Your browser is old and dusty. Try Google Chrome!

Details for slr2143

ORF slr2143
Accession NP_441045.1
Symbol
Category Glutamate family / Nitrogen assimilation
Definition L-cysteine/cystine lyase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -185 -171 9.5377 0.0722
NP_441061.1_2 Reverse -178 -192 -1.8687 0.274
NP_441061.1_2 Reverse -263 -277 -2.06536 0.281
NP_440795.1_7 Forward -185 -178 14.6904 0.0123
NP_440795.1_7 Reverse -178 -185 14.6904 0.0123
NP_441418.1_6 Reverse -177 -196 -9.63698 0.0288
NP_442291.1_5 Forward -187 -171 11.2683 0.0402
NP_442291.1_5 Reverse -176 -192 5.95839 0.0727
NP_441453.1_4 Reverse -177 -185 16.539 0.00633
NP_441453.1_4 Forward -186 -178 16.539 0.00633
NP_441453.1_8 Forward -397 -380 12.5269 0.205
NP_442151.1_6 Forward -139 -125 9.2427 0.155
NP_441818.1_1 Forward -185 -174 15.4961 0.0264
NP_441818.1_1 Reverse -178 -189 9.30127 0.246
NP_441818.1_9 Reverse -319 -338 -10.3253 0.292
NP_440226.1_1 Reverse -177 -196 7.57094 0.103
NP_440226.1_1 Forward -186 -167 1.96607 0.282
NP_441630.1_3 Reverse -169 -188 4.81767 0.157
NP_441098.1_8 Forward -60 -41 5.11266 0.284
NP_440348.1_3 Reverse -251 -270 14.2574 0.282
NP_440150.1_2 Forward -350 -331 14.1583 0.157
NP_442744.1_9 Forward -277 -263 14.3866 0.266
NP_442287.1_3 Forward -194 -177 19.0159 0.0701
NP_442173.1_1 Forward -185 -177 15.4574 0.00633
NP_442173.1_1 Reverse -178 -186 15.4574 0.00633
NP_442173.1_1 Reverse -263 -271 5.72262 0.203
NP_442752.1_4 Forward -186 -179 13.8055 0.0199
NP_442752.1_4 Reverse -177 -184 13.8055 0.0199
NP_442752.1_4 Reverse -330 -337 10.5605 0.1
NP_443027.1_4 Forward -188 -178 11.8781 0.0872
NP_443027.1_4 Reverse -175 -185 11.0914 0.107
NP_441812.1_3 Reverse -176 -190 8.55439 0.251
NP_442975.1_10 Forward -190 -176 13.4703 0.0459
NP_442975.1_10 Reverse -126 -140 5.50552 0.219
NP_440784.1_7 Forward -185 -178 15.9687 0.0123
NP_440784.1_7 Reverse -178 -185 15.9687 0.0123
NP_442000.2_6 Reverse -160 -179 19.469 0.0799
NP_440061.1_9 Forward -188 -174 18.3868 0.00917
NP_440061.1_9 Forward -341 -327 5.80051 0.272
NP_440061.1_9 Reverse -175 -189 5.30886 0.29
NP_440928.1_4 Reverse -27 -46 10.0284 0.204
NP_440110.1_6 Forward -191 -172 14.1591 0.205
NP_441499.1_5 Forward -72 -58 15.4376 0.275
NP_442062.1_8 Reverse -177 -187 19.4496 0.000558
NP_442062.1_8 Forward -186 -176 17.3846 0.00193
NP_442062.1_8 Reverse -269 -279 2.83163 0.293
NP_442826.1_1 Forward -68 -49 4.12936 0.222
NP_441900.1_1 Reverse -180 -199 9.88101 0.273
NP_440304.1_4 Forward -71 -61 2.14332 0.299
NP_440304.1_4 Forward -188 -178 1.84832 0.299
NP_440304.1_4 Reverse -175 -185 1.84832 0.299
NP_442242.1_4 Forward -185 -178 14.3954 0.0124
NP_442242.1_4 Reverse -178 -185 14.3954 0.0124
NP_442242.1_4 Forward -138 -131 10.0689 0.174
NP_440044.1_8 Reverse -178 -197 -1.57384 0.248
NP_441035.1_3 Reverse -57 -76 1.27776 0.241
NP_441581.1_6 Forward -195 -176 9.38943 0.291
NP_442602.1_3 Reverse -184 -203 8.75091 0.0877
NP_441935.1_1 Reverse -178 -197 7.57094 0.24
NP_441619.1_8 Reverse -171 -185 8.84875 0.237
NP_441082.1_10 Forward -84 -71 9.85238 0.237
NP_442726.1_1 Reverse -172 -191 19.5673 0.0708
NP_441925.1_5 Forward -35 -21 16.2242 0.132
NP_441083.1_5 Forward -186 -176 20.3345 0.00053
NP_441083.1_5 Reverse -177 -187 11.3864 0.0159
NP_441083.1_5 Forward -339 -329 6.66654 0.0811
NP_441149.1_7 Forward -114 -95 0.982764 0.276
NP_441434.1_7 Reverse -179 -193 5.1128 0.225
NP_441738.1_2 Forward -184 -177 15.28 0.0102
NP_441738.1_2 Reverse -179 -186 15.28 0.0102
NP_440209.1_1 Reverse -177 -185 18.1123 0.00295
NP_440209.1_1 Forward -186 -178 18.1123 0.00295
NP_440209.1_2 Forward -110 -94 13.1366 0.17
NP_442889.1_8 Forward -189 -175 14.8469 0.0473
NP_442889.1_8 Forward -342 -328 7.07881 0.163
NP_440178.1_7 Reverse -336 -355 -14.3569 0.153
NP_442111.1_4 Reverse -176 -190 3.53951 0.24
NP_440851.1_3 Forward -33 -14 4.03102 0.245
NP_440851.1_6 Reverse -182 -199 7.11867 0.263
NP_440906.1_5 Forward -185 -178 15.8704 0.0124
NP_440906.1_5 Reverse -178 -185 15.8704 0.0124
NP_440906.1_5 Reverse -131 -138 9.47889 0.116
NP_440747.1_10 Reverse -174 -186 16.7552 0.0019
NP_440747.1_10 Forward -189 -177 7.31547 0.00577
NP_440747.1_10 Forward -342 -330 -12.5474 0.297
NP_441130.1_10 Reverse -175 -189 15.5359 0.0312
NP_441130.1_10 Forward -188 -174 9.43936 0.125
NP_441486.1_1 Forward -189 -175 4.91614 0.0399
NP_441486.1_1 Forward -142 -128 -0.492064 0.156
NP_441486.1_1 Reverse -127 -141 -4.03198 0.186
NP_441486.1_1 Reverse -174 -188 -4.13031 0.189
NP_441486.1_1 Reverse -266 -280 -5.01529 0.218
NP_440403.1_4 Forward -195 -176 4.916 0.111
NP_440403.1_10 Reverse -177 -196 5.50599 0.242
NP_440842.1_10 Forward -399 -385 13.7659 0.251
NP_441014.1_8 Forward -338 -319 -7.67036 0.281
NP_441014.1_10 Reverse -176 -195 13.175 0.104
