Your browser is old and dusty. Try Google Chrome!

Details for sml0001

ORF sml0001
Accession NP_442015.1
Symbol psbI
Category Photosystem II
Definition photosystem II reaction center PsbI protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -193 -207 10.521 0.0605
NP_441061.1_2 Forward -200 -186 2.5562 0.174
NP_440795.1_7 Forward -200 -193 14.6904 0.0123
NP_440795.1_7 Reverse -193 -200 14.6904 0.0123
NP_441418.1_6 Reverse -192 -211 -8.85033 0.0273
NP_441418.1_6 Forward -201 -182 -11.8986 0.0576
NP_440897.1_6 Reverse -192 -211 -1.27961 0.187
NP_441453.1_1 Reverse -185 -203 6.99988 0.221
NP_441453.1_4 Reverse -192 -200 16.539 0.00633
NP_441453.1_4 Forward -201 -193 16.539 0.00633
NP_441453.1_4 Forward -121 -113 3.756 0.288
NP_441960.1_3 Reverse -232 -251 12.364 0.299
NP_442151.1_6 Forward -201 -187 19.5675 0.0045
NP_442151.1_6 Forward -121 -107 9.2427 0.155
NP_442151.1_6 Reverse -218 -232 8.35772 0.175
NP_441818.1_1 Forward -200 -189 11.4645 0.177
NP_441818.1_1 Reverse -193 -204 9.79292 0.232
NP_441818.1_9 Reverse -104 -123 -10.1286 0.292
NP_441630.1_3 Reverse -184 -203 2.0644 0.235
NP_441630.1_3 Forward -209 -190 1.86774 0.236
NP_440348.1_6 Reverse -164 -183 4.32602 0.251
NP_440150.1_6 Reverse -189 -208 10.3242 0.172
NP_442744.1_8 Forward -201 -182 -5.9004 0.297
NP_442744.1_8 Reverse -112 -131 -6.78538 0.297
NP_442655.1_10 Reverse -109 -128 -19.7651 0.289
NP_443002.1_5 Forward -112 -94 7.98318 0.299
NP_442173.1_1 Forward -200 -192 15.4574 0.00633
NP_442173.1_1 Reverse -193 -201 15.4574 0.00633
NP_442752.1_4 Forward -201 -194 13.8055 0.0199
NP_442752.1_4 Reverse -192 -199 13.8055 0.0199
NP_442752.1_4 Forward -266 -259 5.54565 0.194
NP_443027.1_4 Forward -203 -193 11.0914 0.107
NP_443027.1_4 Forward -268 -258 8.1415 0.218
NP_443027.1_4 Forward -123 -113 8.1415 0.218
NP_443027.1_4 Reverse -190 -200 6.46988 0.275
NP_441745.1_3 Forward -198 -179 16.5182 0.211
NP_442975.1_10 Reverse -188 -202 11.602 0.0497
NP_440784.1_7 Forward -200 -193 15.9687 0.0123
NP_440784.1_7 Reverse -193 -200 15.9687 0.0123
NP_440061.1_9 Forward -203 -189 20.0584 0.0045
NP_440061.1_9 Forward -123 -109 6.0955 0.261
NP_440110.1_4 Forward -212 -193 9.63589 0.125
NP_440110.1_8 Reverse -190 -209 3.73603 0.211
NP_440110.1_8 Forward -203 -184 -0.4922 0.225
NP_441054.1_4 Reverse -102 -120 -3.81576 0.285
NP_442062.1_8 Forward -201 -191 17.6796 0.00193
NP_442062.1_8 Reverse -192 -202 17.3846 0.00193
NP_442062.1_8 Forward -121 -111 4.50326 0.212
NP_442062.1_8 Reverse -253 -263 3.51995 0.267
NP_440304.1_4 Reverse -190 -200 17.9746 0.00654
NP_440304.1_4 Reverse -110 -120 6.56821 0.15
NP_440304.1_4 Forward -203 -193 1.84832 0.299
NP_442242.1_4 Forward -200 -193 14.3954 0.0124
NP_442242.1_4 Reverse -193 -200 14.3954 0.0124
NP_440044.1_8 Reverse -193 -212 2.85105 0.143
NP_440044.1_8 Forward -200 -181 -2.16383 0.261
NP_439918.1_2 Reverse -98 -117 1.0811 0.217
NP_441620.1_5 Forward -181 -162 17.3057 0.131
NP_441208.1_9 Reverse -109 -123 5.21113 0.275
NP_441594.1_6 Reverse -183 -202 5.60432 0.209
NP_442196.1_10 Forward -203 -184 11.9958 0.224
NP_442742.1_9 Reverse -334 -353 -7.57203 0.248
NP_442110.1_7 Forward -201 -187 2.2612 0.222
NP_442110.1_7 Reverse -192 -206 1.67122 0.222
NP_440856.1_4 Forward -208 -189 9.73422 0.0546
NP_440856.1_4 Reverse -133 -152 7.57094 0.0666
NP_440856.1_4 Reverse -327 -346 -4.13045 0.25
NP_440856.1_7 Reverse -189 -208 4.916 0.141
NP_441083.1_5 Reverse -192 -202 20.3345 0.00053
NP_441083.1_5 Forward -201 -191 19.3512 0.000718
NP_441083.1_5 Forward -121 -111 0.176696 0.241
NP_442827.1_8 Reverse -184 -203 9.34008 0.0705
NP_442827.1_8 Forward -270 -251 0.195343 0.214
NP_442827.1_8 Forward -209 -190 -0.492971 0.228
NP_441434.1_7 Forward -199 -185 3.93283 0.225
NP_441738.1_2 Forward -199 -192 15.28 0.0102
NP_441738.1_2 Reverse -194 -201 15.28 0.0102
NP_441558.1_5 Reverse -110 -129 13.7658 0.0561
NP_441558.1_5 Forward -203 -184 11.2092 0.0852
NP_441558.1_5 Forward -159 -140 7.57094 0.176
NP_440209.1_1 Reverse -192 -200 18.1123 0.00295
NP_440209.1_1 Forward -201 -193 18.1123 0.00295
NP_442889.1_8 Reverse -189 -203 9.83206 0.0943
NP_440447.1_1 Reverse -135 -153 5.13236 0.218
NP_441713.1_3 Reverse -103 -122 14.7491 0.13
NP_442570.1_3 Forward -203 -184 -7.17871 0.268
NP_441716.1_1 Reverse -192 -206 17.2075 0.0287
NP_442111.1_4 Forward -202 -188 21.1407 0.00255
NP_442111.1_4 Reverse -191 -205 11.8976 0.0469
NP_441624.1_7 Forward -144 -130 5.99778 0.296
NP_441163.1_1 Forward -139 -122 11.3462 0.191
NP_441163.1_1 Reverse -184 -201 5.93797 0.267
NP_440906.1_5 Forward -200 -193 15.8704 0.0124
NP_440906.1_5 Reverse -193 -200 15.8704 0.0124
NP_440747.1_10 Forward -204 -192 26.5883 0.000317
NP_440747.1_10 Reverse -189 -201 -2.02597 0.0196
NP_440747.1_10 Forward -124 -112 -2.61596 0.0556
NP_441130.1_10 Reverse -190 -204 8.25939 0.139
NP_441130.1_10 Forward -203 -189 6.98109 0.173
NP_441486.1_1 Reverse -126 -140 -0.688726 0.16
NP_441486.1_1 Forward -204 -190 -2.65535 0.175
NP_441486.1_1 Forward -269 -255 -5.40861 0.237
NP_442634.1_4 Reverse -190 -204 5.01447 0.0671
NP_442634.1_4 Forward -203 -189 -3.34366 0.161
NP_442634.1_4 Reverse -110 -124 -5.90027 0.284
NP_441265.1_3 Reverse -186 -200 3.53951 0.181
NP_440403.1_4 Forward -210 -191 10.4225 0.0704
NP_440403.1_4 Reverse -183 -202 -6.1954 0.23
NP_440403.1_4 Reverse -313 -332 -10.1286 0.295
NP_440403.1_10 Reverse -183 -202 1.57275 0.288
NP_440842.1_10 Reverse -189 -203 1.27789 0.294
NP_441014.1_5 Reverse -187 -205 13.2938 0.216
NP_442848.1_1 Forward -207 -193 -0.983719 0.263
NP_443018.1_3 Forward -200 -193 14.8871 0.0123
NP_443018.1_3 Reverse -193 -200 14.8871 0.0123
