.118297 0.282
NP_440297.1_9 Reverse -246 -256 -0.118297 0.282
NP_440297.1_9 Forward -343 -333 -0.216628 0.282
NP_440297.1_9 Forward -253 -243 -0.314959 0.282
NP_442280.1_10 Reverse -160 -178 7.79204 0.268
NP_441592.1_4 Forward -344 -325 4.71934 0.144
NP_441592.1_4 Reverse -245 -264 3.6377 0.171
NP_441896.1_3 Reverse -236 -255 -3.14714 0.297
NP_440894.1_10 Reverse -240 -259 8.55425 0.175
NP_440894.1_10 Forward -271 -252 4.32602 0.254
NP_440999.1_9 Reverse -241 -255 2.06454 0.154
NP_440999.1_9 Forward -258 -244 0.687908 0.177
NP_440888.1_2 Forward -254 -240 15.0436 0.013
NP_440888.1_2 Reverse -348 -362 10.6187 0.0893
NP_440888.1_2 Reverse -245 -259 8.94708 0.142
NP_440888.1_4 Reverse -336 -350 15.6527 0.237
NP_442454.1_2 Forward -159 -140 8.45061 0.291
NP_439969.1_3 Forward -349 -330 9.73422 0.116
NP_442948.1_2 Forward -38 -19 5.01433 0.256
NP_441123.1_6 Reverse -84 -102 13.5888 0.133
NP_441543.1_2 Reverse -246 -255 16.9127 0.00359
NP_441543.1_2 Forward -253 -244 15.9293 0.00518
NP_441543.1_2 Reverse -40 -49 5.50626 0.197
NP_442845.1_2 Forward -260 -246 16.8142 0.0608
NP_442845.1_2 Reverse -239 -253 12.1926 0.114
NP_442845.1_2 Reverse -39 -53 11.3077 0.131
NP_442845.1_2 Reverse -245 -259 6.98109 0.199
NP_442845.1_2 Reverse -211 -225 4.22782 0.264
NP_442845.1_2 Forward -102 -88 3.53951 0.287
NP_441551.1_5 Forward -37 -21 10.3826 0.193
NP_441178.1_6 Forward -354 -335 3.63691 0.269
NP_441469.1_8 Reverse -244 -253 6.5879 0.227
NP_441469.1_8 Forward -255 -246 6.48957 0.227
NP_443064.1_6 Reverse -245 -255 12.5669 0.0796
NP_443064.1_6 Forward -254 -244 10.8217 0.13
NP_443064.1_6 Reverse -28 -38 9.07643 0.247
NP_442578.1_7 Forward -253 -246 14.5921 0.026
NP_442578.1_7 Reverse -246 -253 14.5921 0.026
NP_442578.1_7 Forward -47 -40 11.4455 0.0898
NP_440220.1_4 Reverse -32 -51 -2.16459 0.266
NP_441462.1_2 Forward -254 -244 20.2362 0.000805
NP_441462.1_2 Reverse -245 -255 11.5831 0.00406
NP_441462.1_5 Forward -373 -354 5.211 0.258
NP_441621.1_7 Reverse -243 -257 -2.75368 0.188
NP_441621.1_7 Forward -256 -242 -5.21195 0.248
NP_441621.1_7 Reverse -379 -393 -5.9986 0.27
NP_443062.1_1 Forward -378 -360 11.4711 0.0984
NP_443062.1_1 Reverse -28 -46 6.01073 0.211
NP_443062.1_1 Reverse -45 -63 4.64563 0.255
NP_443062.1_1 Forward -254 -236 3.76806 0.285
NP_441601.1_2 Reverse -290 -309 -2.75381 0.273
NP_440519.1_8 Reverse -284 -300 4.48343 0.223
NP_442204.1_1 Forward -258 -247 8.7118 0.0852
NP_442204.1_1 Forward -52 -41 -0.236322 0.289
NP_441560.1_8 Reverse -87 -106 13.5579 0.205
NP_441351.1_8 Forward -195 -176 3.83436 0.23