NP_441014.1_10 Forward -140 -121 1.27698 0.23
NP_441014.1_10 Reverse -273 -292 -1.18128 0.257
NP_442848.1_4 Reverse -385 -399 5.70279 0.288
NP_443018.1_3 Forward -185 -178 14.8871 0.0123
NP_443018.1_3 Reverse -178 -185 14.8871 0.0123
NP_441634.1_8 Reverse -175 -189 14.8476 0.0248
NP_440376.1_1 Forward -186 -177 19.4693 0.000692
NP_440376.1_1 Reverse -177 -186 19.4693 0.000692
NP_440376.1_1 Reverse -269 -278 4.32629 0.163
NP_440376.1_1 Reverse -330 -339 2.85133 0.213
NP_440376.1_1 Reverse -262 -271 2.75299 0.215
NP_441588.1_4 Reverse -179 -189 7.05986 0.178
NP_441588.1_4 Forward -184 -174 6.46988 0.193
NP_442687.1_7 Forward -187 -177 15.8113 0.0125
NP_442687.1_7 Forward -391 -381 11.1898 0.0994
NP_442687.1_7 Reverse -176 -186 8.92815 0.0994
NP_442687.1_7 Forward -279 -269 7.05986 0.142
NP_442687.1_7 Reverse -289 -299 4.0116 0.271
NP_442485.1_3 Forward -197 -178 8.35759 0.13
NP_442485.1_3 Reverse -175 -194 -5.50708 0.291
NP_441846.1_10 Forward -324 -305 -23.2067 0.279
NP_442958.1_3 Reverse -166 -185 -1.86883 0.293
NP_440642.1_10 Reverse -378 -392 2.16228 0.283
NP_441422.1_7 Forward -188 -171 -3.5994 0.235
NP_441746.1_2 Reverse -164 -183 14.4541 0.248
NP_442296.1_9 Forward -185 -166 -0.885524 0.197
NP_442658.1_1 Forward -188 -178 17.0891 0.00615
NP_442658.1_1 Reverse -175 -185 7.94438 0.199
NP_440141.1_8 Forward -286 -267 6.4893 0.26
NP_442496.1_5 Forward -102 -84 4.44404 0.289
NP_440656.1_8 Forward -197 -178 -9.047 0.273
NP_441414.1_9 Forward -186 -167 12.5858 0.0155
NP_442937.1_5 Forward -191 -172 7.37428 0.254
NP_441958.1_5 Forward -187 -177 12.2714 0.00183
NP_441958.1_5 Reverse -176 -186 12.2714 0.00183
NP_441958.1_5 Reverse -261 -271 -0.609952 0.215
NP_441958.1_5 Forward -391 -381 -2.28158 0.27
NP_441127.1_1 Forward -314 -300 8.25939 0.3
NP_442486.1_4 Forward -184 -165 7.27595 0.273
NP_442836.1_5 Reverse -171 -190 14.1591 0.0588
NP_439905.1_1 Forward -185 -172 9.65572 0.216
NP_440984.1_7 Reverse -172 -186 11.3077 0.122
NP_440984.1_7 Forward -191 -177 5.89945 0.235
NP_439990.1_5 Reverse -172 -185 10.2457 0.128
NP_439990.1_5 Reverse -125 -138 7.6891 0.186
NP_442911.1_2 Reverse -167 -186 -3.24547 0.11
NP_440153.1_5 Reverse -178 -192 0.392915 0.299
NP_441591.1_10 Reverse -175 -194 4.32602 0.297
NP_443055.1_3 Forward -195 -176 21.3401 0.0162
NP_443055.1_6 Forward -194 -176 6.90155 0.164
NP_443055.1_6 Reverse -193 -211 1.69003 0.225
NP_440993.1_7 Forward -304 -290 16.4362 0.275
NP_440934.1_1 Reverse -163 -182 26.4505 0.00301
NP_440602.1_8 Reverse -262 -276 13.2743 0.174
NP_440138.1_6 Forward -185 -166 13.2733 0.109
NP_439975.1_1 Reverse -58 -77 18.9765 0.0758
NP_441099.1_5 Reverse -167 -186 5.30933 0.0469
NP_441099.1_5 Reverse -148 -167 -9.44032 0.223
NP_442002.1_9 Forward -187 -180 10.7572 0.185
NP_441294.1_7 Forward -190 -176 18.8495 0.00443
NP_441294.1_7 Forward -343 -329 11.1704 0.153
NP_441646.1_1 Reverse -170 -189 -1.27885 0.281
NP_441000.1_6 Reverse -176 -190 14.8476 0.0396
NP_441000.1_6 Forward -187 -173 -3.93365 0.225
NP_440147.1_4 Forward -188 -175 17.6205 0.00602
NP_440147.1_4 Reverse -175 -188 15.0639 0.0197
NP_441550.1_8 Reverse -175 -185 15.1225 0.0132
NP_441550.1_8 Forward -188 -178 8.82935 0.112
NP_441550.1_8 Forward -341 -331 5.87944 0.224
NP_441916.1_7 Reverse -177 -187 18.4663 0.00144
NP_441916.1_7 Forward -186 -176 10.3048 0.0261
NP_441041.1_4 Reverse -381 -400 -7.4737 0.188
NP_441041.1_4 Reverse -177 -196 -12.8819 0.276
NP_441041.1_7 Forward -189 -177 17.9128 0.00663
NP_441041.1_7 Reverse -259 -271 10.0414 0.103
NP_442396.1_5 Reverse -173 -186 11.819 0.0913
NP_440703.1_9 Forward -396 -383 11.0318 0.192
NP_441725.1_4 Reverse -172 -186 2.26061 0.287
NP_441725.1_5 Forward -185 -175 2.04498 0.115
NP_441725.1_5 Reverse -178 -188 2.04498 0.115
NP_439966.1_7 Forward -188 -178 17.9741 0.00631
NP_439966.1_7 Reverse -175 -185 15.3192 0.0152
NP_439966.1_7 Forward -273 -263 4.01116 0.295
NP_439966.1_9 Forward -188 -179 0.884706 0.253
NP_440736.1_3 Reverse -260 -279 6.29264 0.223
NP_440202.1_8 Forward -195 -176 10.1954 0.297
NP_442941.1_3 Forward -185 -175 19.2529 0.00262
NP_442941.1_3 Reverse -178 -188 10.7964 0.0116
NP_442941.1_3 Forward -138 -128 7.55152 0.0711
NP_440674.1_3 Reverse -177 -196 2.26107 0.267
NP_440289.1_2 Forward -189 -176 20.6688 0.00313
NP_440289.1_2 Reverse -174 -187 -3.61896 0.267
NP_440289.1_4 Reverse -82 -101 8.35759 0.297
NP_440983.1_9 Reverse -168 -187 1.57275 0.292
NP_440260.1_8 Reverse -321 -339 3.06741 0.175
NP_442281.1_1 Forward -191 -177 20.3534 0.00192
NP_442281.1_1 Forward -276 -262 14.6503 0.0168
NP_442281.1_1 Reverse -172 -186 7.86545 0.0907
NP_440177.1_9 Reverse -169 -188 12.0942 0.238
NP_442256.1_2 Reverse -175 -193 -8.53565 0.227
NP_441087.1_6 Reverse -373 -391 0.0184138 0.258
NP_441556.1_4 Forward -333 -314 15.4039 0.16
