Your browser is old and dusty. Try Google Chrome!

Details for slr2141

ORF slr2141
Accession NP_441043.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -221 -207 7.07942 0.109
NP_440557.1_1 Forward -221 -202 7.27595 0.148
NP_442761.1_5 Forward -94 -75 3.6377 0.268
NP_440795.1_7 Forward -221 -214 14.6904 0.0123
NP_440795.1_7 Reverse -214 -221 14.6904 0.0123
NP_441418.1_6 Forward -222 -203 -19.4701 0.0888
NP_440897.1_6 Reverse -213 -232 -0.39464 0.182
NP_441453.1_4 Reverse -213 -221 16.539 0.00633
NP_441453.1_4 Forward -222 -214 16.539 0.00633
NP_441453.1_4 Forward -252 -244 4.14932 0.264
NP_441453.1_7 Forward -9 -2 11.6422 0.298
NP_442151.1_1 Reverse -131 -150 10.4225 0.253
NP_442151.1_6 Reverse -213 -227 10.226 0.127
NP_442151.1_6 Forward -222 -208 5.01447 0.298
NP_440226.1_1 Forward -222 -203 12.3892 0.0451
NP_440226.1_1 Reverse -115 -134 7.07928 0.114
NP_442173.1_1 Forward -221 -213 15.4574 0.00633
NP_442173.1_1 Reverse -214 -222 15.4574 0.00633
NP_442752.1_4 Forward -222 -215 13.8055 0.0199
NP_442752.1_4 Reverse -213 -220 13.8055 0.0199
NP_442752.1_4 Forward -124 -117 4.26735 0.293
NP_443027.1_4 Forward -224 -214 5.87989 0.294
NP_443027.1_4 Reverse -211 -221 5.87989 0.294
NP_442975.1_10 Forward -226 -212 11.897 0.0482
NP_440784.1_7 Forward -221 -214 15.9687 0.0123
NP_440784.1_7 Reverse -214 -221 15.9687 0.0123
NP_440110.1_8 Reverse -149 -168 -0.295539 0.22
NP_441145.1_1 Reverse -242 -261 5.211 0.254
NP_441476.1_5 Forward -227 -208 -2.95047 0.231
NP_442062.1_8 Forward -222 -212 19.4496 0.000558
NP_442062.1_8 Reverse -213 -223 19.4496 0.000558
NP_442062.1_8 Forward -252 -242 11.9764 0.0377
NP_440304.1_4 Forward -254 -244 7.55152 0.109
NP_440304.1_4 Forward -224 -214 1.84832 0.299
NP_440304.1_4 Reverse -211 -221 1.84832 0.299
NP_442242.1_4 Forward -221 -214 14.3954 0.0124
NP_442242.1_4 Reverse -214 -221 14.3954 0.0124
NP_441581.1_6 Reverse -214 -233 9.09856 0.297
NP_441594.1_6 Reverse -148 -167 -0.39387 0.299
NP_440132.1_1 Forward -224 -206 7.98396 0.284
NP_442375.1_7 Reverse -361 -380 9.0459 0.191
NP_441082.1_10 Reverse -254 -267 9.45906 0.245
NP_441925.1_4 Forward -283 -264 -16.7175 0.285
NP_441083.1_5 Forward -222 -212 11.3864 0.0159
NP_441083.1_5 Reverse -213 -223 11.3864 0.0159
NP_441083.1_5 Forward -124 -114 5.48657 0.116
NP_441083.1_5 Reverse -157 -167 3.51995 0.169
NP_441149.1_7 Reverse -313 -332 2.75272 0.267
NP_441434.1_7 Reverse -245 -259 6.19444 0.225
NP_441434.1_7 Reverse -117 -131 2.75286 0.27
NP_441141.1_3 Reverse -27 -45 19.0954 0.098
NP_441738.1_2 Forward -220 -213 15.28 0.0102
NP_441738.1_2 Reverse -215 -222 15.28 0.0102
NP_441738.1_2 Reverse -377 -384 8.29857 0.176
NP_441558.1_5 Forward -254 -235 7.7676 0.17
NP_441558.1_5 Forward -224 -205 5.50599 0.247
NP_440209.1_1 Reverse -213 -221 18.1123 0.00295
NP_440209.1_1 Forward -222 -214 18.1123 0.00295
NP_440209.1_5 Forward -221 -203 9.55725 0.201
NP_442136.1_4 Forward -220 -201 8.35677 0.295
NP_442889.1_8 Forward -225 -211 12.5853 0.0611
NP_442889.1_8 Reverse -210 -224 3.53891 0.275