NP_442487.1_3 Forward -259 -240 17.2074 0.19
NP_440516.1_6 Reverse -93 -107 9.14375 0.238
NP_440516.1_8 Forward -254 -245 16.9127 0.00442
NP_440516.1_8 Reverse -245 -254 16.9127 0.00442
NP_442428.1_4 Forward -102 -83 3.34271 0.242
NP_442428.1_5 Forward -253 -246 15.8704 0.0124
NP_442428.1_5 Reverse -246 -253 15.8704 0.0124
NP_442428.1_5 Forward -32 -25 4.46401 0.267
NP_442428.1_5 Forward -53 -46 4.36568 0.271
NP_441443.1_10 Forward -258 -240 4.73828 0.268
NP_440673.1_2 Reverse -235 -254 8.341 0.273
NP_440673.1_3 Forward -252 -245 12.4288 0.0426
NP_440673.1_3 Reverse -247 -254 12.4288 0.0426
NP_440673.1_3 Reverse -166 -173 7.80726 0.244
NP_440673.1_7 Forward -59 -40 -0.0988766 0.283
NP_441052.1_2 Reverse -245 -255 19.9412 0.00106
NP_441052.1_2 Forward -254 -244 10.4031 0.0285
NP_441052.1_2 Reverse -251 -261 4.89658 0.14
NP_441052.1_2 Reverse -335 -345 0.865012 0.256
NP_442219.1_8 Forward -264 -245 13.2887 0.153
NP_442219.1_9 Reverse -246 -255 17.7976 0.00718
NP_442219.1_9 Forward -253 -244 8.25953 0.0681
NP_440436.1_4 Reverse -246 -255 17.2072 0.00233
NP_440436.1_4 Forward -253 -244 9.24241 0.0871
NP_442086.1_3 Forward -253 -234 6.98095 0.285
NP_440314.1_9 Forward -253 -234 0.392778 0.0952
NP_441719.1_4 Forward -253 -246 16.3621 0.0124
NP_441719.1_4 Reverse -246 -253 16.3621 0.0124
NP_441719.1_4 Forward -47 -40 3.77569 0.285
NP_441733.1_10 Reverse -242 -255 6.01747 0.203
NP_441004.1_1 Forward -372 -353 -10.6203 0.224
NP_441004.1_1 Forward -390 -371 -12.9802 0.251
NP_441004.1_1 Forward -179 -160 -13.5702 0.259
NP_441004.1_1 Reverse -206 -225 -16.8151 0.287
NP_441004.1_1 Reverse -239 -258 -18.1918 0.298
NP_441004.1_2 Forward -377 -358 -2.16383 0.263
NP_441004.1_2 Reverse -201 -220 -3.44213 0.28
NP_441004.1_4 Reverse -209 -219 9.32148 0.259
NP_442366.1_3 Reverse -244 -262 5.82068 0.0829
NP_442366.1_5 Forward -257 -247 14.0409 0.0497
NP_442366.1_5 Forward -359 -349 10.5993 0.251
NP_440129.1_10 Forward -291 -277 3.44117 0.209
NP_442873.1_5 Reverse -160 -179 7.17681 0.282
NP_441115.1_4 Reverse -256 -274 10.5398 0.173
NP_441115.1_4 Reverse -244 -262 8.96649 0.229
NP_440328.1_4 Forward -260 -241 9.43923 0.0991
NP_443054.1_2 Reverse -333 -347 0.0979218 0.278
NP_440864.1_9 Reverse -160 -179 1.96607 0.139
NP_441851.1_10 Forward -255 -245 15.8113 0.00552
NP_441851.1_10 Reverse -244 -254 8.53483 0.114
NP_441668.1_4 Forward -264 -245 -0.0988766 0.248
NP_442515.1_1 Forward -255 -241 15.8309 0.0227
NP_442515.1_1 Reverse -302 -316 -0.983719 0.241
NP_442515.1_1 Forward -162 -148 -4.7203 0.298
NP_441396.1_5 Forward -362 -353 7.27622 0.29