NP_440375.1_8 Reverse -178 -197 -0.197208 0.266
NP_442068.1_2 Reverse -259 -278 7.27595 0.3
NP_441644.1_6 Forward -186 -176 17.3841 0.00127
NP_441644.1_6 Forward -339 -329 12.0743 0.0392
NP_441644.1_6 Reverse -177 -187 10.1076 0.0628
NP_442215.1_2 Forward -141 -125 -1.71142 0.187
NP_442215.1_2 Forward -280 -264 -6.92296 0.281
NP_442215.1_2 Forward -348 -332 -7.31629 0.291
NP_440253.1_2 Reverse -177 -195 10.1472 0.0415
NP_440253.1_2 Reverse -262 -280 -3.52077 0.294
NP_440929.1_8 Forward -186 -177 19.2726 0.000701
NP_440929.1_8 Reverse -177 -186 19.2726 0.000701
NP_441346.1_7 Reverse -190 -209 10.2259 0.274
NP_442933.1_2 Reverse -17 -35 9.16921 0.257
NP_442933.1_10 Forward -186 -177 17.601 0.00325
NP_442933.1_10 Reverse -177 -186 17.601 0.00325
NP_441751.2_8 Forward -185 -171 14.0609 0.0132
NP_441751.2_8 Reverse -178 -192 -3.93365 0.157
NP_442926.1_3 Forward -185 -166 5.01433 0.245
NP_442554.1_8 Forward -185 -175 16.2046 0.0065
NP_442554.1_8 Reverse -178 -188 14.1397 0.0144
NP_442554.1_8 Reverse -331 -341 3.22496 0.235
NP_441762.1_7 Reverse -176 -188 2.98891 0.0676
NP_441762.1_7 Forward -187 -175 2.39892 0.0676
NP_442142.1_4 Forward -189 -176 13.8833 0.0324
NP_442142.1_4 Reverse -174 -187 6.80355 0.154
NP_442292.1_1 Forward -185 -176 18.486 0.00229
NP_442292.1_1 Reverse -178 -187 9.63616 0.0183
NP_442476.1_6 Forward -185 -171 9.34103 0.0888
NP_442381.1_8 Forward -189 -170 1.76941 0.103
NP_442381.1_8 Reverse -174 -193 -6.58872 0.161
NP_443009.1_5 Reverse -176 -187 18.3477 0.00265
NP_441715.1_4 Reverse -178 -188 18.8596 0.00741
NP_441715.1_4 Forward -185 -175 17.3846 0.0106
NP_441715.1_4 Forward -138 -128 4.99491 0.24
NP_440357.1_3 Reverse -206 -225 1.0811 0.275
NP_440881.1_4 Forward -118 -99 1.76941 0.226
NP_440279.1_2 Reverse -166 -185 10.7175 0.146
NP_440183.1_9 Reverse -179 -198 -3.83545 0.194
NP_441468.1_1 Forward -185 -178 15.8704 0.0124
NP_441468.1_1 Reverse -178 -185 15.8704 0.0124
NP_441020.2_6 Reverse -175 -192 6.92201 0.249
NP_441673.1_1 Forward -186 -177 20.8459 0.000698
NP_441673.1_1 Reverse -177 -186 20.8459 0.000698
NP_441673.1_1 Forward -278 -269 -8.06341 0.254
NP_441731.1_3 Reverse -169 -188 -6.58872 0.296
NP_442253.1_5 Forward -205 -188 -6.15601 0.297
NP_440265.1_7 Reverse -165 -179 16.3219 0.169
NP_441876.1_9 Reverse -66 -76 11.3859 0.275
NP_441826.1_2 Reverse -171 -185 -4.52363 0.296
NP_441826.1_2 Forward -396 -382 -4.62196 0.298
NP_441637.1_9 Forward -23 -5 5.72234 0.245
NP_442868.1_6 Reverse -175 -185 19.2529 0.00563
NP_442868.1_6 Forward -188 -178 10.3048 0.038
NP_442719.1_2 Reverse -186 -204 -0.374908 0.162
NP_441612.1_2 Forward -186 -176 8.54929 0.21
NP_442808.1_1 Forward -187 -177 18.4657 0.00201
NP_442808.1_1 Reverse -176 -186 8.63269 0.0481
NP_440145.1_3 Forward -196 -177 -1.86883 0.156
NP_440145.1_4 Forward -270 -260 16.5975 0.123
NP_442542.1_2 Forward -188 -175 15.6539 0.0793
NP_442542.1_9 Forward -193 -179 13.5686 0.108
NP_442050.1_5 Reverse -175 -185 14.3359 0.0206
NP_442050.1_5 Forward -188 -178 6.96107 0.27
NP_440601.1_8 Reverse -167 -186 17.3761 0.148
NP_440601.1_8 Reverse -183 -202 16.606 0.175
NP_440346.1_6 Reverse -47 -57 15.4106 0.221
NP_441114.1_3 Forward -200 -191 8.35786 0.231
NP_440558.1_2 Forward -399 -380 -0.983855 0.206
NP_441518.1_3 Forward -196 -177 2.16274 0.0598
NP_441518.1_3 Reverse -120 -139 -15.8318 0.299
NP_441878.1_6 Forward -187 -177 10.4031 0.0176
NP_441878.1_6 Reverse -176 -186 10.4031 0.0176
NP_441878.1_6 Reverse -192 -202 -7.49312 0.231
NP_441036.1_8 Forward -187 -177 17.7779 0.000554
NP_441036.1_8 Reverse -176 -186 8.33817 0.174
NP_441557.1_5 Forward -186 -177 19.9609 0.000699
NP_441557.1_5 Reverse -177 -186 19.9609 0.000699
NP_441445.1_1 Reverse -321 -340 8.45592 0.121
NP_441445.1_1 Forward -195 -176 6.4893 0.148
NP_441445.1_1 Reverse -121 -140 0.0977854 0.283
NP_442066.2_9 Reverse -173 -186 20.0788 0.00699
NP_442066.2_9 Forward -190 -177 8.77074 0.185
NP_441433.1_8 Forward -61 -42 -2.65548 0.27
NP_441739.1_2 Reverse -61 -77 4.08943 0.247
NP_441458.1_10 Forward -195 -176 1.0811 0.298
NP_442469.1_8 Forward -107 -93 15.8309 0.23
NP_442183.1_1 Forward -186 -172 11.5043 0.0702
NP_442183.1_1 Reverse -177 -191 10.6193 0.0821
NP_442183.1_1 Reverse -262 -276 10.4227 0.0845
NP_440190.1_5 Forward -288 -270 12.3105 0.282
NP_442135.1_5 Forward -195 -177 16.1446 0.24
NP_441574.1_1 Forward -107 -88 -7.86702 0.297
NP_442347.1_2 Forward -185 -176 12.4878 0.056
NP_442347.1_2 Reverse -178 -187 11.1111 0.056
NP_442347.1_2 Forward -362 -353 6.09625 0.191
NP_442347.1_2 Reverse -131 -140 3.83464 0.284
NP_442645.1_2 Reverse -169 -188 -14.6519 0.177
NP_441037.1_4 Forward -188 -178 6.92787 0.237
NP_442594.1_8 Forward -97 -78 5.99764 0.236
NP_442317.1_6 Reverse -172 -191 6.98095 0.231
NP_441633.1_3 Reverse -175 -188 10.8357 0.0286