NP_441713.1_1 Forward -228 -209 -16.2252 0.278
NP_441713.1_1 Reverse -207 -226 -16.4218 0.283
NP_440178.1_7 Reverse -212 -231 -20.5517 0.194
NP_442706.1_5 Reverse -324 -343 12.4788 0.283
NP_442570.1_3 Reverse -256 -275 14.0608 0.0732
NP_442570.1_3 Reverse -257 -276 -5.40875 0.243
NP_442570.1_8 Reverse -250 -268 14.0805 0.15
NP_441025.1_10 Forward -121 -105 16.5781 0.101
NP_440906.1_5 Forward -221 -214 15.8704 0.0124
NP_440906.1_5 Reverse -214 -221 15.8704 0.0124
NP_440747.1_10 Reverse -210 -222 15.1819 0.00196
NP_440747.1_10 Forward -225 -213 5.44718 0.0137
NP_440747.1_10 Reverse -112 -124 -2.91095 0.0732
NP_440747.1_10 Reverse -256 -268 -12.2524 0.254
NP_441486.1_1 Forward -225 -211 21.6324 0.00233
NP_441486.1_1 Reverse -210 -224 12.8809 0.00979
NP_441486.1_1 Forward -255 -241 -5.50694 0.242
NP_441880.2_5 Forward -389 -370 11.9958 0.274
NP_441880.2_10 Reverse -214 -232 15.3588 0.111
NP_440470.1_5 Forward -344 -325 12.4613 0.165
NP_441014.1_10 Reverse -248 -267 2.26028 0.216
NP_441014.1_10 Reverse -114 -133 -0.0996487 0.246
NP_442848.1_5 Reverse -353 -371 -0.669169 0.276
NP_443018.1_3 Forward -221 -214 14.8871 0.0123
NP_443018.1_3 Reverse -214 -221 14.8871 0.0123
NP_443018.1_3 Forward -251 -244 10.7572 0.0907
NP_443018.1_3 Reverse -244 -251 4.56234 0.241
NP_441316.1_7 Forward -224 -209 3.81481 0.137
NP_441634.1_8 Reverse -146 -160 -1.18038 0.282
NP_441634.1_8 Reverse -211 -225 -4.32697 0.295
NP_441634.1_8 Reverse -113 -127 -4.7203 0.295
NP_440376.1_1 Forward -222 -213 19.4693 0.000692
NP_440376.1_1 Reverse -213 -222 19.4693 0.000692
NP_441588.1_4 Reverse -215 -225 16.4996 0.0369
NP_441588.1_4 Forward -220 -210 7.35486 0.178
NP_442687.1_7 Forward -223 -213 15.8113 0.0125
NP_442687.1_7 Reverse -212 -222 15.8113 0.0125
NP_442191.1_4 Reverse -260 -274 13.2231 0.158
NP_442485.1_3 Forward -123 -104 -4.13045 0.278
NP_441846.1_10 Reverse -259 -278 -15.2418 0.246
NP_440042.1_2 Forward -176 -157 1.86774 0.199
NP_441422.1_7 Forward -224 -207 -2.91109 0.225
NP_440533.1_9 Forward -222 -203 4.22769 0.234
NP_441763.1_10 Forward -233 -214 5.01354 0.295
NP_442658.1_1 Reverse -211 -221 15.9091 0.00966
NP_442658.1_1 Forward -224 -214 15.9091 0.00966
NP_442658.1_1 Reverse -241 -251 10.501 0.117
NP_441414.1_9 Reverse -213 -232 6.68596 0.0378
NP_441414.1_9 Forward -222 -203 4.916 0.0504
NP_441487.1_9 Reverse -212 -231 -1.96717 0.29
NP_442937.1_5 Forward -227 -208 10.5209 0.158
NP_441958.1_5 Forward -223 -213 12.2714 0.00183
NP_441958.1_5 Reverse -212 -222 12.2714 0.00183
NP_441127.1_1 Forward -160 -146 7.66941 0.3
NP_439905.1_1 Reverse -116 -129 12.8023 0.178
NP_440984.1_7 Reverse -208 -222 9.34103 0.127
NP_441097.1_2 Reverse -4 -21 5.34871 0.259
NP_439990.1_5 Forward -227 -214 10.049 0.128
NP_442376.1_2 Reverse -152 -171 1.96607 0.202
NP_442690.1_1 Forward -345 -326 -17.3068 0.299
NP_442911.1_2 Reverse -203 -222 13.3725 0.0118
NP_442911.1_2 Forward -232 -213 -1.96717 0.092
NP_442911.1_2 Reverse -233 -252 -10.1286 0.27
NP_441580.1_6 Forward -233 -214 -5.99873 0.235