NP_440593.1_3 Reverse -240 -259 -0.787193 0.209
NP_440593.1_9 Forward -99 -85 9.14437 0.255
NP_441349.1_10 Forward -264 -245 -7.27704 0.247
NP_441409.1_6 Reverse -239 -258 -5.50708 0.106
NP_441409.1_6 Reverse -39 -58 -9.14533 0.18
NP_441409.1_6 Forward -54 -35 -12.1936 0.225
NP_441394.1_2 Reverse -63 -82 15.5357 0.265
NP_440432.1_2 Reverse -342 -361 23.3039 0.00197
NP_440432.1_9 Forward -253 -238 5.19144 0.0578
NP_440432.1_9 Reverse -4 -19 -5.52664 0.253
NP_439960.1_10 Forward -261 -243 -4.70074 0.296
NP_440474.1_8 Forward -253 -239 12.9786 0.0776
NP_440431.1_3 Reverse -244 -263 6.68596 0.0886
NP_442450.1_5 Forward -256 -246 7.55152 0.13
NP_440588.1_2 Forward -263 -244 -2.26216 0.163
NP_439950.1_1 Forward -164 -155 14.7494 0.195
NP_442006.1_2 Reverse -251 -268 -16.8741 0.265
NP_441003.1_9 Reverse -161 -180 3.93269 0.291
NP_440483.1_1 Forward -200 -181 1.27776 0.187
NP_440483.1_1 Forward -319 -300 -7.57203 0.266
NP_440483.1_2 Reverse -240 -259 16.4207 0.117
NP_440078.1_10 Reverse -245 -264 8.25926 0.208
NP_441078.1_4 Forward -254 -245 19.6659 0.0007
NP_441078.1_4 Reverse -245 -254 19.6659 0.0007
NP_441078.1_4 Reverse -39 -48 -1.57357 0.266
NP_441078.1_4 Reverse -335 -344 -1.6719 0.266
NP_441078.1_4 Forward -344 -335 -1.77023 0.266
NP_442729.1_8 Reverse -241 -254 11.4257 0.125
NP_440707.1_9 Reverse -285 -304 0.58944 0.293
NP_440526.1_3 Reverse -246 -257 8.02298 0.126
NP_440526.1_3 Forward -253 -242 2.41814 0.267
NP_441432.1_8 Reverse -244 -253 16.8143 0.00595
NP_441432.1_8 Forward -255 -246 16.8143 0.00595
NP_441432.1_8 Forward -261 -252 3.44131 0.245
NP_441432.1_8 Reverse -217 -226 2.75299 0.287
NP_442320.1_8 Reverse -239 -253 -0.983719 0.0817
NP_442320.1_8 Forward -260 -246 -2.26202 0.0871
NP_442320.1_8 Forward -54 -40 -6.19526 0.269
NP_442344.1_7 Reverse -246 -265 0.196116 0.1
NP_441732.1_2 Forward -258 -242 2.22182 0.0253
NP_441732.1_2 Reverse -241 -257 -15.5761 0.151
NP_441732.1_2 Reverse -344 -360 -16.0677 0.164
NP_441732.1_2 Reverse -35 -51 -16.8544 0.207
NP_442343.1_1 Forward -85 -66 15.9291 0.271
NP_442003.1_4 Forward -53 -34 16.1257 0.19
NP_440760.1_1 Reverse -245 -264 -13.5702 0.107
NP_440760.1_1 Forward -254 -235 -20.945 0.226
NP_442274.1_8 Forward -394 -376 15.6694 0.235
NP_440913.1_1 Reverse -333 -351 4.73903 0.257
NP_441072.1_2 Forward -265 -246 13.6675 0.159
NP_441072.1_2 Reverse -241 -260 5.80098 0.296
NP_440713.1_4 Forward -264 -245 3.83436 0.237
NP_442489.1_2 Forward -271 -252 7.07928 0.172
NP_442489.1_7 Forward -254 -245 20.1576 0.000695
NP_442489.1_7 Reverse -245 -254 20.1576 0.000695