NP_441633.1_3 Forward -188 -175 5.72248 0.0481
NP_440136.1_2 Forward -185 -178 15.9687 0.0123
NP_440136.1_2 Reverse -178 -185 15.9687 0.0123
NP_442998.1_5 Reverse -58 -68 11.9764 0.176
NP_442998.1_10 Forward -184 -177 15.5754 0.0102
NP_442998.1_10 Reverse -179 -186 15.5754 0.0102
NP_440899.1_1 Forward -107 -88 6.65079 0.267
NP_440299.1_1 Reverse -173 -186 10.9334 0.0529
NP_441799.1_1 Reverse -173 -187 16.1252 0.0153
NP_441799.1_1 Forward -190 -176 10.0287 0.0797
NP_441799.1_1 Forward -282 -268 6.48882 0.17
NP_441799.1_1 Forward -343 -329 3.53891 0.295
NP_441007.1_10 Reverse -172 -185 8.27909 0.115
NP_442201.1_10 Reverse -166 -185 -13.0786 0.27
NP_442201.1_10 Forward -197 -178 -14.6519 0.285
NP_440256.1_1 Reverse -174 -193 16.2241 0.0061
NP_440256.1_1 Forward -189 -170 -9.63698 0.284
NP_442961.1_4 Forward -144 -125 3.83436 0.288
NP_440087.1_1 Reverse -168 -187 -8.85033 0.285
NP_441559.1_4 Reverse -378 -397 7.96426 0.113
NP_441559.1_8 Forward -191 -177 -5.90027 0.271
NP_441559.1_8 Forward -74 -60 -5.90027 0.271
NP_440915.1_6 Forward -190 -176 3.63784 0.101
NP_440915.1_6 Forward -171 -157 1.27789 0.142
NP_440915.1_6 Reverse -173 -187 0.687908 0.155
NP_442069.1_10 Forward -185 -167 17.7187 0.0593
NP_442866.1_1 Reverse -175 -194 -6.09707 0.249
NP_441464.1_10 Reverse -328 -342 13.1759 0.199
NP_441464.1_10 Reverse -385 -399 8.45605 0.281
NP_440306.1_3 Forward -307 -288 4.81767 0.295
NP_442993.1_1 Reverse -262 -278 0.451859 0.0636
NP_442993.1_1 Reverse -330 -346 -1.41643 0.0906
NP_442993.1_1 Reverse -177 -193 -7.70961 0.146
NP_442993.1_1 Reverse -290 -306 -11.2495 0.24
NP_442386.1_9 Forward -187 -178 15.7322 0.0144
NP_442386.1_9 Reverse -176 -185 13.8639 0.0289
NP_442386.1_10 Forward -80 -67 4.54251 0.262
NP_441340.1_5 Forward -185 -178 15.6737 0.0124
NP_441340.1_5 Reverse -178 -185 15.6737 0.0124
NP_442186.1_10 Forward -279 -260 19.5664 0.112
NP_441947.1_4 Forward -197 -178 11.2092 0.267
NP_442791.1_5 Forward -194 -175 -10.0303 0.279
NP_440168.1_9 Reverse -175 -194 -5.40875 0.296
NP_440161.1_3 Reverse -175 -194 15.2408 0.117
NP_440586.1_8 Forward -185 -178 13.2151 0.026
NP_440586.1_8 Reverse -178 -185 13.2151 0.026
NP_440586.1_8 Forward -138 -131 9.3802 0.156
NP_442251.1_6 Forward -185 -178 15.2804 0.0124
NP_442251.1_6 Reverse -178 -185 15.2804 0.0124
NP_440192.1_4 Forward -107 -88 14.1516 0.169
NP_440684.1_9 Reverse -171 -185 12.9793 0.168
NP_441262.1_3 Reverse -177 -184 14.7888 0.0223
NP_441262.1_3 Forward -186 -179 14.7888 0.0223
NP_441262.1_3 Forward -139 -132 5.15232 0.265
NP_443051.1_1 Reverse -176 -185 10.4228 0.00754
NP_443051.1_1 Forward -187 -178 10.4228 0.00754
NP_439996.1_6 Reverse -320 -339 5.96975 0.3
NP_441232.1_2 Reverse -327 -346 9.43923 0.236
NP_439984.1_3 Reverse -170 -184 18.9768 0.0523
NP_439937.1_9 Reverse -59 -76 -6.45167 0.157
NP_440408.1_7 Forward -330 -311 8.75091 0.269
NP_440439.1_1 Forward -189 -176 3.06754 0.121
NP_440439.1_1 Reverse -174 -187 1.88757 0.139
NP_439943.1_7 Reverse -105 -124 3.6377 0.29
NP_440372.1_2 Forward -185 -178 16.3621 0.0124
NP_440372.1_2 Reverse -178 -185 16.3621 0.0124
NP_441138.1_5 Forward -21 -8 8.84703 0.238
NP_441138.1_5 Forward -24 -11 3.02202 0.297
NP_440316.1_10 Reverse -386 -396 9.32148 0.235
NP_440316.1_10 Forward -325 -315 5.78156 0.281
NP_440139.1_1 Forward -192 -173 4.12856 0.19
NP_440267.1_2 Forward -191 -177 12.2903 0.125
NP_442384.1_10 Forward -186 -173 19.2922 0.00338
NP_442384.1_10 Forward -363 -350 13.0973 0.0227
NP_442384.1_10 Reverse -381 -394 4.05085 0.17
NP_442384.1_10 Reverse -177 -190 2.87088 0.21
NP_442384.1_10 Forward -339 -326 1.78924 0.247
NP_442384.1_10 Reverse -196 -209 0.60927 0.286
NP_442114.1_4 Reverse -177 -188 9.20345 0.17
NP_441980.1_8 Forward -171 -152 7.96426 0.258
NP_441877.1_7 Forward -191 -172 4.03023 0.218
NP_442790.1_4 Reverse -168 -187 7.86593 0.0729
NP_442790.1_4 Forward -195 -176 -6.1954 0.144
NP_442262.1_10 Forward -185 -178 14.1988 0.0123
NP_442262.1_10 Reverse -178 -185 14.1988 0.0123
NP_441689.1_5 Reverse -175 -185 5.78111 0.197
NP_440344.1_10 Forward -193 -176 8.10198 0.0114
NP_440344.1_10 Reverse -123 -140 -10.8759 0.194
NP_440344.1_10 Reverse -255 -272 -13.9242 0.298
NP_440282.1_10 Forward -184 -165 -6.68705 0.25
NP_440531.1_6 Forward -194 -175 8.45592 0.0844
NP_440531.1_6 Reverse -169 -188 4.52268 0.124
NP_440531.1_6 Reverse -202 -221 3.44104 0.145
NP_441965.1_10 Forward -189 -173 9.00665 0.123
NP_442693.1_7 Forward -187 -168 13.9625 0.202
NP_440297.1_9 Forward -185 -175 -0.118297 0.282
NP_440297.1_9 Reverse -178 -188 -0.118297 0.282
NP_440297.1_9 Reverse -382 -392 -0.609952 0.292
NP_442280.1_10 Reverse -378 -396 6.52583 0.274
NP_441592.1_4 Forward -186 -167 -0.885524 0.247
NP_440999.1_9 Forward -190 -176 11.406 0.0448
NP_440888.1_2 Forward -186 -172 14.1586 0.02