NP_441580.1_6 Forward -135 -116 -6.98204 0.235
NP_441580.1_6 Forward -156 -137 -8.752 0.271
NP_440153.1_8 Reverse -151 -164 -2.83231 0.266
NP_443055.1_6 Reverse -205 -223 -1.75153 0.284
NP_441099.1_5 Forward -232 -213 -0.4922 0.0937
NP_441099.1_5 Reverse -203 -222 -10.227 0.247
NP_442002.1_1 Forward -133 -115 -6.07737 0.249
NP_442002.1_1 Reverse -3 -21 -7.06068 0.249
NP_442002.1_9 Forward -223 -216 10.7572 0.185
NP_442002.1_9 Reverse -212 -219 10.7572 0.185
NP_442002.1_9 Forward -125 -118 10.7572 0.185
NP_441294.1_7 Forward -226 -212 10.3065 0.197
NP_442438.1_10 Reverse -208 -222 5.40779 0.134
NP_442438.1_10 Forward -227 -213 0.294584 0.232
NP_441000.1_6 Reverse -212 -226 4.91614 0.0933
NP_441000.1_6 Forward -223 -209 -3.93365 0.225
NP_440147.1_4 Forward -224 -211 11.4257 0.0326
NP_440147.1_4 Reverse -211 -224 11.4257 0.0326
NP_441175.1_7 Forward -222 -203 11.4058 0.146
NP_441550.1_8 Reverse -211 -221 8.3377 0.124
NP_441550.1_8 Reverse -113 -123 8.3377 0.124
NP_441550.1_8 Forward -224 -214 8.3377 0.124
NP_441916.1_7 Forward -222 -212 18.4663 0.00144
NP_441916.1_7 Reverse -213 -223 18.4663 0.00144
NP_440465.1_10 Reverse -150 -169 2.45773 0.268
NP_441041.1_4 Reverse -213 -232 23.5006 0.00403
NP_441041.1_4 Forward -222 -203 12.3892 0.0234
NP_441041.1_4 Forward -208 -189 -13.3736 0.285
NP_441041.1_7 Forward -225 -213 18.9817 0.00435
NP_441041.1_7 Reverse -210 -222 15.6777 0.0222
NP_441041.1_7 Reverse -154 -166 7.90349 0.154
NP_442396.1_5 Reverse -209 -222 9.36073 0.13
NP_442004.1_6 Forward -222 -208 5.99778 0.181
NP_440703.1_9 Forward -268 -255 10.1468 0.208
NP_441725.1_5 Forward -251 -241 6.37155 0.115
NP_441725.1_5 Reverse -244 -254 2.24165 0.115
NP_441725.1_5 Forward -221 -211 2.04498 0.115
NP_441725.1_5 Reverse -214 -224 2.04498 0.115
NP_439966.1_7 Reverse -211 -221 9.91099 0.0968
NP_439966.1_7 Forward -224 -214 9.91099 0.0968
NP_439966.1_7 Forward -275 -265 8.04271 0.142
NP_439966.1_7 Reverse -155 -165 5.87944 0.204
NP_439966.1_9 Reverse -155 -164 9.83282 0.215
NP_439966.1_9 Forward -126 -117 0.983037 0.253
NP_439966.1_9 Forward -224 -215 0.884706 0.253
NP_439966.1_9 Reverse -211 -220 0.884706 0.253
NP_442941.1_3 Forward -221 -211 2.63497 0.14
NP_442941.1_3 Reverse -214 -224 2.63497 0.14
NP_440289.1_2 Forward -225 -212 5.91914 0.0605
NP_440289.1_2 Forward -255 -242 -3.22564 0.267
NP_440289.1_2 Reverse -210 -223 -3.61896 0.267
NP_440260.1_8 Reverse -106 -124 -1.25915 0.232
NP_440260.1_8 Reverse -250 -268 -1.45582 0.233
NP_442281.1_1 Reverse -208 -222 18.5835 0.00414
NP_442281.1_1 Forward -227 -213 12.2903 0.0385
NP_440437.1_1 Reverse -109 -128 -5.21209 0.276
NP_440437.1_1 Reverse -124 -143 -5.70374 0.292
NP_440647.1_9 Forward -224 -206 6.31233 0.219
NP_442012.1_1 Reverse -207 -226 8.55425 0.099
NP_441556.1_10 Reverse -208 -222 13.6286 0.178
NP_440498.1_1 Reverse -204 -222 15.6538 0.0241
NP_440375.1_8 Reverse -214 -233 10.9142 0.138
NP_441644.1_6 Forward -222 -212 10.1076 0.0628
NP_441644.1_6 Reverse -213 -223 10.1076 0.0628
NP_441644.1_6 Forward -252 -242 7.55106 0.123