NP_442489.1_7 Forward -344 -335 5.21127 0.077
NP_442489.1_7 Reverse -335 -344 -1.6719 0.235
NP_440941.1_1 Forward -197 -187 18.4663 0.127
NP_442079.1_7 Forward -53 -34 1.76941 0.241
NP_442079.1_7 Forward -253 -234 1.67108 0.244
NP_440559.1_1 Reverse -246 -255 17.4043 0.00658
NP_440559.1_1 Forward -253 -244 8.65285 0.0586
NP_441659.2_8 Forward -254 -244 20.9245 0.000805
NP_441659.2_8 Reverse -245 -255 18.1713 0.00133
NP_441040.1_2 Forward -395 -376 -12.4886 0.256
NP_442008.1_2 Reverse -242 -261 3.73603 0.249
NP_440442.1_2 Reverse -372 -391 17.101 0.271
NP_442776.1_1 Reverse -246 -265 4.62101 0.274
NP_442346.1_5 Forward -255 -245 16.6963 0.00248
NP_442346.1_5 Reverse -244 -254 16.303 0.00248
NP_442346.1_5 Reverse -334 -344 6.8632 0.188
NP_442346.1_5 Forward -345 -335 6.17489 0.212
NP_442346.1_5 Forward -34 -24 4.89658 0.269
NP_440352.1_7 Forward -336 -323 17.3249 0.194
NP_440545.1_3 Forward -258 -241 13.3135 0.018
NP_440545.1_3 Forward -52 -35 1.61214 0.116
NP_440545.1_3 Reverse -88 -105 -5.66436 0.256
NP_440545.1_3 Reverse -241 -258 -6.64766 0.285
NP_441856.1_3 Forward -257 -238 0.196116 0.216
NP_440250.1_1 Reverse -207 -225 10.1472 0.273
NP_440459.1_2 Forward -353 -336 10.2653 0.204
NP_442603.1_7 Forward -254 -240 8.16044 0.183
NP_441047.1_2 Reverse -376 -395 -2.85214 0.281
NP_441833.1_4 Forward -253 -246 15.9687 0.0124
NP_441833.1_4 Reverse -246 -253 15.9687 0.0124
NP_441895.1_2 Forward -178 -159 -26.6482 0.246
NP_441895.1_2 Forward -179 -160 -26.7466 0.247
NP_442162.1_9 Forward -253 -246 16.2637 0.0124
NP_442162.1_9 Reverse -246 -253 16.2637 0.0124
NP_440671.1_4 Forward -260 -246 12.586 0.105
NP_442199.1_5 Reverse -237 -256 -4.91709 0.233
NP_442140.1_3 Reverse -246 -256 12.2714 0.0632
NP_442140.1_3 Forward -377 -367 11.3864 0.0767
NP_442140.1_3 Forward -253 -243 7.94484 0.124
NP_442140.1_3 Forward -350 -340 5.19158 0.221
NP_442021.1_3 Forward -260 -241 -5.60541 0.257
NP_440875.1_9 Forward -252 -242 8.66404 0.233
NP_441813.1_5 Reverse -243 -253 8.73149 0.0367
NP_441813.1_5 Forward -256 -246 8.63316 0.0367
NP_441813.1_5 Forward -56 -46 4.50326 0.155
NP_440594.1_6 Forward -260 -241 11.11 0.177
NP_440594.1_8 Forward -253 -240 19.1932 0.0537
NP_440590.1_4 Reverse -246 -259 10.934 0.0235
NP_440590.1_4 Forward -253 -240 3.36254 0.0746
NP_440567.1_1 Reverse -246 -260 13.0776 0.0213
NP_440567.1_1 Forward -253 -239 8.45605 0.0577
NP_440567.1_1 Reverse -40 -54 2.75286 0.164
NP_442497.1_10 Forward -253 -244 17.601 0.00813
NP_442497.1_10 Reverse -246 -255 10.4228 0.0087
NP_440821.1_4 Reverse -243 -253 10.7964 0.0146