NP_443018.1_3 Reverse -113 -120 4.07068 0.299
NP_441634.1_8 Forward -203 -189 6.48943 0.114
NP_441634.1_8 Reverse -93 -107 -3.147 0.295
NP_441634.1_8 Reverse -311 -325 -4.81863 0.298
NP_441634.1_9 Reverse -193 -212 8.65176 0.294
NP_440376.1_1 Forward -201 -192 19.4693 0.000692
NP_440376.1_1 Reverse -192 -201 19.4693 0.000692
NP_440376.1_1 Reverse -112 -121 6.68623 0.0902
NP_440376.1_1 Forward -121 -112 -0.196935 0.285
NP_442687.1_7 Reverse -191 -201 18.5646 0.0028
NP_442687.1_7 Forward -202 -192 8.92815 0.0994
NP_442687.1_7 Forward -122 -112 4.40493 0.249
NP_442687.1_7 Forward -344 -334 3.91327 0.278
NP_442485.1_3 Forward -212 -193 2.16274 0.215
NP_442485.1_3 Reverse -190 -209 -5.99873 0.297
NP_441846.1_10 Reverse -191 -210 -23.305 0.282
NP_440642.1_10 Reverse -71 -85 3.73557 0.265
NP_441013.1_2 Reverse -329 -347 7.29564 0.208
NP_440042.1_2 Reverse -332 -351 1.86774 0.199
NP_440533.1_9 Reverse -112 -131 2.94938 0.261
NP_440667.1_10 Forward -362 -343 13.9625 0.233
NP_442658.1_1 Reverse -190 -200 17.6791 0.00565
NP_442658.1_1 Forward -203 -193 7.94438 0.199
NP_442658.1_1 Reverse -110 -120 7.0594 0.214
NP_442658.1_1 Reverse -17 -27 5.58445 0.262
NP_440141.1_8 Reverse -103 -122 9.63589 0.214
NP_440141.1_8 Reverse -183 -202 4.22769 0.292
NP_441855.2_4 Reverse -184 -203 15.0183 0.136
NP_442782.1_2 Forward -343 -329 0.88457 0.282
NP_442205.1_9 Forward -272 -256 -3.8747 0.297
NP_441487.1_9 Forward -63 -44 -1.7705 0.287
NP_442937.1_5 Reverse -314 -333 11.7008 0.132
NP_442937.1_5 Forward -206 -187 9.53756 0.187
NP_442321.1_1 Reverse -190 -209 -0.787193 0.175
NP_442321.1_1 Forward -203 -184 -7.4737 0.262
NP_442321.1_4 Forward -130 -111 -5.70374 0.284
NP_441958.1_5 Reverse -191 -201 20.5312 0.000966
NP_441958.1_5 Forward -202 -192 12.2714 0.00183
NP_441958.1_5 Reverse -111 -121 1.06167 0.116
NP_441127.1_1 Forward -272 -258 9.93102 0.267
NP_439905.1_1 Forward -200 -187 7.49244 0.258
NP_439905.1_2 Reverse -329 -343 8.65272 0.253
NP_439905.1_3 Forward -142 -123 13.4708 0.202
NP_440984.1_7 Reverse -187 -201 12.291 0.122
NP_439990.1_5 Forward -206 -193 13.884 0.0889
NP_442376.1_2 Reverse -187 -206 -11.8003 0.286
NP_442911.1_2 Reverse -182 -201 -2.26216 0.096
NP_442911.1_2 Forward -131 -112 -3.04881 0.107
NP_442911.1_2 Reverse -102 -121 -5.70374 0.165
NP_441580.1_6 Reverse -181 -200 4.62101 0.117
NP_440153.1_5 Forward -200 -186 4.91614 0.193
NP_442064.1_4 Forward -211 -192 16.6165 0.116
NP_443055.1_6 Forward -215 -197 -2.04653 0.287
NP_440993.1_2 Forward -206 -190 3.69678 0.256
NP_440993.1_2 Reverse -187 -203 3.59845 0.256
NP_440138.1_6 Reverse -193 -212 2.45694 0.267
NP_443044.1_1 Forward -75 -56 7.07928 0.258
NP_441099.1_5 Forward -211 -192 11.9958 0.02
NP_441099.1_5 Reverse -182 -201 -3.14714 0.131
NP_441099.1_5 Forward -341 -322 -9.93197 0.237
NP_441099.1_5 Forward -323 -304 -11.5053 0.283
NP_441099.1_8 Reverse -356 -374 11.6214 0.286
NP_442002.1_1 Reverse -101 -119 -6.56903 0.249
NP_442002.1_9 Reverse -191 -198 14.1004 0.074
NP_441294.1_7 Forward -332 -318 9.4426 0.244
NP_442438.1_10 Reverse -187 -201 2.06454 0.188
NP_442438.1_10 Forward -206 -192 0.88457 0.213
NP_441000.1_6 Reverse -191 -205 -2.95034 0.221
NP_442771.1_1 Reverse -320 -338 -1.06249 0.127
NP_442771.1_1 Reverse -190 -208 -4.01242 0.166
NP_442771.1_1 Forward -203 -185 -8.53565 0.198
NP_440147.1_4 Forward -203 -190 18.4072 0.00407
NP_440147.1_4 Forward -123 -110 14.3756 0.0255
NP_440147.1_4 Reverse -190 -203 11.6223 0.0326
NP_441175.1_7 Reverse -239 -258 9.83255 0.175
NP_441550.1_8 Reverse -190 -200 19.8424 0.00352
NP_441550.1_8 Forward -203 -193 15.1225 0.0132
NP_441916.1_7 Forward -201 -191 16.893 0.00407
NP_441916.1_7 Reverse -192 -202 10.3048 0.0261
NP_441916.1_7 Reverse -112 -122 5.97822 0.111
NP_441041.1_4 Reverse -112 -131 -7.57203 0.19
NP_441041.1_4 Reverse -192 -211 -9.34199 0.215
NP_441041.1_7 Reverse -189 -201 12.4708 0.0611
NP_441041.1_7 Forward -204 -192 7.51478 0.162
NP_440569.1_10 Forward -256 -237 14.6576 0.119
NP_441725.1_4 Forward -206 -192 13.372 0.0693
NP_441725.1_5 Forward -200 -190 18.7612 0.0119
NP_441725.1_5 Forward -120 -110 6.37155 0.115
NP_441725.1_5 Reverse -193 -203 2.04498 0.115
NP_439966.1_7 Forward -203 -193 15.3192 0.0152
NP_439966.1_7 Reverse -190 -200 8.14104 0.14
NP_439966.1_7 Forward -123 -113 4.69947 0.263
NP_439966.1_9 Reverse -190 -199 0.983037 0.253
NP_442941.1_3 Reverse -193 -203 19.2529 0.00262
NP_442941.1_3 Forward -200 -190 2.43831 0.14
NP_440674.1_3 Reverse -192 -211 5.50599 0.229
NP_440289.1_2 Reverse -189 -202 11.4257 0.0196
NP_440289.1_2 Forward -204 -191 5.91914 0.0605
NP_440289.1_2 Reverse -139 -152 -1.65234 0.243
NP_440260.1_8 Forward -210 -192 2.28076 0.182
NP_442281.1_1 Forward -206 -192 17.2068 0.00633
NP_442281.1_1 Reverse -187 -201 9.6354 0.0684
NP_442281.1_1 Forward -126 -112 7.17714 0.106
NP_441334.1_7 Reverse -190 -209 -9.44032 0.12
NP_441334.1_7 Forward -203 -184 -20.4534 0.276
NP_440177.1_9 Reverse -171 -190 11.7008 0.253
NP_442256.1_2 Reverse -190 -208 0.0191479 0.131
NP_442012.1_1 Forward -207 -188 13.5691 0.058
NP_440498.1_5 Reverse -234 -252 12.7688 0.185
NP_441644.1_6 Reverse -192 -202 17.3841 0.00127
NP_441644.1_6 Forward -201 -191 15.7125 0.0048
NP_441644.1_6 Forward -157 -147 7.25606 0.132
NP_441644.1_6 Reverse -319 -329 4.89613 0.22
NP_441644.1_6 Forward -121 -111 4.30615 0.242
NP_441644.1_6 Reverse -218 -228 3.12618 0.297
NP_442215.1_2 Forward -203 -187 1.14018 0.14
NP_442215.1_2 Reverse -127 -143 0.451859 0.151
NP_442215.1_2 Reverse -140 -156 -3.8747 0.223
NP_442215.1_2 Reverse -190 -206 -4.85801 0.24
NP_442247.1_8 Forward -203 -189 13.4709 0.247