NP_442215.1_2 Reverse -211 -227 9.89163 0.052
NP_442215.1_2 Forward -224 -208 5.56507 0.0785
NP_440253.1_2 Reverse -213 -231 4.73903 0.1
NP_440929.1_8 Forward -222 -213 19.2726 0.000701
NP_440929.1_8 Reverse -213 -222 19.2726 0.000701
NP_440929.1_8 Reverse -115 -124 4.81794 0.176
NP_442933.1_1 Forward -66 -47 7.30471 0.253
NP_442933.1_10 Forward -222 -213 17.601 0.00325
NP_442933.1_10 Reverse -213 -222 17.601 0.00325
NP_440382.1_2 Forward -60 -41 6.39016 0.259
NP_441751.2_8 Forward -221 -207 -3.147 0.134
NP_441751.2_8 Reverse -244 -258 -6.58858 0.273
NP_442554.1_8 Forward -221 -211 13.2547 0.0187
NP_442554.1_8 Reverse -214 -224 13.2547 0.0187
NP_442554.1_8 Reverse -244 -254 4.60159 0.18
NP_442167.1_3 Reverse -380 -398 14.2763 0.297
NP_441762.1_7 Forward -223 -211 19.3118 0.00342
NP_441762.1_7 Reverse -212 -224 19.3118 0.00342
NP_441762.1_7 Forward -167 -155 -3.99259 0.148
NP_442142.1_4 Reverse -210 -223 16.4399 0.0264
NP_442142.1_4 Forward -225 -212 15.1616 0.0289
NP_442292.1_1 Forward -221 -212 9.63616 0.0183
NP_442292.1_1 Reverse -214 -223 9.63616 0.0183
NP_442476.1_6 Forward -221 -207 3.8345 0.154
NP_442476.1_6 Reverse -116 -130 1.08123 0.231
NP_442016.1_10 Forward -214 -195 4.52268 0.288
NP_442381.1_8 Forward -225 -206 -5.21209 0.141
NP_442381.1_8 Reverse -154 -173 -13.6686 0.279
NP_443009.1_5 Reverse -212 -223 11.6612 0.0602
NP_443009.1_5 Forward -223 -212 11.6612 0.0602
NP_443009.1_5 Forward -253 -242 10.9729 0.0699
NP_441715.1_4 Reverse -214 -224 9.41981 0.097
NP_441715.1_4 Forward -221 -211 9.41981 0.097
NP_440357.1_3 Forward -224 -205 1.27776 0.275
NP_440881.1_4 Forward -331 -312 -0.4922 0.261
NP_440379.1_5 Reverse -255 -274 -8.06369 0.25
NP_441468.1_1 Forward -221 -214 15.8704 0.0124
NP_441468.1_1 Reverse -214 -221 15.8704 0.0124
NP_441468.1_1 Reverse -244 -251 4.07068 0.263
NP_441020.2_6 Forward -224 -207 21.2783 0.00316
NP_441015.1_8 Forward -259 -240 0.196116 0.28
NP_441015.1_10 Forward -207 -188 -10.227 0.283
NP_441015.1_10 Forward -129 -110 -11.3086 0.294
NP_441673.1_1 Forward -222 -213 20.8459 0.000698
NP_441673.1_1 Reverse -213 -222 20.8459 0.000698
NP_441956.1_9 Reverse -150 -169 7.37428 0.274
NP_441826.1_2 Forward -258 -244 8.06273 0.0806
NP_441826.1_2 Forward -228 -214 -4.52363 0.296
NP_441330.1_1 Forward -90 -71 -6.98204 0.178
NP_442490.1_9 Reverse -145 -164 -5.70374 0.273
NP_441764.1_1 Reverse -48 -67 8.65258 0.248
NP_442868.1_6 Forward -224 -214 0.865012 0.205
NP_442868.1_6 Reverse -211 -221 0.865012 0.205
NP_442227.1_2 Reverse -150 -169 -3.3438 0.29
NP_442427.1_8 Reverse -26 -45 7.37428 0.215
NP_442808.1_1 Forward -223 -213 18.4657 0.00201
NP_442808.1_1 Reverse -212 -222 18.4657 0.00201
NP_440031.1_10 Reverse -1 -20 -0.295539 0.282
NP_442692.1_1 Forward -176 -157 -5.9004 0.276
NP_440145.1_3 Forward -232 -213 6.4893 0.0511
NP_442542.1_10 Reverse -116 -130 18.6825 0.219
NP_442050.1_2 Forward -22 -3 11.7983 0.172
NP_442342.1_9 Reverse -211 -227 2.22182 0.29
NP_441114.1_3 Forward -250 -241 7.96454 0.231
NP_440558.1_2 Reverse -240 -259 -2.16383 0.223