NP_440821.1_4 Forward -256 -246 9.41981 0.0286
NP_441239.1_9 Reverse -243 -255 14.887 0.0247
NP_441239.1_9 Reverse -333 -345 6.52882 0.185
NP_441239.1_9 Reverse -22 -34 6.43049 0.189
NP_441239.1_9 Forward -353 -341 5.25052 0.223
NP_441239.1_9 Forward -346 -334 5.05386 0.231
NP_441239.1_9 Forward -256 -244 3.38223 0.285
NP_441727.1_3 Forward -261 -242 12.5858 0.127
NP_441892.1_1 Forward -263 -246 5.84037 0.0995
NP_441892.1_1 Forward -353 -336 1.61214 0.15
NP_442044.1_1 Forward -259 -240 -11.6036 0.271
NP_442193.1_1 Reverse -335 -353 8.57394 0.271
NP_442216.1_4 Reverse -155 -163 8.08217 0.255
NP_440546.1_4 Forward -254 -244 13.5365 0.0459
NP_440546.1_4 Forward -33 -23 11.7912 0.0712
NP_440546.1_4 Reverse -245 -255 10.046 0.109
NP_441230.1_5 Reverse -240 -259 5.40766 0.182
NP_441603.1_5 Forward -340 -321 20.9431 0.0797
NP_440675.1_1 Reverse -208 -227 5.99764 0.203
NP_440462.1_6 Reverse -243 -253 19.4496 0.00371
NP_440462.1_6 Forward -256 -246 1.35667 0.294
NP_442611.1_1 Forward -59 -40 -0.000545616 0.265
NP_442611.1_1 Forward -48 -29 -0.39387 0.266
NP_440868.1_4 Reverse -241 -253 9.38042 0.049
NP_440868.1_4 Forward -258 -246 6.1355 0.0878
NP_440868.1_7 Forward -92 -73 19.1731 0.0702
NP_441204.1_1 Forward -88 -69 13.7658 0.2
NP_442499.1_1 Forward -259 -240 4.42435 0.239
NP_442402.1_4 Forward -154 -135 -5.90115 0.249
NP_440653.1_10 Reverse -246 -265 18.289 0.0688
NP_440653.1_10 Reverse -336 -355 4.71934 0.246
NP_440843.1_8 Forward -260 -241 13.5691 0.297
NP_442039.1_4 Forward -253 -246 15.1821 0.0124
NP_442039.1_4 Reverse -246 -253 15.1821 0.0124
NP_441811.1_8 Forward -260 -246 7.47274 0.243
NP_441811.1_8 Forward -39 -25 6.3911 0.273
NP_442679.1_1 Reverse -255 -274 -2.85214 0.244
NP_440008.1_9 Forward -260 -241 14.9458 0.135
NP_440825.1_7 Reverse -246 -256 12.9096 0.152
NP_442837.1_3 Forward -253 -246 15.7721 0.0124
NP_442837.1_3 Reverse -246 -253 15.7721 0.0124
NP_442837.1_3 Reverse -29 -36 5.74231 0.275
NP_440160.1_9 Forward -48 -29 18.1907 0.115
NP_442053.1_1 Forward -254 -245 18.3876 0.0007
NP_442053.1_1 Reverse -245 -254 18.3876 0.0007
NP_440505.1_3 Reverse -243 -253 15.418 0.0114
NP_440505.1_3 Forward -256 -246 9.22315 0.122
NP_440505.1_3 Forward -50 -40 5.97822 0.202
NP_440505.1_3 Reverse -319 -329 5.09324 0.246
NP_440505.1_7 Reverse -192 -211 2.45773 0.235
NP_442360.1_5 Reverse -171 -181 15.2213 0.172
NP_441252.1_6 Forward -191 -184 11.6422 0.288
NP_442532.1_7 Forward -254 -240 5.1128 0.171
NP_441408.2_7 Reverse -243 -262 15.2408 0.0464
NP_440914.1_1 Reverse -245 -255 17.5935 0.000537