NP_440888.1_2 Reverse -177 -191 13.8636 0.0231
NP_441771.1_4 Forward -375 -356 2.55606 0.213
NP_440600.1_4 Reverse -169 -187 6.50899 0.0974
NP_440600.1_4 Forward -194 -176 0.21581 0.142
NP_440822.1_4 Reverse -104 -122 19.6347 0.255
NP_441543.1_2 Reverse -178 -187 18.486 0.00236
NP_441543.1_2 Forward -185 -176 16.9127 0.00359
NP_441543.1_2 Forward -138 -129 4.42462 0.246
NP_442845.1_2 Reverse -171 -185 7.9644 0.195
NP_441469.1_8 Forward -187 -178 16.126 0.00797
NP_441469.1_8 Reverse -176 -185 6.48957 0.227
NP_443064.1_6 Forward -186 -176 12.5669 0.0796
NP_442337.1_8 Reverse -319 -338 4.03102 0.21
NP_442578.1_7 Forward -185 -178 14.5921 0.026
NP_442578.1_7 Reverse -178 -185 14.5921 0.026
NP_440710.1_1 Forward -194 -176 -0.374176 0.163
NP_441462.1_2 Forward -186 -176 11.5831 0.00406
NP_441462.1_2 Reverse -177 -187 11.5831 0.00406
NP_441929.1_6 Forward -119 -100 4.62101 0.294
NP_443062.1_1 Forward -186 -168 13.5188 0.0616
NP_443062.1_1 Reverse -177 -195 10.3986 0.117
NP_443062.1_6 Reverse -169 -188 0.491109 0.294
NP_441601.1_2 Forward -345 -326 -4.6221 0.286
NP_442204.1_1 Forward -356 -345 9.79344 0.0736
NP_441560.1_10 Forward -194 -175 6.19431 0.292
NP_440516.1_2 Reverse -171 -189 -2.53746 0.299
NP_440516.1_8 Forward -186 -177 16.9127 0.00442
NP_440516.1_8 Reverse -177 -186 16.9127 0.00442
NP_442428.1_5 Forward -185 -178 15.8704 0.0124
NP_442428.1_5 Reverse -178 -185 15.8704 0.0124
NP_442120.1_10 Forward -277 -258 -6.09707 0.203
NP_440673.1_3 Forward -184 -177 12.4288 0.0426
NP_440673.1_3 Reverse -179 -186 12.4288 0.0426
NP_440673.1_3 Reverse -317 -324 6.72562 0.277
NP_441052.1_2 Forward -186 -176 19.9412 0.00106
NP_441052.1_2 Reverse -177 -187 10.5014 0.0285
NP_441052.1_2 Reverse -330 -340 4.99491 0.135
NP_441052.1_2 Forward -339 -329 4.0116 0.168
NP_442219.1_9 Forward -185 -176 17.7976 0.00718
NP_442219.1_9 Reverse -178 -187 8.35786 0.0681
NP_440436.1_4 Reverse -178 -187 18.1905 0.00233
NP_440436.1_4 Forward -185 -176 17.2072 0.00233
NP_440436.1_4 Forward -138 -129 4.42421 0.265
NP_441884.1_9 Forward -189 -170 -16.2252 0.138
NP_441884.1_9 Forward -274 -255 -21.9284 0.272
NP_442864.1_7 Forward -396 -378 8.47561 0.274
NP_440314.1_9 Forward -185 -166 3.24438 0.0849
NP_442907.1_2 Forward -372 -354 8.86894 0.259
NP_441719.1_4 Forward -185 -178 16.3621 0.0124
NP_441719.1_4 Reverse -178 -185 16.3621 0.0124
NP_441733.1_10 Reverse -174 -187 7.09911 0.156
NP_441004.1_1 Reverse -187 -206 -13.6686 0.26
NP_441004.1_2 Forward -400 -381 0.786102 0.23
NP_441004.1_4 Forward -392 -382 8.04317 0.282
NP_442813.1_4 Forward -64 -45 5.50599 0.197
NP_442813.1_4 Forward -65 -46 -8.06369 0.299
NP_442139.1_7 Reverse -148 -167 11.4058 0.19
NP_440129.1_10 Forward -193 -179 1.76955 0.297
NP_443054.1_2 Reverse -175 -189 10.6193 0.0761
NP_443054.1_2 Forward -273 -259 2.65453 0.242
NP_441851.1_10 Forward -187 -177 16.008 0.00552
NP_441851.1_10 Reverse -176 -186 15.8113 0.00552
NP_442622.1_8 Forward -186 -168 -8.83064 0.138
NP_442622.1_8 Reverse -177 -195 -9.32229 0.145
NP_442011.1_1 Forward -187 -168 4.22769 0.232
NP_442856.1_7 Forward -195 -176 -3.3438 0.243
NP_441668.1_4 Reverse -167 -186 -1.96717 0.285
NP_442515.1_1 Forward -187 -173 11.6026 0.0393
NP_442515.1_1 Reverse -176 -190 3.04785 0.125
NP_442515.1_1 Reverse -6 -20 -1.47537 0.255
NP_441396.1_5 Forward -55 -46 7.47288 0.252
NP_440593.1_3 Reverse -81 -100 -5.31042 0.259
NP_440165.1_5 Reverse -176 -195 -3.54046 0.22
NP_440165.1_5 Forward -187 -168 -7.96535 0.286
NP_441349.1_10 Reverse -167 -186 3.44104 0.0669
NP_441349.1_10 Forward -196 -177 -8.752 0.278
NP_440432.1_9 Reverse -178 -193 16.8928 0.00961
NP_442843.1_1 Forward -185 -166 3.93269 0.153
NP_442843.1_1 Forward -112 -93 -10.4236 0.278
NP_442843.1_1 Reverse -178 -197 -10.6203 0.279
NP_439960.1_10 Reverse -164 -182 -4.60241 0.293
NP_440474.1_8 Reverse -178 -192 7.86545 0.196
NP_440588.1_2 Reverse -168 -187 6.29264 0.0584
NP_440588.1_2 Reverse -214 -233 0.58944 0.146
NP_442006.1_2 Forward -195 -178 -17.1691 0.27
NP_442006.1_2 Forward -56 -39 -17.6607 0.279
NP_442006.1_2 Forward -390 -373 -18.7424 0.295
NP_441570.1_1 Reverse -177 -195 8.57394 0.0134
NP_441570.1_1 Forward -139 -121 -11.0923 0.187
NP_441570.1_1 Forward -186 -168 -13.9439 0.225
NP_440078.1_10 Reverse -153 -172 5.70265 0.224
NP_441078.1_4 Forward -186 -177 19.6659 0.0007
NP_441078.1_4 Reverse -177 -186 19.6659 0.0007
NP_442729.1_8 Reverse -173 -186 10.639 0.125
NP_441663.1_8 Forward -192 -173 2.45773 0.203
NP_442348.1_2 Forward -70 -61 13.5694 0.179
NP_442443.1_1 Reverse -202 -221 -5.50708 0.282
NP_440526.1_3 Reverse -178 -189 2.02482 0.267
NP_440526.1_3 Forward -185 -174 1.04151 0.267
NP_441432.1_8 Reverse -176 -185 16.8143 0.00595
NP_441432.1_8 Forward -325 -316 9.24284 0.0755
NP_441432.1_8 Forward -187 -178 8.25953 0.0755