NP_442789.1_4 Reverse -134 -153 -3.54046 0.25
NP_441878.1_6 Forward -223 -213 10.4031 0.0176
NP_441878.1_6 Reverse -212 -222 10.4031 0.0176
NP_441878.1_6 Reverse -242 -252 2.24165 0.0462
NP_441878.1_6 Forward -253 -243 1.25834 0.108
NP_441036.1_8 Forward -223 -213 17.7779 0.000554
NP_441036.1_8 Reverse -212 -222 17.7779 0.000554
NP_441557.1_5 Forward -222 -213 19.9609 0.000699
NP_441557.1_5 Reverse -213 -222 19.9609 0.000699
NP_441445.1_1 Reverse -204 -223 3.73603 0.208
NP_441445.1_1 Forward -261 -242 3.44104 0.213
NP_441445.1_1 Reverse -289 -308 0.196116 0.281
NP_441445.1_8 Reverse -261 -280 -10.6203 0.277
NP_441590.1_4 Reverse -188 -207 2.9486 0.29
NP_440084.1_8 Reverse -44 -58 9.17885 0.29
NP_440738.1_5 Reverse -364 -383 2.26107 0.289
NP_441739.1_2 Forward -51 -35 2.22115 0.288
NP_440101.1_3 Reverse -208 -227 10.4225 0.121
NP_440101.1_3 Forward -129 -110 6.39097 0.181
NP_441458.1_8 Reverse -41 -60 11.807 0.229
NP_442183.1_1 Forward -222 -208 9.5377 0.0966
NP_442494.1_7 Reverse -255 -274 -1.67217 0.264
NP_442347.1_2 Reverse -116 -125 11.2095 0.056
NP_442347.1_2 Forward -221 -212 11.1111 0.056
NP_442347.1_2 Reverse -214 -223 11.1111 0.056
NP_442645.1_2 Forward -230 -211 -2.85214 0.0487
NP_442645.1_2 Reverse -205 -224 -3.44213 0.0487
NP_442645.1_2 Forward -260 -241 -17.8968 0.266
NP_441037.1_4 Reverse -211 -221 14.7245 0.028
NP_441037.1_4 Forward -224 -214 14.7245 0.028
NP_441633.1_3 Forward -224 -211 10.8357 0.0286
NP_441633.1_3 Reverse -211 -224 10.8357 0.0286
NP_441633.1_3 Reverse -113 -126 10.2457 0.0309
NP_441633.1_3 Reverse -241 -254 -5.48725 0.236
NP_440136.1_2 Forward -221 -214 15.9687 0.0123
NP_440136.1_2 Reverse -214 -221 15.9687 0.0123
NP_442590.1_9 Reverse -242 -261 8.75091 0.23
NP_442998.1_10 Forward -220 -213 15.5754 0.0102
NP_442998.1_10 Reverse -215 -222 15.5754 0.0102
NP_442998.1_10 Reverse -117 -124 5.93897 0.206
NP_440299.1_1 Forward -226 -213 11.9167 0.0427
NP_440299.1_1 Reverse -209 -222 10.4418 0.0573
NP_441799.1_1 Reverse -209 -223 18.9768 0.00745
NP_441799.1_1 Forward -226 -212 8.25877 0.12
NP_440977.1_5 Reverse -326 -339 15.9483 0.222
NP_441007.1_10 Reverse -208 -221 3.85419 0.182
NP_440256.1_1 Forward -88 -69 1.37609 0.0761
NP_440256.1_1 Reverse -246 -265 -1.27885 0.102
NP_440256.1_1 Reverse -210 -229 -8.35868 0.259
NP_440256.1_1 Reverse -256 -275 -10.3253 0.299
NP_441559.1_8 Forward -227 -213 3.14618 0.143
NP_441559.1_8 Reverse -208 -222 -7.08024 0.283
NP_440915.1_6 Reverse -153 -167 9.2427 0.0445
NP_440915.1_6 Forward -226 -212 6.29277 0.0828
NP_441464.1_1 Forward -272 -253 9.3409 0.24
NP_441464.1_8 Forward -252 -238 7.57108 0.206
NP_441464.1_10 Reverse -262 -276 13.6676 0.199
NP_440702.1_5 Reverse -259 -278 11.7008 0.0964
NP_440695.1_5 Forward -222 -203 -1.18052 0.284
NP_441939.1_3 Forward -221 -202 6.68596 0.227
NP_441199.1_6 Forward -170 -151 -0.39387 0.268
NP_442993.1_1 Reverse -213 -229 -7.70961 0.146
NP_442993.1_1 Forward -222 -206 -10.9545 0.231
NP_442386.1_9 Reverse -212 -221 15.7322 0.0144