NP_440914.1_1 Forward -254 -244 16.3248 0.00196
NP_441011.1_8 Forward -253 -244 16.6177 0.00602
NP_441011.1_8 Reverse -246 -255 8.25953 0.144
NP_442533.1_1 Forward -205 -186 -13.8652 0.239
NP_442533.1_6 Forward -254 -245 17.2076 0.00137
NP_442533.1_6 Reverse -245 -254 17.2076 0.00137
NP_442533.1_6 Forward -344 -335 6.8829 0.101
NP_442533.1_6 Reverse -335 -344 6.78456 0.103
NP_442533.1_6 Reverse -93 -102 3.63797 0.206
NP_442232.1_3 Forward -262 -243 -15.9302 0.299
NP_442229.1_1 Reverse -243 -257 8.25877 0.184
NP_441482.1_7 Forward -260 -246 0.982901 0.0554
NP_439944.1_9 Forward -253 -243 17.7779 0.00341
NP_439944.1_9 Reverse -246 -256 10.5014 0.0887
NP_439944.1_9 Forward -32 -22 9.7148 0.1
NP_439944.1_9 Reverse -40 -50 6.46988 0.179
NP_441028.1_6 Forward -274 -264 5.68278 0.243
NP_441028.1_6 Reverse -29 -39 3.42118 0.296
NP_440116.1_5 Forward -257 -240 7.90532 0.155
NP_440115.1_6 Forward -90 -80 14.3364 0.0615
NP_440115.1_6 Forward -257 -247 9.32148 0.115
NP_440115.1_6 Reverse -242 -252 7.74818 0.146
NP_440007.1_9 Forward -58 -44 5.1128 0.265
NP_440007.1_9 Forward -264 -250 2.85119 0.277
NP_440007.1_9 Forward -258 -244 1.37622 0.285
NP_441680.1_4 Reverse -376 -395 1.17943 0.246
NP_443045.1_3 Reverse -91 -110 20.2556 0.184
NP_441972.1_5 Reverse -336 -355 0.786102 0.146
NP_441106.1_1 Reverse -244 -253 18.486 0.0028
NP_441106.1_1 Forward -255 -246 9.63616 0.0311
NP_439903.1_6 Reverse -242 -261 18.9765 0.0527
NP_442306.1_10 Reverse -240 -259 -19.4701 0.197
NP_440797.1_2 Forward -265 -246 12.0828 0.283
NP_441286.1_1 Forward -255 -243 14.6903 0.00418
NP_441286.1_1 Reverse -244 -256 3.48056 0.0467
NP_440670.1_8 Forward -254 -245 18.3876 0.000699
NP_440670.1_8 Reverse -245 -254 18.3876 0.000699
NP_440886.1_7 Reverse -186 -196 9.02601 0.0805
NP_440886.1_7 Reverse -244 -254 8.04271 0.0805
NP_440886.1_7 Forward -255 -245 7.94438 0.0805
NP_440828.1_4 Reverse -241 -260 -6.09781 0.265
NP_442614.1_2 Reverse -245 -259 7.17775 0.275
NP_442072.1_9 Forward -255 -237 -11.2889 0.0789
NP_442072.1_9 Reverse -244 -262 -22.007 0.216
NP_442072.1_9 Reverse -91 -109 -23.187 0.284
NP_440907.2_8 Forward -253 -243 19.1541 0.00362
NP_440907.2_8 Reverse -246 -256 7.64939 0.117
NP_442264.1_2 Forward -264 -247 9.77361 0.194
NP_442264.1_5 Reverse -245 -259 14.7492 0.222
NP_441021.1_1 Forward -343 -324 -7.08038 0.181
NP_441021.1_1 Reverse -246 -265 -11.8003 0.274
NP_441463.1_3 Reverse -371 -390 -0.787193 0.133
NP_441463.1_3 Forward -264 -245 -9.44032 0.28
NP_440501.1_4 Forward -179 -160 -7.57203 0.285
NP_442842.1_10 Reverse -153 -172 1.0479 0.254