NP_441432.1_9 Reverse -273 -286 9.66489 0.269
NP_442320.1_8 Forward -192 -178 4.91614 0.0442
NP_442320.1_8 Reverse -171 -185 -4.81863 0.188
NP_442344.1_7 Reverse -178 -197 -5.70374 0.168
NP_440321.1_1 Forward -88 -71 11.5436 0.28
NP_442815.1_2 Forward -316 -298 12.1139 0.144
NP_440760.1_1 Forward -186 -167 -3.44213 0.0342
NP_442797.1_2 Forward -191 -173 13.5317 0.239
NP_442797.1_6 Reverse -376 -395 8.51591 0.265
NP_442353.1_4 Forward -192 -173 5.50519 0.183
NP_440913.1_1 Reverse -175 -193 10.2456 0.175
NP_440913.1_3 Forward -396 -383 16.9322 0.184
NP_441072.1_2 Forward -197 -178 8.25926 0.24
NP_442489.1_7 Forward -186 -177 20.1576 0.000695
NP_442489.1_7 Reverse -177 -186 20.1576 0.000695
NP_442489.1_7 Reverse -330 -339 -1.6719 0.235
NP_442489.1_7 Reverse -269 -278 -1.77023 0.247
NP_442489.1_7 Reverse -262 -271 -1.86856 0.259
NP_442079.1_7 Forward -185 -166 0.982764 0.266
NP_440559.1_1 Forward -185 -176 17.4043 0.00658
NP_440559.1_1 Reverse -178 -187 8.75118 0.0586
NP_441659.2_8 Forward -186 -176 18.1713 0.00133
NP_441659.2_8 Reverse -177 -187 11.9764 0.0147
NP_441659.2_8 Forward -339 -329 3.22496 0.169
NP_441040.1_2 Reverse -379 -398 -5.11376 0.174
NP_441040.1_2 Reverse -372 -391 -10.3253 0.245
NP_442849.1_1 Forward -308 -294 7.76774 0.282
NP_441800.1_7 Reverse -33 -51 -3.02911 0.268
NP_440779.1_5 Reverse -177 -194 -5.76269 0.152
NP_442346.1_5 Reverse -176 -186 16.6963 0.00248
NP_442346.1_5 Forward -187 -177 9.02648 0.118
NP_440352.1_5 Forward -384 -365 12.5584 0.229
NP_440025.1_3 Reverse -189 -203 11.2885 0.29
NP_440831.1_3 Reverse -184 -203 7.35791 0.256
NP_440831.1_3 Reverse -168 -187 6.77545 0.27
NP_442857.1_5 Forward -301 -282 10.0292 0.291
NP_441653.1_1 Forward -36 -22 18.9775 0.155
NP_441653.1_2 Forward -197 -178 3.91615 0.264
NP_440010.1_6 Reverse -166 -185 8.06259 0.213
NP_440010.1_10 Reverse -318 -337 2.0644 0.29
NP_442551.1_4 Forward -204 -189 -0.80675 0.245
NP_440847.1_3 Reverse -39 -53 11.5037 0.263
NP_442603.1_7 Forward -186 -172 14.6503 0.0613
NP_441888.1_7 Forward -191 -177 12.0943 0.0743
NP_441888.1_7 Reverse -172 -186 2.75286 0.225
NP_440946.1_6 Reverse -93 -112 1.67108 0.294
NP_441948.1_4 Forward -193 -175 6.50899 0.0633
NP_441833.1_4 Forward -185 -178 15.9687 0.0124
NP_441833.1_4 Reverse -178 -185 15.9687 0.0124
NP_441833.1_4 Reverse -131 -138 4.46401 0.256
NP_440751.1_3 Reverse -95 -114 7.17681 0.287
NP_441329.1_1 Reverse -286 -305 6.63627 0.252
NP_441895.1_2 Forward -329 -310 -26.5499 0.24
NP_441895.1_2 Forward -333 -314 -26.9432 0.275
NP_441112.1_6 Forward -196 -177 5.70265 0.172
NP_442162.1_9 Forward -185 -178 16.2637 0.0124
NP_442162.1_9 Reverse -178 -185 16.2637 0.0124
NP_440671.1_6 Forward -341 -322 14.2566 0.221
NP_442140.1_3 Reverse -178 -188 14.238 0.0486
NP_442140.1_3 Forward -185 -175 10.3048 0.0902
NP_441609.1_1 Forward -68 -49 2.55606 0.189
NP_440875.1_9 Reverse -179 -189 16.6457 0.0145
NP_440875.1_9 Forward -172 -162 8.37203 0.233
NP_441813.1_5 Forward -188 -178 19.4496 0.00647
NP_441813.1_5 Reverse -175 -185 18.1713 0.00743
NP_440590.1_4 Reverse -178 -191 4.8375 0.0585
NP_440590.1_4 Forward -185 -172 2.67422 0.0835
NP_440590.1_4 Forward -138 -125 -4.40561 0.261
NP_440590.1_4 Reverse -159 -172 -6.07724 0.299
NP_440567.1_1 Forward -185 -171 2.65453 0.167
NP_440567.1_1 Reverse -178 -192 -0.393733 0.281
NP_442497.1_10 Forward -185 -176 10.4228 0.0087
NP_442497.1_10 Reverse -178 -187 10.4228 0.0087
NP_440821.1_4 Forward -188 -178 10.2065 0.0163
NP_440821.1_4 Reverse -175 -185 9.41981 0.0286
NP_441239.1_9 Forward -188 -176 14.1986 0.0288
NP_441239.1_9 Reverse -175 -187 7.80712 0.148
NP_441239.1_9 Forward -398 -386 3.97222 0.269
NP_441951.1_4 Reverse -381 -400 3.34271 0.275
NP_441892.1_1 Forward -195 -178 3.57876 0.123
NP_441892.1_1 Forward -211 -194 -5.95935 0.294
NP_441017.1_8 Forward -72 -57 6.56807 0.297
NP_440876.1_5 Forward -184 -165 10.7175 0.244
NP_441617.1_6 Reverse -210 -229 4.32602 0.155
NP_441617.1_6 Forward -39 -20 -5.60541 0.274
NP_442138.1_10 Reverse -177 -196 21.7306 0.00921
NP_440546.1_4 Reverse -177 -187 11.8882 0.0679
NP_440546.1_4 Forward -186 -176 10.046 0.109
NP_440546.1_4 Reverse -387 -397 9.3673 0.142
NP_441230.1_5 Forward -207 -188 -0.4922 0.287
NP_440055.1_8 Forward -369 -350 18.2882 0.187
NP_440462.1_4 Reverse -323 -337 5.80112 0.29
NP_440462.1_6 Forward -188 -178 17.2863 0.00752
NP_440462.1_6 Reverse -175 -185 9.61647 0.0429
NP_440868.1_4 Forward -190 -178 10.3637 0.0388
NP_440868.1_4 Reverse -173 -185 9.97041 0.0405
NP_440868.1_6 Reverse -190 -209 17.8957 0.105
NP_441204.1_1 Forward -195 -176 9.0459 0.25
NP_441582.1_5 Reverse -267 -286 8.84842 0.164
NP_440638.2_8 Forward -56 -39 12.4285 0.215
NP_442402.1_10 Reverse -42 -52 14.3359 0.18
NP_442402.1_10 Reverse -250 -260 12.5659 0.206