NP_442386.1_9 Forward -223 -214 15.7322 0.0144
NP_442386.1_9 Reverse -359 -368 9.34074 0.166
NP_442386.1_9 Reverse -187 -196 8.94741 0.178
NP_442386.1_9 Reverse -156 -165 5.21086 0.262
NP_442386.1_10 Reverse -264 -277 4.8375 0.262
NP_441340.1_5 Forward -221 -214 15.6737 0.0124
NP_441340.1_5 Reverse -214 -221 15.6737 0.0124
NP_441340.1_5 Forward -251 -244 3.97235 0.274
NP_441340.1_9 Forward -318 -308 7.38756 0.27
NP_442240.1_1 Reverse -107 -126 2.9486 0.295
NP_440586.1_8 Forward -221 -214 13.2151 0.026
NP_440586.1_8 Reverse -214 -221 13.2151 0.026
NP_442251.1_6 Forward -221 -214 15.2804 0.0124
NP_442251.1_6 Reverse -214 -221 15.2804 0.0124
NP_440192.1_4 Reverse -321 -340 13.8605 0.169
NP_440684.1_9 Reverse -207 -221 7.07942 0.28
NP_441262.1_3 Reverse -213 -220 14.7888 0.0223
NP_441262.1_3 Forward -222 -215 14.7888 0.0223
NP_440027.1_3 Forward -167 -149 3.06666 0.28
NP_443051.1_1 Reverse -212 -221 10.4228 0.00754
NP_443051.1_1 Forward -223 -214 10.4228 0.00754
NP_440451.1_10 Reverse -244 -263 8.75009 0.264
NP_439937.1_9 Reverse -212 -229 -0.846829 0.122
NP_440408.1_7 Forward -264 -245 10.6192 0.247
NP_440439.1_1 Reverse -210 -223 8.57408 0.0518
NP_440439.1_1 Forward -225 -212 1.39592 0.156
NP_442239.1_8 Reverse -266 -285 7.47261 0.257
NP_440372.1_2 Forward -221 -214 16.3621 0.0124
NP_440372.1_2 Reverse -214 -221 16.3621 0.0124
NP_440372.1_2 Forward -123 -116 4.07068 0.262
NP_440316.1_10 Reverse -265 -275 7.84651 0.245
NP_442488.1_7 Reverse -321 -340 10.1275 0.254
NP_441803.1_2 Reverse -208 -227 26.4505 0.000751
NP_439977.1_5 Reverse -207 -226 -0.688862 0.233
NP_441572.1_7 Forward -228 -209 -3.73712 0.219
NP_440267.1_2 Forward -90 -76 4.71887 0.296
NP_442384.1_10 Forward -222 -209 13.884 0.018
NP_442384.1_10 Reverse -213 -226 8.37742 0.0656
NP_441980.1_8 Forward -133 -114 8.06259 0.258
NP_441877.1_7 Forward -227 -208 3.83357 0.218
NP_441877.1_9 Forward -348 -331 3.97208 0.284
NP_441877.1_9 Reverse -46 -63 1.61214 0.297
NP_441018.1_7 Forward -128 -109 6.68596 0.283
NP_441018.1_7 Reverse -255 -274 6.09597 0.299
NP_442262.1_10 Forward -221 -214 14.1988 0.0123
NP_442262.1_10 Reverse -214 -221 14.1988 0.0123
NP_442262.1_10 Forward -251 -244 9.87221 0.164
NP_440344.1_10 Forward -229 -212 18.7217 0.00244
NP_440344.1_10 Reverse -206 -223 -2.12444 0.0609
NP_440531.1_6 Reverse -251 -270 2.94938 0.148
NP_440531.1_6 Forward -260 -241 -1.86883 0.241
NP_442917.1_1 Forward -348 -329 5.89851 0.29
NP_441060.1_3 Forward -271 -252 8.94757 0.228
NP_441965.1_10 Forward -225 -209 12.4482 0.105
NP_440297.1_9 Reverse -244 -254 10.3048 0.0917
NP_440297.1_9 Forward -251 -241 7.64985 0.108
NP_440297.1_9 Forward -221 -211 -0.118297 0.282
NP_440297.1_9 Reverse -214 -224 -0.118297 0.282
NP_442280.1_10 Reverse -250 -268 9.25304 0.233
NP_441592.1_4 Reverse -188 -207 -2.75381 0.269
NP_441896.1_3 Forward -231 -212 -1.67217 0.267
NP_440894.1_10 Forward -227 -208 8.25926 0.179
NP_440999.1_2 Forward -135 -116 8.55425 0.288
NP_440999.1_9 Forward -226 -212 5.01447 0.114
NP_440999.1_9 Reverse -209 -223 0.982901 0.172