NP_440253.1_2 Reverse -192 -210 7.00065 0.0752
NP_440929.1_8 Forward -201 -192 19.2726 0.000701
NP_440929.1_8 Reverse -192 -201 19.2726 0.000701
NP_441346.1_7 Reverse -119 -138 12.1925 0.206
NP_442933.1_10 Forward -201 -192 17.601 0.00325
NP_442933.1_10 Reverse -192 -201 17.601 0.00325
NP_442933.1_10 Reverse -112 -121 4.62128 0.227
NP_441751.2_8 Reverse -193 -207 6.58777 0.0348
NP_441751.2_8 Forward -200 -186 -2.65535 0.133
NP_442554.1_8 Forward -200 -190 16.9913 0.0065
NP_442554.1_8 Reverse -193 -203 16.2046 0.0065
NP_442554.1_8 Reverse -113 -123 10.4031 0.0466
NP_442554.1_8 Forward -120 -110 6.07655 0.126
NP_442554.1_8 Reverse -149 -159 2.7333 0.259
NP_441762.1_7 Forward -202 -190 2.59558 0.0676
NP_441762.1_7 Reverse -191 -203 1.80894 0.0735
NP_442142.1_4 Forward -204 -191 6.80355 0.154
NP_442142.1_4 Reverse -189 -202 3.95196 0.239
NP_442292.1_1 Reverse -193 -202 18.486 0.00229
NP_442292.1_1 Forward -200 -191 9.53783 0.0183
NP_442476.1_6 Forward -200 -186 3.53951 0.156
NP_442381.1_8 Reverse -189 -208 -5.80207 0.15
NP_443009.1_5 Forward -202 -191 15.7911 0.0107
NP_443009.1_5 Reverse -191 -202 11.1696 0.066
NP_441715.1_4 Reverse -193 -203 17.3846 0.0106
NP_441715.1_4 Reverse -113 -123 8.1415 0.107
NP_440357.1_3 Reverse -190 -209 2.94938 0.245
NP_440881.1_5 Forward -333 -314 15.1424 0.299
NP_440730.1_4 Reverse -192 -211 0.0977854 0.248
NP_441448.1_1 Reverse -190 -209 4.62101 0.275
NP_441448.1_1 Reverse -199 -218 4.12936 0.279
NP_440158.1_8 Reverse -190 -209 10.4225 0.249
NP_440183.1_9 Reverse -178 -197 -12.3902 0.256
NP_441198.1_8 Reverse -190 -200 15.2245 0.0427
NP_441468.1_1 Forward -200 -193 15.8704 0.0124
NP_441468.1_1 Reverse -193 -200 15.8704 0.0124
NP_441468.1_1 Reverse -113 -120 10.9539 0.0726
NP_441020.2_6 Reverse -190 -207 14.2968 0.0573
NP_441015.1_10 Forward -206 -187 -6.49039 0.249
NP_441015.1_10 Reverse -107 -126 -9.53865 0.282
NP_441673.1_1 Forward -201 -192 20.8459 0.000698
NP_441673.1_1 Reverse -192 -201 20.8459 0.000698
NP_441673.1_1 Reverse -112 -121 1.37636 0.114
NP_441673.1_1 Forward -121 -112 1.1797 0.163
NP_441731.1_3 Forward -209 -190 5.11266 0.159
NP_440672.1_1 Reverse -124 -142 16.1454 0.29
NP_441826.1_2 Reverse -186 -200 15.8309 0.0196
NP_441826.1_2 Forward -207 -193 3.93283 0.105
NP_442490.1_9 Reverse -180 -199 -1.96717 0.202
NP_442868.1_6 Forward -203 -193 19.2529 0.00563
NP_442868.1_6 Reverse -190 -200 16.7946 0.0131
NP_442719.1_2 Forward -37 -19 -11.5846 0.292
NP_441056.1_1 Reverse -192 -211 -8.55534 0.282
NP_441612.1_2 Reverse -192 -202 8.54929 0.21
NP_441612.1_2 Forward -331 -321 6.70984 0.277
NP_442361.1_3 Forward -207 -194 8.18076 0.285
NP_442808.1_1 Reverse -191 -201 8.73102 0.0481
NP_442808.1_1 Forward -202 -192 8.63269 0.0481
NP_442808.1_1 Forward -122 -112 6.27276 0.121
NP_442808.1_1 Forward -114 -104 4.20782 0.203
NP_441101.1_1 Reverse -190 -208 9.75391 0.286
NP_441101.1_10 Forward -205 -186 3.53937 0.173
NP_440145.1_3 Forward -211 -192 7.07928 0.0493
NP_440145.1_4 Forward -120 -110 16.5975 0.123
NP_442542.1_2 Reverse -190 -203 20.6688 0.00569
NP_442050.1_5 Reverse -190 -200 14.9258 0.0175
NP_442050.1_5 Forward -203 -193 14.3359 0.0206
NP_440558.1_2 Reverse -120 -139 -1.27885 0.213
NP_440558.1_2 Forward -136 -117 -1.57384 0.215
NP_440558.1_2 Forward -210 -191 -5.40875 0.258
NP_440111.2_2 Forward -212 -193 -4.13045 0.285
NP_442789.1_4 Reverse -190 -209 -0.197208 0.198
NP_440274.1_3 Reverse -206 -220 20.1568 0.153
NP_441518.1_3 Forward -211 -192 -12.5869 0.263
NP_441878.1_6 Reverse -191 -201 20.2362 0.0046
NP_441878.1_6 Reverse -111 -121 11.4848 0.0176
NP_441878.1_6 Forward -202 -192 10.4031 0.0176
NP_441878.1_6 Forward -122 -112 -0.41329 0.177
NP_441878.1_6 Forward -332 -322 -7.39479 0.222
NP_441036.1_8 Reverse -191 -201 8.4365 0.174
NP_441036.1_8 Forward -202 -192 8.33817 0.174
NP_441557.1_5 Forward -201 -192 19.9609 0.000699
NP_441557.1_5 Reverse -192 -201 19.9609 0.000699
NP_441557.1_5 Reverse -112 -121 0.491382 0.144
NP_441557.1_5 Forward -121 -112 0.29472 0.174
NP_441520.1_7 Reverse -138 -157 8.65258 0.179
NP_441445.1_1 Reverse -313 -332 2.45773 0.233
NP_442066.2_4 Forward -201 -182 9.53756 0.0742
NP_442066.2_4 Reverse -192 -211 -7.86702 0.289
NP_440101.1_3 Reverse -302 -321 1.27776 0.281
NP_440101.1_3 Reverse -187 -206 1.27776 0.281
NP_441458.1_10 Forward -210 -191 4.42435 0.23
NP_442183.1_1 Forward -201 -187 10.816 0.0784
NP_442183.1_1 Reverse -192 -206 7.47274 0.141
NP_440356.1_10 Reverse -194 -212 15.5554 0.206
NP_441819.1_5 Reverse -366 -385 12.4613 0.242
NP_441549.1_9 Forward -205 -187 -6.96235 0.206
NP_442347.1_2 Reverse -258 -267 16.421 0.056
NP_442347.1_2 Reverse -193 -202 12.4878 0.056
NP_442347.1_2 Forward -200 -191 3.34298 0.284
NP_441037.1_4 Reverse -190 -200 18.9151 0.00351
NP_441037.1_4 Reverse -110 -120 13.3601 0.0659
NP_441633.1_3 Forward -203 -190 22.6354 0.00371
NP_441633.1_3 Forward -123 -110 6.21414 0.0481
NP_441633.1_3 Reverse -320 -333 -5.48725 0.236
NP_440136.1_2 Forward -200 -193 15.9687 0.0123
NP_440136.1_2 Reverse -193 -200 15.9687 0.0123
NP_442998.1_5 Reverse -45 -55 11.1898 0.191
NP_442998.1_10 Forward -199 -192 15.5754 0.0102
NP_442998.1_10 Reverse -194 -201 15.5754 0.0102
NP_440899.1_2 Forward -212 -193 6.48849 0.266
NP_440299.1_1 Forward -205 -192 20.2748 0.00128
NP_440299.1_1 Reverse -188 -201 18.9965 0.00298
NP_440299.1_1 Forward -125 -112 13.9817 0.0271
NP_441799.1_1 Reverse -188 -202 4.71887 0.238
NP_441799.1_1 Reverse -108 -122 4.03056 0.269
NP_440640.1_6 Forward -150 -131 -0.39387 0.285
NP_441007.1_10 Reverse -187 -200 9.16406 0.104
NP_441007.1_10 Reverse -107 -120 0.707601 0.219