NP_441626.1_2 Forward -253 -246 15.7721 0.0124
NP_441626.1_2 Reverse -246 -253 15.7721 0.0124
NP_441626.1_2 Forward -47 -40 4.66067 0.267
NP_442794.1_1 Forward -258 -246 21.9668 0.00123
NP_442615.1_1 Reverse -236 -254 10.8356 0.0193
NP_442615.1_1 Forward -263 -245 9.95058 0.0228
NP_441962.1_4 Forward -259 -240 3.04771 0.102
NP_441962.1_4 Forward -101 -82 -9.34199 0.215
NP_441962.1_4 Reverse -246 -265 -11.8003 0.245
NP_440387.1_1 Reverse -245 -261 13.3332 0.00865
NP_440387.1_1 Forward -254 -238 7.33503 0.0282
NP_441431.1_2 Reverse -242 -256 7.76712 0.234
NP_441431.1_2 Reverse -355 -369 7.47213 0.241
NP_441431.1_2 Reverse -89 -103 6.0955 0.28
NP_441488.1_8 Forward -259 -245 13.077 0.146
NP_441488.1_8 Reverse -40 -54 8.06211 0.209
NP_441488.1_8 Reverse -337 -351 7.96378 0.214
NP_441836.1_1 Forward -265 -246 12.2785 0.259
NP_441836.1_2 Reverse -239 -258 13.5691 0.0686
NP_441993.1_1 Forward -260 -241 8.86616 0.136
NP_441993.1_1 Reverse -336 -355 2.72635 0.254
NP_440467.1_3 Forward -265 -246 13.1118 0.209
NP_440114.1_10 Forward -254 -240 12.4876 0.0814
NP_440114.1_10 Reverse -45 -59 10.1277 0.153
NP_440114.1_10 Reverse -342 -356 7.76774 0.227
NP_442323.1_7 Reverse -34 -53 5.80018 0.202
NP_442323.1_7 Forward -259 -240 1.08032 0.292
NP_440287.1_6 Forward -263 -244 7.7676 0.151
NP_440293.1_3 Forward -262 -243 2.85105 0.192
NP_439988.1_3 Forward -106 -92 11.406 0.219
NP_439988.1_3 Forward -355 -341 4.71948 0.292
NP_441237.1_9 Reverse -246 -256 14.828 0.0242
NP_442743.1_5 Reverse -252 -271 4.52268 0.215
NP_439910.1_2 Reverse -237 -254 -12.6459 0.0924
NP_440457.1_1 Forward -258 -246 -0.452677 0.263
NP_440457.1_1 Forward -52 -40 -0.944332 0.285
NP_442940.1_2 Reverse -245 -264 -0.197208 0.296
NP_442680.1_5 Forward -163 -144 8.47361 0.165
NP_440142.1_7 Reverse -246 -265 9.63589 0.21
NP_442297.1_4 Forward -258 -239 18.7545 0.128
NP_441984.1_3 Reverse -331 -349 9.95058 0.195
NP_441984.1_3 Reverse -241 -259 8.57394 0.224
NP_442509.1_9 Reverse -245 -255 8.14104 0.192
NP_442509.1_9 Forward -254 -244 8.04271 0.192
NP_440081.1_1 Forward -38 -19 14.1591 0.281
NP_442514.1_5 Forward -352 -333 -7.27777 0.276
NP_440554.1_4 Forward -253 -243 15.418 0.0199
NP_440554.1_4 Reverse -46 -56 6.56821 0.121
NP_440554.1_4 Reverse -25 -35 2.14332 0.276
NP_441885.1_5 Reverse -245 -255 20.9245 0.000538
NP_441885.1_5 Forward -254 -244 11.3864 0.00668
NP_441885.1_5 Reverse -39 -49 -0.0199663 0.186
NP_440478.1_4 Reverse -35 -54 14.8474 0.161
NP_441428.1_8 Forward -262 -243 6.29264 0.226
NP_442341.1_7 Forward -255 -241 8.35772 0.0881