NP_440888.1_2 Reverse -213 -227 10.422 0.0946
NP_440803.1_3 Reverse -272 -291 9.73422 0.174
NP_442147.1_6 Forward -17 -3 16.2235 0.205
NP_440052.1_5 Forward -233 -214 -1.37718 0.195
NP_442077.1_9 Forward -248 -229 -1.86883 0.22
NP_441543.1_2 Forward -221 -212 18.486 0.00236
NP_441543.1_2 Reverse -214 -223 18.486 0.00236
NP_441543.1_2 Reverse -137 -146 7.37455 0.127
NP_442845.1_2 Reverse -151 -165 4.81781 0.251
NP_441304.1_10 Forward -255 -246 13.1761 0.255
NP_441319.1_5 Reverse -214 -233 8.35759 0.282
NP_441319.1_6 Reverse -199 -218 16.4207 0.197
NP_440982.1_1 Forward -274 -255 10.1267 0.212
NP_442710.1_7 Reverse -43 -62 -3.57057 0.263
NP_442710.1_7 Reverse -323 -342 -5.68499 0.294
NP_442710.1_7 Reverse -224 -243 -8.18384 0.299
NP_442710.1_7 Forward -344 -325 -8.47217 0.299
NP_441469.1_8 Reverse -212 -221 16.126 0.00797
NP_441469.1_8 Forward -223 -214 16.126 0.00797
NP_441469.1_8 Reverse -242 -251 10.0295 0.227
NP_441469.1_8 Reverse -156 -165 5.50626 0.265
NP_442315.1_2 Reverse -283 -295 9.28209 0.291
NP_442578.1_7 Forward -221 -214 14.5921 0.026
NP_442578.1_7 Reverse -214 -221 14.5921 0.026
NP_440710.1_1 Forward -260 -242 -2.14413 0.189
NP_440710.1_1 Forward -276 -258 -7.35568 0.237
NP_441462.1_2 Forward -222 -212 11.5831 0.00406
NP_441462.1_2 Reverse -213 -223 11.5831 0.00406
NP_441621.1_7 Forward -224 -210 6.09611 0.068
NP_441621.1_7 Reverse -211 -225 -3.73699 0.193
NP_441621.1_7 Forward -168 -154 -3.73699 0.193
NP_443062.1_1 Reverse -213 -231 18.6867 0.022
NP_443062.1_1 Forward -222 -204 13.0313 0.0687
NP_443062.1_1 Reverse -115 -133 5.03566 0.242
NP_443062.1_6 Forward -230 -211 0.786102 0.288
NP_443062.1_6 Reverse -205 -224 0.491109 0.294
NP_440516.1_2 Forward -228 -210 11.8189 0.0708
NP_440516.1_2 Reverse -207 -225 -1.16082 0.276
NP_440516.1_8 Forward -222 -213 16.9127 0.00442
NP_440516.1_8 Reverse -213 -222 16.9127 0.00442
NP_440516.1_8 Forward -124 -115 -0.196935 0.185
NP_440516.1_8 Reverse -157 -166 -0.68859 0.297
NP_442428.1_5 Forward -221 -214 15.8704 0.0124
NP_442428.1_5 Reverse -214 -221 15.8704 0.0124
NP_442428.1_5 Reverse -244 -251 4.46401 0.267
NP_442859.1_2 Reverse -244 -263 10.2259 0.185
NP_440673.1_3 Forward -220 -213 12.4288 0.0426
NP_440673.1_3 Reverse -215 -222 12.4288 0.0426
NP_440673.1_3 Forward -83 -76 10.5605 0.123
NP_440673.1_3 Reverse -117 -124 10.1672 0.149
NP_441714.1_3 Reverse -206 -224 14.3747 0.188
NP_441052.1_2 Forward -222 -212 10.5014 0.0285
NP_441052.1_2 Reverse -213 -223 10.5014 0.0285
NP_441052.1_2 Reverse -136 -146 1.06167 0.252
NP_442219.1_9 Forward -221 -212 8.35786 0.0681
NP_442219.1_9 Reverse -214 -223 8.35786 0.0681
NP_440592.1_2 Reverse -75 -94 -0.688862 0.271
NP_440436.1_4 Forward -221 -212 18.1905 0.00233
NP_440436.1_4 Reverse -214 -223 18.1905 0.00233
NP_440436.1_4 Reverse -250 -259 5.11253 0.222
NP_441884.1_9 Forward -225 -206 -23.895 0.284
NP_440314.1_9 Reverse -214 -233 -2.85214 0.168
NP_440648.1_1 Forward -222 -203 5.50599 0.214
NP_441719.1_4 Forward -221 -214 16.3621 0.0124