NP_441007.1_10 Forward -206 -193 -0.964025 0.296
NP_442334.1_1 Reverse -180 -199 -4.6221 0.259
NP_442334.1_2 Reverse -182 -199 -11.6625 0.297
NP_442201.1_10 Reverse -181 -200 15.9291 0.0406
NP_442333.2_5 Reverse -181 -200 5.89931 0.146
NP_440256.1_1 Forward -204 -185 4.22769 0.0459
NP_442961.1_7 Forward -330 -311 12.8808 0.245
NP_441559.1_4 Forward -230 -211 2.65439 0.191
NP_441559.1_8 Forward -126 -112 6.19444 0.0806
NP_441559.1_8 Forward -206 -192 3.04785 0.143
NP_441559.1_8 Reverse -329 -343 -5.80194 0.27
NP_441559.1_8 Forward -220 -206 -7.17857 0.287
NP_441559.1_8 Reverse -118 -132 -7.17857 0.287
NP_441270.1_5 Forward -349 -330 11.4328 0.291
NP_440915.1_6 Forward -205 -191 18.3875 0.0114
NP_440915.1_6 Reverse -188 -202 14.9459 0.0183
NP_440915.1_6 Forward -125 -111 0.786239 0.153
NP_440915.1_6 Reverse -330 -344 -1.67204 0.243
NP_441296.1_6 Reverse -151 -170 4.916 0.299
NP_440717.1_3 Reverse -325 -339 6.78381 0.294
NP_442967.1_2 Forward -137 -118 10.9142 0.254
NP_442866.1_1 Reverse -187 -206 -9.53865 0.294
NP_441464.1_8 Forward -121 -107 17.9942 0.072
NP_441464.1_10 Reverse -102 -116 8.45605 0.281
NP_440702.1_7 Forward -392 -373 21.0414 0.138
NP_441939.1_3 Forward -68 -49 6.78429 0.222
NP_441199.1_6 Forward -125 -106 4.916 0.158
NP_441199.1_6 Forward -205 -186 3.04771 0.189
NP_441494.1_6 Reverse -205 -218 17.5222 0.0758
NP_441494.1_6 Reverse -187 -200 8.86907 0.227
NP_439985.1_7 Reverse -186 -205 2.55606 0.289
NP_442386.1_9 Forward -202 -193 13.8639 0.0289
NP_442386.1_9 Reverse -191 -200 6.39082 0.219
NP_442386.1_9 Forward -122 -113 4.62087 0.294
NP_440570.1_5 Forward -341 -322 2.26107 0.234
NP_441750.1_4 Forward -205 -186 7.66927 0.159
NP_441340.1_5 Forward -200 -193 15.6737 0.0124
NP_441340.1_5 Reverse -193 -200 15.6737 0.0124
NP_440168.1_9 Forward -203 -184 4.52268 0.227
NP_440168.1_9 Reverse -190 -209 1.37609 0.248
NP_440327.1_6 Reverse -92 -111 6.68596 0.232
NP_442240.1_1 Forward -209 -190 11.3067 0.192
NP_442240.1_2 Reverse -193 -212 -9.63698 0.137
NP_440586.1_1 Reverse -188 -207 -4.42544 0.278
NP_440586.1_8 Forward -200 -193 13.2151 0.026
NP_440586.1_8 Reverse -193 -200 13.2151 0.026
NP_442251.1_6 Forward -200 -193 15.2804 0.0124
NP_442251.1_6 Reverse -193 -200 15.2804 0.0124
NP_441262.1_3 Reverse -192 -199 14.7888 0.0223
NP_441262.1_3 Forward -201 -194 14.7888 0.0223
NP_440027.1_3 Forward -201 -183 7.19654 0.214
NP_443051.1_1 Reverse -191 -200 18.0926 0.00402
NP_443051.1_1 Forward -202 -193 10.4228 0.00754
NP_439937.1_9 Forward -58 -41 -5.46836 0.157
NP_439937.1_9 Forward -122 -105 -10.0899 0.221
NP_439937.1_9 Reverse -122 -139 -11.6632 0.261
NP_439937.1_9 Forward -124 -107 -12.8431 0.276
NP_439937.1_9 Forward -202 -185 -16.1864 0.287
NP_442294.1_3 Forward -58 -44 14.3553 0.246
NP_441595.1_3 Reverse -315 -325 17.8763 0.202
NP_441595.1_5 Reverse -185 -203 7.59063 0.222
NP_440439.1_1 Forward -204 -191 11.1307 0.0339
NP_440439.1_1 Forward -124 -111 -0.275709 0.211
NP_439943.1_1 Forward -67 -48 -12.1936 0.296
NP_440372.1_2 Forward -200 -193 16.3621 0.0124
NP_440372.1_2 Reverse -193 -200 16.3621 0.0124
NP_442511.1_6 Forward -227 -208 3.6377 0.229
NP_440316.1_10 Reverse -103 -113 8.4365 0.239
NP_441803.1_2 Forward -206 -187 6.98095 0.146
NP_441803.1_2 Forward -156 -137 0.0977854 0.26
NP_439977.1_5 Forward -207 -188 13.8641 0.0531
NP_439977.1_5 Forward -127 -108 5.01433 0.15
NP_441572.1_1 Forward -345 -326 -6.1954 0.278
NP_441572.1_7 Reverse -186 -205 9.24257 0.0732
NP_442384.1_10 Reverse -192 -205 20.8655 0.00194
NP_442384.1_10 Forward -201 -188 12.2123 0.0296
NP_442384.1_10 Reverse -112 -125 9.36073 0.054
NP_442339.1_1 Forward -56 -37 18.4848 0.11
NP_442339.1_9 Forward -182 -163 13.5691 0.162
NP_441877.1_7 Forward -206 -187 -0.29631 0.283
NP_442790.1_4 Reverse -183 -202 9.73422 0.0729
NP_442790.1_4 Forward -210 -191 -8.752 0.174
NP_442262.1_10 Forward -200 -193 14.1988 0.0123
NP_442262.1_10 Reverse -193 -200 14.1988 0.0123
NP_442262.1_10 Reverse -113 -120 9.47889 0.187
NP_441689.1_5 Forward -203 -193 5.78111 0.197
NP_440163.1_10 Forward -269 -259 7.84651 0.299
NP_440344.1_10 Reverse -185 -202 -0.944468 0.048
NP_440344.1_10 Forward -208 -191 -10.4826 0.182
NP_440531.1_6 Reverse -184 -203 3.83436 0.138
NP_440531.1_6 Forward -209 -190 3.44104 0.145
NP_442910.1_1 Forward -208 -189 3.24438 0.118
NP_440562.1_10 Forward -210 -192 7.88563 0.284
NP_441965.1_3 Reverse -182 -201 1.27776 0.223
NP_441965.1_10 Reverse -189 -205 12.6449 0.105
NP_442750.1_1 Forward -382 -363 5.60352 0.29
NP_440297.1_9 Forward -200 -190 9.51814 0.0917
NP_440297.1_9 Forward -120 -110 -0.0199663 0.282
NP_440297.1_9 Reverse -193 -203 -0.118297 0.282
NP_441592.1_4 Reverse -192 -211 -2.0655 0.26
NP_441896.1_3 Reverse -103 -122 8.94757 0.0872
NP_440894.1_4 Reverse -378 -397 2.94938 0.219
NP_440894.1_10 Reverse -187 -206 5.11266 0.238
NP_440894.1_10 Forward -39 -20 4.81767 0.243
NP_442078.1_3 Forward -341 -322 0.883656 0.236
NP_440999.1_9 Forward -125 -111 12.3893 0.0414
NP_440999.1_9 Forward -205 -191 7.86607 0.082
NP_440999.1_9 Reverse -318 -332 5.50613 0.111
NP_440999.1_9 Reverse -188 -202 5.1128 0.113
NP_440888.1_2 Reverse -192 -206 15.1419 0.0122
NP_440888.1_2 Forward -201 -187 13.4703 0.0285
NP_440600.1_4 Reverse -184 -202 0.904127 0.134
NP_440600.1_4 Forward -209 -191 -1.16082 0.163
NP_440491.1_1 Forward -107 -88 6.7221 0.289
NP_439969.1_3 Reverse -187 -206 5.89931 0.178
NP_442277.1_2 Forward -67 -53 10.226 0.287
NP_442033.1_10 Reverse -190 -209 0.884433 0.0992
NP_442033.1_10 Forward -123 -104 -9.34199 0.213
NP_441543.1_2 Reverse -193 -202 16.9127 0.00359
NP_441543.1_2 Forward -200 -191 9.34117 0.0818