NP_441848.1_4 Reverse -53 -69 8.41009 0.288
NP_441848.1_7 Reverse -94 -113 9.63507 0.196
NP_441084.1_6 Forward -392 -378 11.3802 0.205
NP_440696.1_3 Reverse -177 -195 5.03403 0.198
NP_440696.1_3 Reverse -377 -395 3.06741 0.211
NP_442039.1_4 Forward -185 -178 15.1821 0.0124
NP_442039.1_4 Reverse -178 -185 15.1821 0.0124
NP_442039.1_4 Reverse -263 -270 7.02061 0.269
NP_441926.1_3 Reverse -330 -346 8.90832 0.17
NP_441926.1_3 Reverse -262 -278 4.18844 0.197
NP_440825.1_6 Forward -48 -29 9.0459 0.285
NP_441053.1_3 Forward -328 -309 -1.18052 0.278
NP_442786.1_2 Reverse -23 -42 14.6576 0.133
NP_442837.1_3 Forward -185 -178 15.7721 0.0124
NP_442837.1_3 Reverse -178 -185 15.7721 0.0124
NP_440160.1_5 Forward -182 -172 14.5325 0.291
NP_442053.1_1 Forward -186 -177 18.3876 0.0007
NP_442053.1_1 Reverse -177 -186 18.3876 0.0007
NP_440505.1_3 Reverse -175 -185 18.3679 0.00213
NP_440505.1_3 Forward -188 -178 15.9097 0.00857
NP_441252.1_6 Reverse -190 -197 14.3954 0.168
NP_442532.1_4 Reverse -127 -145 7.86797 0.289
NP_440914.1_1 Forward -186 -176 17.5935 0.000537
NP_440914.1_1 Forward -271 -261 9.98138 0.164
NP_440914.1_1 Reverse -177 -187 8.6151 0.186
NP_441011.1_8 Reverse -178 -187 16.9127 0.00602
NP_441011.1_8 Forward -185 -176 8.25953 0.144
NP_442101.1_6 Forward -43 -24 17.699 0.133
NP_442533.1_1 Forward -88 -69 -15.5368 0.256
NP_442533.1_6 Forward -186 -177 17.2076 0.00137
NP_442533.1_6 Reverse -177 -186 17.2076 0.00137
NP_442533.1_6 Forward -339 -330 11.9961 0.0343
NP_441089.1_10 Forward -335 -316 1.67108 0.294
NP_442232.1_3 Reverse -169 -188 -13.3736 0.282
NP_441219.1_6 Forward -196 -178 10.5406 0.252
NP_441482.1_7 Reverse -171 -185 -4.7203 0.156
NP_441482.1_7 Forward -192 -178 -12.1934 0.29
NP_439944.1_9 Forward -185 -175 10.5014 0.0887
NP_439944.1_9 Forward -138 -128 7.45319 0.141
NP_442269.1_10 Reverse -166 -185 8.25926 0.194
NP_441028.1_6 Forward -65 -55 4.89613 0.275
NP_441028.1_6 Reverse -43 -53 4.10949 0.278
NP_440115.1_6 Reverse -174 -184 6.76487 0.167
NP_440007.1_9 Reverse -126 -140 8.75105 0.171
NP_440007.1_9 Forward -356 -342 0.687908 0.292
NP_442728.1_7 Forward -396 -382 11.3077 0.289
NP_440608.1_5 Reverse -27 -41 18.1551 0.191
NP_440608.1_6 Forward -338 -319 8.84842 0.238
NP_441602.1_3 Reverse -172 -191 -4.81876 0.274
NP_441972.1_5 Forward -185 -166 -10.227 0.3
NP_441106.1_1 Forward -187 -178 18.191 0.0028
NP_441106.1_1 Reverse -176 -185 9.63616 0.0311
NP_441216.1_4 Reverse -376 -395 9.24257 0.27
NP_439903.1_7 Forward -59 -40 2.85105 0.281
NP_442306.1_10 Reverse -172 -191 -20.0601 0.202
NP_441286.1_1 Forward -140 -128 7.80712 0.0258
NP_441286.1_1 Reverse -176 -188 6.03717 0.0258
NP_441286.1_1 Forward -187 -175 3.38223 0.0467
NP_441385.1_1 Forward -77 -62 17.6795 0.224
NP_441385.1_1 Forward -321 -306 15.3195 0.28
NP_440670.1_8 Forward -186 -177 18.3876 0.000699
NP_440670.1_8 Reverse -177 -186 18.3876 0.000699
NP_440670.1_8 Reverse -262 -271 5.11294 0.171
NP_440670.1_8 Reverse -130 -139 4.62128 0.189
NP_440886.1_7 Forward -187 -177 17.7774 0.0011
NP_440886.1_7 Forward -272 -262 12.0743 0.0805
NP_440886.1_7 Reverse -176 -186 7.94438 0.0805
NP_440886.1_7 Forward -340 -330 5.78111 0.163
NP_440513.1_4 Forward -186 -167 8.65258 0.295
NP_440907.2_8 Reverse -178 -188 7.94438 0.117
NP_441905.1_3 Forward -278 -260 17.9146 0.193
NP_441021.1_1 Forward -185 -166 1.17943 0.0848
NP_441463.1_2 Forward -37 -19 -0.686551 0.29
NP_441463.1_3 Forward -196 -177 7.57094 0.052
NP_441463.1_3 Reverse -167 -186 -0.590531 0.133
NP_441626.1_2 Forward -185 -178 15.7721 0.0124
NP_441626.1_2 Reverse -178 -185 15.7721 0.0124
NP_442365.1_7 Reverse -173 -192 2.0644 0.168
NP_442794.1_1 Reverse -173 -185 7.31547 0.142
NP_442794.1_1 Reverse -126 -138 6.62715 0.169
NP_440387.1_1 Forward -186 -170 6.45005 0.0282
NP_441431.1_2 Forward -189 -175 8.25877 0.221
NP_441431.1_2 Reverse -67 -81 7.17714 0.247
NP_441488.1_7 Reverse -171 -190 5.70265 0.155
NP_441836.1_2 Forward -192 -173 -1.96717 0.224
NP_441993.1_1 Reverse -337 -356 7.50176 0.163
NP_441993.1_1 Reverse -381 -400 2.53143 0.257
NP_441993.1_1 Reverse -194 -213 0.484826 0.298
NP_440114.1_10 Reverse -177 -191 15.7325 0.0234
NP_440114.1_10 Forward -186 -172 5.80112 0.292
NP_442090.1_10 Forward -78 -65 12.3107 0.18
NP_442323.1_7 Reverse -93 -112 2.06362 0.273
NP_441510.2_6 Forward -196 -177 12.88 0.267
NP_441272.1_7 Forward -56 -46 13.2547 0.271
NP_440293.1_3 Reverse -185 -204 -1.27885 0.239
NP_440766.1_4 Reverse -258 -272 7.86607 0.0871
NP_439910.1_2 Forward -194 -177 -21.3973 0.183
NP_442867.1_8 Reverse -179 -198 7.17762 0.244
NP_440457.1_1 Forward -394 -382 1.12062 0.245
NP_440457.1_1 Forward -190 -178 -0.649339 0.271
NP_440457.1_1 Reverse -173 -185 -0.74767 0.273
NP_440473.1_9 Forward -197 -178 -0.000545616 0.128
NP_442509.1_5 Forward -194 -177 16.2627 0.164