NP_442341.1_7 Reverse -244 -258 7.66941 0.0994
NP_442341.1_9 Reverse -243 -257 12.6836 0.0984
NP_443000.1_7 Reverse -243 -253 10.7964 0.0345
NP_443000.1_7 Forward -256 -246 10.3048 0.0345
NP_441842.1_1 Forward -252 -239 10.3434 0.3
NP_440275.1_3 Reverse -243 -253 18.6629 0.0082
NP_440275.1_3 Forward -256 -246 8.04317 0.0602
NP_441397.1_8 Forward -165 -152 12.8577 0.255
NP_440679.1_5 Reverse -248 -267 11.0125 0.279
NP_443010.1_10 Reverse -25 -42 3.9304 0.246
NP_439962.1_4 Forward -181 -162 -7.27704 0.288
NP_441105.1_3 Forward -265 -246 18.0924 0.0104
NP_442373.1_1 Forward -366 -347 -11.1119 0.29
NP_442373.1_2 Reverse -216 -235 -9.73531 0.265
NP_440216.1_1 Forward -254 -240 -2.75368 0.0574
NP_440216.1_1 Reverse -245 -259 -10.3252 0.145
NP_440216.1_1 Forward -48 -34 -12.0951 0.24
NP_440172.1_1 Forward -254 -244 17.5813 0.00421
NP_440172.1_1 Reverse -245 -255 15.0247 0.00945
NP_440172.1_1 Forward -33 -23 5.48657 0.143
NP_442015.1_10 Forward -258 -245 19.8821 0.00366
NP_441226.1_7 Forward -253 -246 14.4934 0.0123
NP_441226.1_7 Reverse -246 -253 14.4934 0.0123
NP_441226.1_7 Reverse -46 -53 12.4284 0.0404
NP_441226.1_7 Reverse -187 -194 5.34865 0.289
NP_441485.1_9 Reverse -207 -226 15.2408 0.283
NP_442222.1_7 Forward -91 -72 22.7139 0.0351
NP_441111.1_7 Forward -253 -245 18.7023 0.00294
NP_441111.1_7 Reverse -246 -254 18.7023 0.00294
NP_442379.1_10 Forward -261 -244 -1.53445 0.223
NP_441766.1_2 Forward -254 -245 17.5026 0.00297
NP_441766.1_2 Reverse -245 -254 17.5026 0.00297
NP_440416.1_9 Forward -261 -242 -5.99873 0.0854
NP_440416.1_9 Reverse -374 -393 -6.98204 0.0951
NP_442116.1_6 Forward -148 -131 6.25912 0.283
NP_440845.1_1 Reverse -334 -353 -5.01543 0.239
NP_440591.1_9 Forward -261 -243 12.9988 0.0931
NP_442154.1_1 Reverse -282 -300 -13.6489 0.217
NP_440261.1_5 Forward -253 -240 6.50913 0.0332
NP_440261.1_5 Reverse -246 -259 -10.4038 0.201
NP_440988.1_10 Reverse -243 -257 6.54464 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAATCTTCCCGGCTGTCGTAGTCCCGATGGTTGAGTAATCGGTGGGGCACCCCATGGTCCATGGCCCGTTTCCTAACCCCAGCATTAGGGTTGTTGTAAATCACCAGTTTCACCACTGCATTTAACTTTCCCTCCTTAATGGCCTTGGCGATCGCCTCAAAATTACTACCACTACCGGATGCCATTATCCCAAGGGATAAACAGCGGGGTTGGGGAATATTCCCTAAAGCAACGGGGGGGGAAATAAAACTCAAGTTATTCGACAAATCTGACATAGCCGACATAGGTTAAAAATTAGGGGCTTGGGCCCCGGAGCAATCCTGCCCTCAACGGGCTAACTTTGACATCCGATGGCGATAGAATGGGGAGCGATGTCTTTATAAAATGAGGTTAACGCGAT

CDS

ATGACCCCTTCTTTAGCAAACTTTCTCTGGAGCCTGGTTTTAGGGGCTGCCATTGTGCTGATCCCCGCCACCGTCGGGTTAATTTTCATCAGCCAAAAAGACAAAATCACCCGTTCCTAG

Protein

MTPSLANFLWSLVLGAAIVLIPATVGLIFISQKDKITRS