NP_441543.1_3 Forward -115 -101 7.27547 0.286
NP_442845.1_2 Reverse -186 -200 6.88276 0.201
NP_441834.1_7 Reverse -100 -119 16.6174 0.209
NP_441178.1_6 Forward -210 -191 1.86696 0.279
NP_441469.1_8 Reverse -191 -200 13.3727 0.073
NP_441469.1_8 Reverse -111 -120 10.3245 0.223
NP_441469.1_8 Forward -202 -193 6.48957 0.227
NP_441469.1_8 Forward -122 -113 5.99792 0.241
NP_443064.1_6 Forward -201 -191 13.8273 0.0796
NP_443064.1_6 Reverse -192 -202 12.5669 0.0796
NP_441306.1_10 Reverse -332 -346 14.2569 0.25
NP_442578.1_7 Forward -200 -193 14.5921 0.026
NP_442578.1_7 Reverse -193 -200 14.5921 0.026
NP_440710.1_1 Forward -209 -191 1.29745 0.14
NP_440710.1_1 Reverse -184 -202 -8.33898 0.262
NP_441462.1_2 Forward -201 -191 20.1379 0.000967
NP_441462.1_2 Reverse -192 -202 11.5831 0.00406
NP_441462.1_2 Forward -121 -111 0.471689 0.148
NP_441621.1_7 Reverse -190 -204 5.01447 0.0934
NP_441621.1_7 Reverse -110 -124 -4.7203 0.242
NP_443062.1_1 Reverse -257 -275 9.81352 0.127
NP_443062.1_6 Forward -209 -190 4.52268 0.217
NP_442204.1_1 Forward -205 -194 11.5634 0.0565
NP_442204.1_1 Forward -142 -131 0.255333 0.282
NP_442204.1_5 Reverse -182 -201 5.01433 0.16
NP_440516.1_8 Forward -201 -192 16.9127 0.00442
NP_440516.1_8 Reverse -192 -201 16.9127 0.00442
NP_442428.1_4 Reverse -321 -340 6.39097 0.198
NP_442428.1_5 Forward -200 -193 15.8704 0.0124
NP_442428.1_5 Reverse -193 -200 15.8704 0.0124
NP_442428.1_5 Reverse -113 -120 4.66067 0.244
NP_440783.1_2 Reverse -258 -277 -0.590531 0.137
NP_442120.1_10 Forward -138 -119 -16.2252 0.297
NP_441867.1_2 Reverse -201 -220 -6.09707 0.189
NP_440673.1_2 Reverse -182 -201 18.3888 0.0429
NP_440673.1_3 Forward -199 -192 12.4288 0.0426
NP_440673.1_3 Reverse -194 -201 12.4288 0.0426
NP_440673.1_7 Reverse -181 -200 9.73422 0.115
NP_440865.1_9 Reverse -186 -205 -4.72043 0.207
NP_441052.1_2 Reverse -192 -202 19.9412 0.00106
NP_441052.1_2 Forward -201 -191 10.4031 0.0285
NP_442219.1_9 Reverse -193 -202 17.7976 0.00718
NP_442219.1_9 Forward -200 -191 8.25953 0.0681
NP_440436.1_4 Reverse -193 -202 17.2072 0.00233
NP_440436.1_4 Forward -200 -191 15.9289 0.00508
NP_441884.1_8 Reverse -191 -210 -6.68705 0.234
NP_441884.1_9 Reverse -189 -208 3.93269 0.0236
NP_441884.1_9 Forward -204 -185 -22.5183 0.281
NP_440314.1_9 Forward -200 -181 3.04771 0.0849
NP_440314.1_9 Forward -120 -101 -8.45701 0.248
NP_440041.1_2 Forward -153 -134 -6.58872 0.296
NP_442577.1_9 Forward -117 -103 18.0918 0.146
NP_441719.1_4 Forward -200 -193 16.3621 0.0124
NP_441719.1_4 Reverse -193 -200 16.3621 0.0124
NP_441733.1_10 Reverse -189 -202 7.29578 0.156
NP_441733.1_10 Forward -204 -191 5.62415 0.21
NP_441004.1_1 Reverse -186 -205 10.9142 0.0458
NP_441004.1_1 Reverse -106 -125 7.47261 0.0897
NP_441004.1_2 Reverse -181 -200 6.4893 0.182
NP_441004.1_2 Reverse -101 -120 0.58944 0.233
NP_441004.1_5 Reverse -108 -122 11.996 0.24
NP_442366.1_3 Reverse -191 -209 -4.70074 0.275
NP_440129.1_4 Forward -116 -98 17.3246 0.155
NP_440129.1_9 Forward -143 -124 5.40766 0.296
NP_440129.1_10 Forward -208 -194 5.21113 0.185
NP_442873.1_3 Forward -209 -190 6.78348 0.22
NP_440296.1_10 Reverse -189 -208 -5.80207 0.225
NP_442206.1_10 Reverse -192 -207 13.4512 0.0799
NP_442854.1_6 Forward -201 -182 2.3594 0.272
NP_443054.1_2 Forward -203 -189 8.06273 0.13
NP_442308.1_4 Forward -207 -188 2.75272 0.267
NP_441851.1_10 Reverse -191 -201 17.4829 0.0027
NP_441851.1_10 Forward -202 -192 15.8113 0.00552
NP_441851.1_10 Reverse -111 -121 6.76487 0.156
NP_442208.1_5 Reverse -177 -196 -7.67036 0.274
NP_442208.1_5 Reverse -233 -252 -8.65367 0.28
NP_442622.1_8 Forward -201 -183 -18.4671 0.222
NP_442622.1_8 Reverse -192 -210 -18.5654 0.23
NP_442011.1_1 Forward -202 -183 11.7992 0.16
NP_441668.1_5 Forward -83 -64 5.80098 0.297
NP_442515.1_1 Forward -202 -188 16.5192 0.0227
NP_442515.1_1 Forward -332 -318 2.45787 0.135
NP_442515.1_1 Reverse -191 -205 2.06454 0.143
NP_442515.1_1 Forward -122 -108 -1.96703 0.268
NP_440593.1_3 Reverse -187 -206 -0.197208 0.199
NP_440593.1_9 Forward -204 -190 8.35772 0.261
NP_441982.1_6 Reverse -43 -52 11.6259 0.288
NP_440165.1_5 Reverse -191 -210 4.22769 0.0987
NP_441046.1_2 Reverse -302 -321 -1.86883 0.292
NP_441349.1_10 Reverse -119 -138 -5.40875 0.201
NP_441349.1_10 Forward -211 -192 -5.60541 0.207
NP_440432.1_2 Forward -157 -138 5.40766 0.17
NP_440432.1_9 Forward -200 -185 8.92802 0.0427
NP_440432.1_9 Reverse -193 -208 -1.00341 0.167
NP_441062.1_10 Reverse -57 -76 5.30933 0.245
NP_439960.1_10 Forward -208 -190 13.0972 0.0769
NP_439960.1_10 Forward -145 -127 -4.79907 0.297
NP_442944.1_9 Reverse -183 -202 17.404 0.228
NP_440474.1_8 Forward -261 -247 5.21053 0.254
NP_441596.1_10 Forward -209 -190 9.63589 0.273
NP_440431.1_5 Reverse -222 -241 17.3057 0.0703
NP_442450.1_5 Reverse -190 -200 10.1081 0.115
NP_440588.1_2 Forward -210 -191 -2.65548 0.17
NP_440195.1_1 Reverse -180 -199 3.04771 0.227
NP_442006.1_2 Forward -194 -177 -13.4325 0.197
NP_442006.1_2 Forward -107 -90 -17.0707 0.269
NP_442006.1_2 Reverse -135 -152 -18.4474 0.291
NP_442006.1_3 Reverse -186 -204 -7.45401 0.298
NP_441003.1_9 Reverse -95 -114 3.83436 0.291
NP_441003.1_9 Forward -210 -191 3.04771 0.3
NP_443047.1_7 Forward -200 -181 7.17762 0.222
NP_442243.1_1 Forward -144 -126 4.54162 0.196
NP_442243.1_1 Forward -207 -189 -3.12816 0.299
NP_442038.1_1 Reverse -39 -58 0.491109 0.278
NP_441570.1_1 Reverse -192 -210 9.85225 0.00993
NP_441570.1_1 Forward -201 -183 -7.35568 0.0887
NP_440078.1_8 Reverse -380 -399 5.60432 0.257
NP_441078.1_4 Forward -201 -192 19.6659 0.0007
NP_441078.1_4 Reverse -192 -201 19.6659 0.0007
NP_441078.1_4 Reverse -112 -121 7.66954 0.052