NP_442509.1_9 Reverse -177 -187 16.2041 0.00739
NP_442509.1_9 Forward -186 -176 8.14104 0.192
NP_440734.1_9 Forward -196 -177 17.6007 0.0988
NP_440554.1_4 Reverse -178 -188 16.4996 0.0189
NP_440554.1_4 Forward -185 -175 8.92815 0.0646
NP_441885.1_5 Forward -186 -176 20.9245 0.000538
NP_441885.1_5 Reverse -177 -187 11.4848 0.00668
NP_441885.1_5 Reverse -330 -340 -0.904945 0.241
NP_441885.1_5 Forward -390 -380 -1.29827 0.259
NP_440478.1_10 Forward -188 -174 16.4209 0.107
NP_442703.1_9 Reverse -18 -36 3.3624 0.292
NP_442341.1_7 Forward -272 -258 9.34103 0.0751
NP_442341.1_7 Forward -340 -326 6.78443 0.118
NP_442341.1_7 Forward -187 -173 6.78443 0.118
NP_442341.1_7 Reverse -176 -190 3.14618 0.234
NP_441173.1_9 Reverse -44 -52 11.3271 0.226
NP_442395.2_4 Forward -187 -168 9.14342 0.12
NP_440423.1_6 Forward -194 -175 3.34271 0.0831
NP_440423.1_6 Reverse -169 -188 -7.27704 0.138
NP_443000.1_7 Reverse -175 -185 19.9412 0.00223
NP_443000.1_7 Forward -188 -178 11.5831 0.0344
NP_443000.1_7 Reverse -128 -138 4.50326 0.188
NP_440552.1_8 Reverse -291 -308 11.8931 0.236
NP_441842.1_10 Reverse -255 -269 7.27608 0.264
NP_440275.1_3 Forward -188 -178 15.418 0.0178
NP_440275.1_3 Reverse -175 -185 15.123 0.0182
NP_440091.1_1 Forward -190 -178 10.7571 0.0429
NP_443010.1_10 Forward -189 -172 2.57753 0.273
NP_441105.1_3 Reverse -166 -185 -8.55534 0.274
NP_440216.1_1 Reverse -177 -191 16.1259 0.00307
NP_440216.1_1 Forward -186 -172 -0.885388 0.0286
NP_440172.1_1 Forward -186 -176 15.0247 0.00945
NP_440172.1_1 Forward -271 -261 9.51814 0.0586
NP_440172.1_1 Reverse -177 -187 8.73149 0.0586
NP_440172.1_1 Reverse -269 -279 1.84832 0.294
NP_440167.1_3 Forward -196 -177 9.3409 0.258
NP_442015.1_10 Forward -190 -177 3.16588 0.185
NP_442015.1_10 Reverse -173 -186 2.67422 0.187
NP_441045.1_2 Forward -168 -149 23.8939 0.0139
NP_441045.1_6 Forward -334 -316 18.5045 0.22
NP_441226.1_7 Forward -185 -178 14.4934 0.0123
NP_441226.1_7 Reverse -178 -185 14.4934 0.0123
NP_441226.1_7 Forward -389 -382 9.47853 0.147
NP_441111.1_7 Forward -185 -177 18.7023 0.00294
NP_441111.1_7 Reverse -178 -186 18.7023 0.00294
NP_441766.1_2 Forward -186 -177 17.5026 0.00297
NP_441766.1_2 Reverse -177 -186 17.5026 0.00297
NP_442252.1_3 Forward -193 -175 9.95058 0.224
NP_440416.1_1 Reverse -177 -196 -5.70374 0.155
NP_440416.1_9 Reverse -170 -189 -16.7168 0.22
NP_443052.1_8 Forward -196 -177 10.7175 0.0166
NP_442403.1_9 Reverse -165 -184 20.1573 0.0643
NP_440591.1_9 Reverse -170 -188 12.1139 0.0935
NP_440591.1_9 Reverse -336 -354 3.75572 0.296
NP_440261.1_5 Forward -185 -172 -2.53732 0.0924
NP_440261.1_5 Reverse -178 -191 -12.1738 0.272
NP_440261.1_5 Reverse -382 -395 -12.2721 0.277
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGACCCCAGGGCCAACGGTAAACGGGAGCTAAATTCACTGATGCCCAGCAGATGGTAACTGCCCATCACCAACCAGGCAATGAGGGGAGGTTTGGATAAAAAAGGTTGCCCTAAATAGGTGGGAAAACGCCAATCTCCTCTGAGGAAAGTATCCTGAGCTGTAGTAGCGTAATAACCTTCGTCAAAATCCCGCAGGGGTACATTGCCCAAACCGGCGATCGCCAGAATCAGGGCCGCTCCGGTAAGCAGCAGTAAATATTTGCGATCATCATTGAGGGCAGGAAAGTTCAAGGGCGGAATCTTGGGGCATGGTAACTGTTGGACTTGGGGGGCATTTTCCCATGTTCTTGGGGGAAGTTGAGGTTTTTGTTAAGGTATTTTGTTGATGTTTCCCCACTA

CDS

ATGGCTGACCCTGTGAACCTGATACCCGATCGCCAGCAATTTCCCGGCCTAGCGAATAAGACCTATTTTAATTTTGGCGGCCAGGGGATTTTACCCACCGTAGCCTTGGAAGCCATTACGGCCATGTATGGCTATTTGCAGGAAAATGGCCCTTTTTCCATTGCCGCCAACCAATACATTCAGCAATTAATTGCCCAACTGCGCCAAGCCCTGGGGGAAACCTTTAACGTTGACCCTAACACCATCACCATTACCGATAACGTCACCACGGGCTGTGACATTGTGCTTTGGGGCATAGATTGGCAGAAGGGCGATGAAATTTTGCTCACCGACTGCGAACATCCCGGCATTATTGCCATCGTCCAGGCGATCGCCGCTCGGTTTGGGGTCACGTACCGTTTTTTCCCGGTGGCGGACACATTAAACCAGGGGGATGCGGCCGCAGTATTAGTTAATCATTTGGGGCCGAAAACCCGTTTAGTTATCCTCAGCCATTTACTCTGGAATACTGGCCAGGTATTGCCCCTAGGAGAAATTATGGCCGTTTGTCGCCGCCATCAAGGGGATTATCCAGTGCGGGTGCTAGTGGATGGGGCGCAGTCTGCCGGTTCCTTACCCTTGGATTTTTCCCGGCTAGAAGTGGATTATTACGCTTTTACAGGGCATAAATGGTTTGCTGGCCCCGCTGGGGTGGGGGGATTGTATATCCATGGCGATGCCAAAGGCACGGCGAATGCCGCACGCCTGGGGGAAATTAACCCGACCTATGTGGGCTGGCGTAGTATCACCTATGGCAGTAAAGGGGAACCCACTGGCTGGGCAGAAGGGGGCAAAAGATTTGAAGTGGCCACCTCCGCCTATCCCCAATATGCTGGTCTGTTGGCCGCTCTCCAGTTGCACCAACGGCAGGGCACCGCCGAGGAACGTTACCAAGCCATTTGTCAACGCAGTGAACTGTTGTGGCAGGGTCTAAACCAATTACCCCATGTCCATTGTTTAGCCACATCGCCTCCCCAAGCAGGTTTGGTATCCTTCACCATAGATTCTCCCCTAGGCCACCGGGCGATCGTGCAGAAACTGGAGGAACAACGCATCTATCTCCGCACCATCGCTGACCCAGACTGTGTCCGGGCCTGTTGCCATTACATCACCAATGAAGAGGAAATTGAGCATTTATTAAGCAGACTAGCTGAATTTACCCCCTAA

Protein

MADPVNLIPDRQQFPGLANKTYFNFGGQGILPTVALEAITAMYGYLQENGPFSIAANQYIQQLIAQLRQALGETFNVDPNTITITDNVTTGCDIVLWGIDWQKGDEILLTDCEHPGIIAIVQAIAARFGVTYRFFPVADTLNQGDAAAVLVNHLGPKTRLVILSHLLWNTGQVLPLGEIMAVCRRHQGDYPVRVLVDGAQSAGSLPLDFSRLEVDYYAFTGHKWFAGPAGVGGLYIHGDAKGTANAARLGEINPTYVGWRSITYGSKGEPTGWAEGGKRFEVATSAYPQYAGLLAALQLHQRQGTAEERYQAICQRSELLWQGLNQLPHVHCLATSPPQAGLVSFTIDSPLGHRAIVQKLEEQRIYLRTIADPDCVRACCHYITNEEEIEHLLSRLAEFTP