NP_441078.1_4 Forward -121 -112 0.688044 0.164
NP_441078.1_4 Reverse -322 -331 -1.37691 0.254
NP_442729.1_5 Reverse -197 -207 8.04317 0.251
NP_442729.1_8 Reverse -188 -201 18.5055 0.0312
NP_442729.1_8 Forward -335 -322 7.39411 0.153
NP_440539.1_9 Forward -209 -190 -4.13045 0.286
NP_440539.1_9 Forward -341 -322 -5.80207 0.286
NP_441663.1_8 Forward -207 -188 -0.197208 0.227
NP_441663.1_8 Reverse -186 -205 -3.14714 0.276
NP_442443.1_1 Reverse -116 -135 -4.91709 0.28
NP_440526.1_3 Forward -200 -189 11.4645 0.0646
NP_440526.1_3 Reverse -193 -204 8.02298 0.126
NP_440526.1_3 Reverse -66 -77 4.48308 0.267
NP_440526.1_3 Forward -120 -109 2.41814 0.267
NP_441432.1_8 Forward -202 -193 16.8143 0.00595
NP_441432.1_8 Reverse -191 -200 8.35786 0.0755
NP_441432.1_8 Reverse -103 -112 7.27622 0.101
NP_443024.1_2 Reverse -80 -93 18.1116 0.156
NP_442320.1_8 Reverse -186 -200 5.70279 0.0334
NP_442320.1_8 Forward -207 -193 -4.62196 0.177
NP_441732.1_2 Forward -205 -189 -6.33298 0.0495
NP_441732.1_2 Reverse -188 -204 -15.1828 0.145
NP_441732.1_2 Forward -335 -319 -15.4778 0.147
NP_440313.1_6 Reverse -246 -265 16.4207 0.262
NP_440497.1_2 Reverse -193 -212 9.3409 0.208
NP_440760.1_1 Forward -201 -182 -5.01543 0.0475
NP_440760.1_1 Reverse -322 -341 -22.125 0.249
NP_442797.1_1 Forward -209 -190 -3.3438 0.278
NP_442797.1_1 Forward -323 -304 -6.49039 0.296
NP_442797.1_7 Forward -208 -190 12.3105 0.156
NP_440913.1_1 Forward -203 -185 5.72234 0.236
NP_440913.1_1 Reverse -190 -208 4.83737 0.254
NP_439935.1_6 Forward -20 -1 15.8307 0.16
NP_442727.1_1 Forward -145 -131 16.6175 0.181
NP_442400.1_1 Reverse -254 -273 -5.11376 0.288
NP_440713.1_4 Forward -211 -192 3.53937 0.242
NP_442489.1_7 Forward -201 -192 20.1576 0.000695
NP_442489.1_7 Reverse -192 -201 20.1576 0.000695
NP_442489.1_7 Reverse -112 -121 8.1612 0.0294
NP_442489.1_7 Forward -121 -112 0.491382 0.178
NP_442079.1_7 Reverse -193 -212 8.55425 0.121
NP_442079.1_7 Forward -200 -181 3.14605 0.212
NP_440559.1_1 Reverse -193 -202 17.4043 0.00658
NP_440559.1_1 Forward -200 -191 17.306 0.00658
NP_441659.2_8 Forward -201 -191 19.3512 0.000966
NP_441659.2_8 Reverse -192 -202 18.1713 0.00133
NP_441659.2_8 Forward -121 -111 7.45319 0.0601
NP_442008.1_2 Reverse -189 -208 6.88262 0.216
NP_440779.1_5 Forward -201 -184 -14.7108 0.269
NP_442346.1_5 Reverse -191 -201 17.9746 0.00128
NP_442346.1_5 Forward -202 -192 16.6963 0.00248
NP_442346.1_5 Reverse -111 -121 7.55152 0.165
NP_440545.1_3 Reverse -188 -205 8.69197 0.0431
NP_440545.1_3 Forward -205 -188 8.10198 0.0463
NP_440545.1_3 Reverse -108 -125 -4.38605 0.224
NP_440545.1_3 Forward -335 -318 -4.97604 0.237
NP_440025.1_3 Forward -116 -102 10.1267 0.29
NP_440831.1_3 Reverse -183 -202 9.68776 0.188
NP_440831.1_5 Reverse -206 -225 18.7781 0.223
NP_440486.1_6 Reverse -191 -210 13.2741 0.207
NP_440459.1_2 Forward -203 -186 16.5584 0.092
NP_441653.1_2 Reverse -181 -200 6.332 0.234
NP_440010.1_4 Forward -211 -192 -2.55791 0.284
NP_442603.1_7 Forward -201 -187 19.5668 0.00949
NP_442603.1_7 Reverse -192 -206 16.5185 0.0304
NP_442603.1_7 Forward -121 -107 10.717 0.125
NP_440034.1_3 Reverse -310 -329 17.6202 0.206
NP_441888.1_7 Forward -206 -192 13.2743 0.0743
NP_441888.1_7 Forward -126 -112 11.5043 0.0846
NP_441888.1_7 Reverse -329 -343 4.03116 0.225
NP_440449.1_6 Reverse -184 -202 7.86678 0.208
NP_441047.1_2 Reverse -193 -212 1.37609 0.239
NP_441833.1_4 Forward -200 -193 15.9687 0.0124
NP_441833.1_4 Reverse -193 -200 15.9687 0.0124
NP_441329.1_1 Forward -176 -157 10.265 0.194
NP_441329.1_6 Reverse -35 -54 2.53011 0.227
NP_441895.1_10 Forward -95 -76 -18.3884 0.282
NP_442162.1_9 Forward -200 -193 16.2637 0.0124
NP_442162.1_9 Reverse -193 -200 16.2637 0.0124
NP_440671.1_7 Reverse -200 -219 14.6508 0.294
NP_440224.1_1 Forward -212 -193 10.2259 0.0569
NP_442140.1_3 Forward -200 -190 14.828 0.0433
NP_442140.1_3 Reverse -193 -203 10.3048 0.0902
NP_442140.1_3 Reverse -113 -123 3.51995 0.294
NP_441609.1_1 Forward -350 -331 0.58944 0.21
NP_440875.1_9 Reverse -194 -204 8.37203 0.233
NP_440875.1_9 Reverse -114 -124 7.496 0.262
NP_441813.1_5 Forward -203 -193 18.1713 0.00743
NP_441813.1_5 Reverse -190 -200 8.92815 0.0347
NP_441813.1_5 Forward -123 -113 -0.216628 0.237
NP_440594.1_8 Forward -120 -107 9.85179 0.174
NP_440590.1_4 Forward -200 -187 11.1307 0.0221
NP_440590.1_4 Reverse -193 -206 5.72248 0.0585
NP_440590.1_4 Reverse -113 -126 -3.52063 0.255
NP_440567.1_1 Forward -200 -186 14.2576 0.0187
NP_440567.1_1 Reverse -193 -207 5.01447 0.108
NP_440719.1_3 Forward -362 -343 18.218 0.125
NP_442497.1_1 Forward -218 -199 10.4217 0.254
NP_442497.1_10 Forward -200 -191 19.8626 0.00532
NP_442497.1_10 Reverse -193 -202 10.4228 0.0087
NP_442497.1_10 Forward -120 -111 0.196389 0.208
NP_440821.1_4 Reverse -190 -200 19.5479 0.00399
NP_440821.1_4 Forward -203 -193 9.41981 0.0286
NP_440821.1_4 Reverse -110 -120 0.275027 0.19
NP_441239.1_9 Reverse -190 -202 14.4936 0.0272
NP_441239.1_9 Reverse -110 -122 12.4287 0.0477
NP_441239.1_9 Forward -203 -191 8.79043 0.122
NP_441239.1_9 Forward -123 -111 8.49544 0.131
NP_441239.1_9 Reverse -332 -344 6.33216 0.193
NP_442897.1_4 Forward -334 -316 14.2771 0.259
NP_441892.1_1 Reverse -183 -200 18.0334 0.0226
NP_441892.1_1 Forward -210 -193 -3.40274 0.239
NP_440604.1_6 Reverse -192 -211 -3.63879 0.23
NP_441541.1_1 Reverse -34 -52 -0.76195 0.237
NP_442216.1_4 Forward -130 -122 8.1805 0.255
NP_440876.1_5 Reverse -194 -213 7.27595 0.283
NP_440949.1_7 Forward -209 -190 9.24175 0.264
NP_442138.1_10 Reverse -192 -211 7.17762 0.0707
NP_442809.1_6 Reverse -123 -142 5.40766 0.256
NP_440546.1_4 Forward -201 -191 12.8578 0.0572
NP_440546.1_4 Reverse -192 -202 10.046 0.109
NP_440546.1_4 Forward -157 -147 7.81598 0.22
NP_440546.1_4 Forward -121 -111 7.62206 0.23
NP_440546.1_7 Forward -194 -184 17.9746 0.181
NP_441230.1_5 Reverse -187 -206 1.27776 0.246
NP_440675.1_1 Reverse -189 -208 1.67108 0.287
NP_440462.1_6 Reverse -190 -200 10.4031 0.0396
NP_440462.1_6 Forward -203 -193 9.61647 0.0429
NP_440868.1_4 Forward -205 -193 8.00379 0.0602
NP_440868.1_8 Reverse -188 -207 6.29264 0.103
NP_441249.1_8 Reverse -98 -117 3.93269 0.264
NP_440812.1_4 Forward -95 -76 12.8913 0.25
NP_442402.1_2 Forward -56 -42 10.9137 0.292
NP_442402.1_4 Forward -127 -108 -7.57277 0.276
NP_442402.1_4 Forward -60 -41 -10.2277 0.298
NP_442402.1_10 Reverse -126 -136 11.5826 0.246
NP_441848.1_4 Reverse -38 -54 15.8585 0.154
NP_440653.1_10 Forward -277 -258 13.0775 0.117
NP_440653.1_10 Forward -200 -181 8.16093 0.201
NP_440696.1_3 Forward -148 -130 -1.06249 0.251
NP_440843.1_3 Forward -350 -331 10.7175 0.228
NP_440843.1_3 Reverse -105 -124 8.65258 0.29
NP_442039.1_4 Forward -200 -193 15.1821 0.0124
NP_442039.1_4 Reverse -193 -200 15.1821 0.0124
NP_441811.1_8 Reverse -186 -200 8.94771 0.227
NP_441811.1_8 Reverse -106 -120 5.99778 0.289
NP_441811.1_8 Reverse -251 -265 5.89945 0.289
NP_442837.1_3 Forward -200 -193 15.7721 0.0124
NP_442837.1_3 Reverse -193 -200 15.7721 0.0124
NP_442837.1_3 Forward -148 -141 7.11894 0.173
NP_442837.1_3 Reverse -258 -265 6.52896 0.2
NP_442053.1_1 Forward -201 -192 18.3876 0.0007
NP_442053.1_1 Reverse -192 -201 18.3876 0.0007
NP_442053.1_1 Forward -121 -112 4.91628 0.218
NP_440505.1_3 Forward -203 -193 18.3679 0.00213
NP_440505.1_3 Reverse -190 -200 7.84651 0.147
NP_440505.1_7 Forward -156 -137 12.2908 0.146
NP_440505.1_7 Reverse -185 -204 11.2092 0.146
NP_441959.1_10 Forward -150 -132 14.5132 0.186
NP_441203.1_1 Forward -200 -181 4.81767 0.0364
NP_440914.1_1 Reverse -192 -202 17.5935 0.000537
NP_440914.1_1 Forward -201 -191 8.51751 0.186
NP_441011.1_8 Forward -200 -191 14.356 0.0249
NP_441011.1_8 Reverse -193 -202 8.25953 0.144
NP_442931.1_4 Forward -202 -183 10.5209 0.262
NP_442533.1_6 Forward -201 -192 17.2076 0.00137
NP_442533.1_6 Reverse -192 -201 17.2076 0.00137
NP_442533.1_6 Forward -121 -112 8.55452 0.0747
NP_442533.1_6 Reverse -112 -121 6.48957 0.109
NP_442533.1_6 Forward -343 -334 3.63797 0.206
NP_442232.1_3 Reverse -184 -203 -13.0786 0.282
NP_442322.1_4 Forward -207 -190 -9.10659 0.287
NP_442322.1_4 Forward -115 -98 -9.49991 0.295
NP_443016.1_1 Forward -207 -188 -8.55534 0.299
NP_441482.1_7 Forward -207 -193 6.88276 0.0257
NP_441482.1_7 Reverse -186 -200 -0.787057 0.0612
NP_441482.1_7 Forward -337 -323 -11.1118 0.237
NP_439944.1_9 Forward -200 -190 17.4829 0.00423
NP_439944.1_9 Reverse -193 -203 10.5014 0.0887
NP_440816.1_7 Reverse -188 -207 10.0292 0.252
NP_441028.1_6 Reverse -258 -268 10.6976 0.197
NP_441028.1_6 Reverse -84 -94 7.74772 0.218
NP_441028.1_6 Reverse -325 -335 3.51951 0.292
NP_440116.1_5 Forward -204 -187 4.95539 0.176
NP_440115.1_6 Forward -204 -194 16.008 0.0325
NP_440115.1_6 Reverse -189 -199 10.0098 0.115
NP_441602.1_3 Forward -206 -187 5.70265 0.141
NP_441602.1_3 Reverse -317 -336 4.71934 0.152
NP_441972.1_5 Forward -200 -181 16.7157 0.0243
NP_441972.1_5 Reverse -193 -212 -8.55534 0.267
NP_441106.1_1 Reverse -191 -200 9.73449 0.0311
NP_441106.1_1 Forward -202 -193 9.63616 0.0311
NP_441420.1_1 Forward -202 -183 -3.04881 0.288
NP_439903.1_6 Reverse -189 -208 -1.37794 0.299
NP_442306.1_10 Forward -206 -187 -20.0601 0.202
NP_441286.1_1 Forward -202 -190 24.2284 0.000758
NP_441286.1_1 Reverse -191 -203 3.48056 0.0467
NP_441286.1_1 Forward -122 -110 -4.9759 0.183
NP_442674.1_2 Reverse -77 -96 8.45592 0.254
NP_442674.1_3 Reverse -184 -203 7.4718 0.219
NP_440670.1_8 Forward -201 -192 18.3876 0.000699
NP_440670.1_8 Reverse -192 -201 18.3876 0.000699
NP_440670.1_8 Forward -121 -112 5.3096 0.167
NP_442908.1_8 Forward -214 -195 14.7491 0.247
NP_440886.1_7 Forward -122 -112 15.6142 0.0243
NP_440886.1_7 Reverse -191 -201 8.04271 0.0805
NP_440886.1_7 Forward -202 -192 7.94438 0.0805
NP_440886.1_7 Reverse -321 -331 5.48612 0.181
NP_441001.1_10 Reverse -102 -121 4.71934 0.292
NP_442614.1_2 Reverse -301 -315 8.65272 0.254
NP_442072.1_9 Forward -202 -184 -12.0756 0.0812
NP_442072.1_9 Reverse -111 -129 -22.597 0.246
NP_440513.1_4 Forward -201 -182 13.7658 0.19
NP_440907.2_8 Forward -200 -190 19.449 0.00351
NP_441021.1_1 Forward -200 -181 -6.98204 0.181
NP_441021.1_1 Reverse -193 -212 -7.37537 0.183
NP_441021.1_1 Reverse -323 -342 -8.45701 0.195
NP_441021.1_1 Forward -218 -199 -12.4886 0.288
NP_440193.1_7 Forward -372 -358 16.0666 0.285
NP_441463.1_6 Forward -203 -189 6.70583 0.267
NP_441626.1_2 Forward -200 -193 15.7721 0.0124
NP_441626.1_2 Reverse -193 -200 15.7721 0.0124
NP_442365.1_5 Forward -200 -181 6.4893 0.279
NP_442365.1_7 Forward -205 -186 -1.86883 0.196
NP_442794.1_1 Forward -205 -193 20.0002 0.00523
NP_442615.1_1 Reverse -183 -201 -2.93078 0.153
NP_441962.1_4 Reverse -187 -206 2.16274 0.103
NP_441962.1_4 Forward -333 -314 -6.39206 0.176
NP_441962.1_4 Forward -206 -187 -9.14533 0.213
NP_440387.1_1 Reverse -192 -208 5.6634 0.0311
NP_440387.1_1 Forward -201 -185 1.14018 0.111
NP_440387.1_3 Reverse -131 -145 20.0591 0.15
NP_441431.1_2 Forward -124 -110 11.9953 0.128
NP_441431.1_2 Forward -204 -190 7.86545 0.231
NP_441431.1_2 Reverse -331 -345 7.3738 0.244
NP_441488.1_7 Reverse -106 -125 13.1758 0.0917
NP_441836.1_2 Reverse -106 -125 -2.95047 0.232
NP_441836.1_2 Reverse -186 -205 -3.54046 0.239
NP_441993.1_1 Reverse -186 -205 18.8068 0.0369
NP_442224.1_1 Reverse -190 -209 3.6377 0.208
NP_442323.1_7 Forward -206 -187 11.3067 0.141
NP_441206.1_4 Reverse -252 -271 -4.52377 0.263
NP_440492.1_9 Reverse -341 -355 9.88843 0.294
NP_441510.2_6 Forward -211 -192 18.1898 0.0974
NP_441500.1_3 Reverse -33 -52 21.2389 0.0161
NP_440287.1_6 Reverse -251 -270 -0.000545616 0.298
NP_440293.1_3 Reverse -116 -135 5.30933 0.192
NP_440766.1_4 Forward -205 -191 6.19444 0.104
NP_440766.1_5 Reverse -42 -54 7.08284 0.29
NP_441237.1_9 Forward -200 -190 17.2863 0.00348
NP_442743.1_1 Forward -122 -103 7.66846 0.264
NP_442743.1_4 Reverse -193 -212 -6.98204 0.279
NP_442103.1_2 Forward -225 -207 8.76983 0.246
NP_439910.1_2 Forward -42 -25 -22.5773 0.267
NP_439910.1_2 Forward -129 -112 -22.6756 0.285
NP_442867.1_8 Reverse -177 -196 4.12936 0.291
NP_440457.1_1 Reverse -188 -200 15.1819 0.0611
NP_440457.1_1 Forward -205 -193 7.61046 0.101
NP_440798.1_6 Forward -200 -187 3.36254 0.151
NP_441981.1_3 Reverse -44 -58 17.132 0.268
NP_441801.1_4 Forward -197 -187 2.92996 0.231
NP_441801.1_4 Reverse -326 -336 2.53664 0.292
NP_440801.1_10 Forward -205 -186 7.57094 0.272
NP_440942.1_6 Reverse -183 -202 5.40686 0.259
NP_441984.1_6 Forward -199 -187 13.5103 0.274
NP_441436.1_6 Forward -201 -182 6.39097 0.29
NP_441436.1_8 Reverse -191 -210 6.98095 0.296
NP_440473.1_9 Reverse -181 -200 -12.2919 0.296
NP_442509.1_4 Forward -195 -176 13.6675 0.26
NP_442509.1_9 Forward -201 -191 17.3841 0.00128
NP_442509.1_9 Reverse -192 -202 8.14104 0.192
NP_440554.1_4 Reverse -193 -203 8.92815 0.0646
NP_440554.1_4 Forward -200 -190 6.27322 0.123
NP_440554.1_4 Reverse -113 -123 3.51995 0.227
NP_442862.1_3 Reverse -93 -110 7.61033 0.253
NP_442862.1_3 Forward -38 -21 6.03703 0.267
NP_441885.1_5 Reverse -192 -202 20.9245 0.000538
NP_441885.1_5 Forward -201 -191 11.3864 0.00668
NP_440478.1_4 Forward -205 -186 23.0089 0.00798
NP_440478.1_4 Reverse -188 -207 10.0292 0.293
NP_440478.1_10 Reverse -190 -204 7.57108 0.261
NP_442341.1_7 Forward -202 -188 18.3875 0.0111
NP_442341.1_7 Forward -122 -108 12.4876 0.0451
NP_442341.1_7 Reverse -191 -205 6.98109 0.113
NP_442341.1_7 Reverse -321 -335 4.52282 0.188
NP_442341.1_7 Reverse -122 -136 2.94952 0.239
NP_442341.1_7 Forward -332 -318 1.67122 0.282
NP_441756.1_5 Reverse -188 -207 3.53937 0.199
NP_441756.1_5 Forward -203 -184 -3.3438 0.29
NP_441173.1_9 Forward -50 -42 13.1954 0.184
NP_441173.1_9 Forward -51 -43 12.9004 0.206
NP_441173.1_9 Forward -252 -244 12.1137 0.21
NP_441173.1_9 Reverse -85 -93 12.0154 0.214
NP_440423.1_6 Reverse -184 -203 -2.95047 0.126
NP_443000.1_7 Forward -203 -193 19.9412 0.00223
NP_443000.1_7 Reverse -190 -200 2.14332 0.226
NP_440507.2_3 Forward -340 -321 10.9134 0.197
NP_441842.1_10 Reverse -185 -199 7.17775 0.264
NP_440275.1_3 Reverse -190 -200 19.5479 0.00756
NP_440275.1_3 Forward -203 -193 15.123 0.0182
NP_440679.1_10 Reverse -315 -334 -11.6036 0.182
NP_442451.1_2 Reverse -314 -333 -5.40875 0.224
NP_442451.1_2 Forward -209 -190 -5.40875 0.224
NP_442451.1_2 Forward -140 -121 -6.09707 0.23
NP_440175.1_4 Reverse -190 -209 -0.197208 0.122
NP_440804.1_7 Forward -53 -36 16.361 0.14
NP_440149.1_8 Reverse -192 -211 -3.63879 0.193
NP_440149.1_10 Forward -201 -182 -1.47551 0.203
NP_441105.1_3 Reverse -181 -200 -2.95047 0.171
NP_440216.1_1 Forward -201 -187 7.27608 0.00942
NP_440216.1_1 Reverse -192 -206 -0.590395 0.0284
NP_440216.1_1 Reverse -112 -126 -11.8001 0.219
NP_440678.1_5 Reverse -195 -214 7.47261 0.296
NP_440172.1_1 Forward -201 -191 16.303 0.00854
NP_440172.1_1 Reverse -192 -202 15.0247 0.00945
NP_440172.1_1 Forward -121 -111 4.79825 0.166
NP_440167.1_3 Reverse -182 -201 14.3558 0.16
NP_440167.1_3 Forward -211 -192 9.73422 0.247
NP_442015.1_3 Forward -123 -104 15.6332 0.172
NP_442015.1_8 Forward -315 -296 25.4672 0.00244
NP_442015.1_10 Forward -205 -192 21.1604 0.00329
NP_442015.1_10 Reverse -188 -201 4.44418 0.169
NP_442015.1_10 Forward -125 -112 1.9859 0.204
NP_441226.1_7 Forward -200 -193 14.4934 0.0123
NP_441226.1_7 Reverse -193 -200 14.4934 0.0123
NP_441111.1_7 Forward -200 -192 18.7023 0.00294
NP_441111.1_7 Reverse -193 -201 18.7023 0.00294
NP_442379.1_10 Forward -208 -191 -1.53445 0.223
NP_442379.1_10 Forward -158 -141 -2.51776 0.233
NP_440415.1_9 Forward -67 -48 17.109 0.208
NP_441766.1_2 Forward -201 -192 17.5026 0.00297
NP_441766.1_2 Reverse -192 -201 17.5026 0.00297
NP_441766.1_2 Forward -121 -112 3.83464 0.202
NP_442417.1_5 Reverse -192 -206 9.2427 0.137
NP_440416.1_1 Forward -62 -43 -13.7669 0.283
NP_440416.1_9 Forward -208 -189 -5.40875 0.0797
NP_443052.1_8 Reverse -182 -201 -10.817 0.216
NP_443052.1_8 Forward -272 -253 -12.3902 0.254
NP_443052.1_9 Forward -320 -301 -6.49039 0.283
NP_442154.1_1 Reverse -305 -323 -11.8789 0.217
NP_440261.1_5 Forward -200 -187 8.77074 0.0244
NP_440261.1_5 Reverse -193 -206 -2.63565 0.0924
NP_440261.1_5 Forward -120 -107 -3.32397 0.127
NP_440261.1_5 Reverse -113 -126 -6.37223 0.201
NP_440988.1_5 Forward -124 -105 17.1491 0.175
NP_440988.1_10 Reverse -190 -204 5.77014 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGTAATTCTCGATTCAGTTGGGCCAAAAGATTAATGCGTTGGAGTTGAAGATTTTGGGCCAGAGCTGGGGAGATAACCGCCACTGTCAGTACCTCCCGCTGGATACCTAGAGGTTTAGTACAGTCATGGAAACGGGGATCAATCACCTTCTGCCAAGCTTCTTTGACCAATTGGTAACGGCGCAGTTGTTCCCACCCTGGCGATCGCCCCAGGCGGCCCAGTAATTGTTCAAGATTGTTTAAGCCCATGGTGTGCTCCCTTGGCGGTGGAAATTCCCCGGCCATCTCCCCAAAGCCTAGACCGAAATGGGGTAAAGTAGGCAAGGTAGAATGGTTTCTGCGCCCGGATTTTTACCCAAATTAAGCTTTGCACGCCTTTGCATTTAACTAAGGAGAATTT

CDS

ATGTTAACCCTTAAAATCGCCGTTTATATCGTTGTTGGCTTGTTTATTTCCTTATTTATCTTCGGCTTTCTTTCCAGTGACCCCACCCGGAACCCTGGCCGCAAAGACTTTGAATAA

Protein

MLTLKIAVYIVVGLFISLFIFGFLSSDPTRNPGRKDFE