NP_441719.1_4 Reverse -214 -221 16.3621 0.0124
NP_441733.1_10 Reverse -154 -167 13.589 0.0916
NP_441733.1_10 Forward -225 -212 10.1474 0.106
NP_441733.1_10 Reverse -210 -223 7.6891 0.152
NP_442366.1_3 Reverse -212 -230 8.67227 0.0635
NP_442366.1_3 Forward -223 -205 5.82068 0.0829
NP_442366.1_5 Forward -225 -215 12.7626 0.108
NP_442366.1_5 Reverse -210 -220 11.9759 0.148
NP_442873.1_3 Reverse -203 -222 8.35677 0.201
NP_442873.1_5 Forward -275 -256 9.83173 0.248
NP_440296.1_10 Reverse -256 -275 -14.4552 0.269
NP_442694.1_9 Forward -340 -321 8.65258 0.277
NP_442206.1_10 Forward -222 -207 4.79811 0.178
NP_442206.1_10 Forward -124 -109 0.471552 0.259
NP_440328.1_4 Forward -228 -209 -0.885524 0.292
NP_442312.1_1 Reverse -112 -131 10.5209 0.275
NP_443054.1_2 Reverse -211 -225 11.5043 0.0761
NP_443054.1_2 Forward -224 -210 2.06454 0.245
NP_442430.1_10 Reverse -203 -222 19.5664 0.042
NP_442308.1_4 Reverse -207 -226 0.392778 0.276
NP_441851.1_10 Forward -223 -213 16.008 0.00552
NP_441851.1_10 Reverse -212 -222 16.008 0.00552
NP_441851.1_10 Forward -253 -243 5.78156 0.2
NP_441851.1_10 Reverse -242 -252 4.69992 0.254
NP_441501.1_4 Reverse -270 -289 16.2241 0.202
NP_441668.1_4 Reverse -233 -252 1.76941 0.211
NP_442515.1_1 Forward -161 -147 -2.85201 0.281
NP_440593.1_3 Forward -227 -208 -2.55715 0.227
NP_441046.1_2 Reverse -231 -250 -1.7705 0.292
NP_441349.1_10 Forward -201 -182 -6.68705 0.235
NP_442314.1_2 Reverse -287 -306 2.75272 0.248
NP_442843.1_1 Reverse -244 -263 -11.7019 0.291
NP_439960.1_10 Reverse -108 -126 12.3105 0.0769
NP_439960.1_10 Forward -275 -257 0.510803 0.212
NP_440431.1_3 Reverse -322 -341 -7.17871 0.202
NP_442450.1_5 Reverse -211 -221 7.55152 0.13
NP_442450.1_5 Forward -224 -214 7.55152 0.13
NP_442450.1_5 Forward -254 -244 6.37155 0.181
NP_442168.1_5 Reverse -183 -202 -2.45882 0.264
NP_440588.1_2 Reverse -204 -223 -0.39387 0.15
NP_440588.1_2 Forward -175 -156 -3.14714 0.179
NP_440588.1_2 Forward -231 -212 -4.13045 0.207
NP_442006.1_3 Reverse -151 -169 -6.1757 0.298
NP_443047.1_7 Reverse -244 -263 12.4875 0.122
NP_440483.1_1 Forward -215 -196 -6.88371 0.252
NP_440483.1_1 Reverse -259 -278 -8.35868 0.282
NP_441570.1_1 Reverse -243 -261 -9.51896 0.139
NP_441570.1_1 Forward -222 -204 -17.3854 0.273
NP_441570.1_1 Reverse -151 -169 -17.4838 0.278
NP_440078.1_10 Forward -222 -203 3.04771 0.269
NP_441078.1_4 Forward -222 -213 19.6659 0.0007
NP_441078.1_4 Reverse -213 -222 19.6659 0.0007
NP_441078.1_4 Reverse -243 -252 -1.6719 0.266
NP_442729.1_8 Forward -128 -115 6.1158 0.212
NP_440526.1_3 Reverse -214 -225 2.02482 0.267
NP_441432.1_8 Reverse -212 -221 8.25953 0.0755
NP_441432.1_8 Forward -223 -214 8.25953 0.0755
NP_442320.1_8 Forward -228 -214 7.76774 0.0186
NP_442344.1_7 Forward -221 -202 9.83255 0.0406
NP_442344.1_7 Reverse -214 -233 -3.83545 0.168
NP_441732.1_2 Forward -226 -210 -16.1661 0.165
NP_441732.1_2 Reverse -97 -113 -16.8544 0.207
NP_441732.1_2 Reverse -209 -225 -17.346 0.253
NP_440313.1_5 Reverse -314 -332 10.6381 0.294
NP_442003.1_4 Reverse -214 -233 10.5209 0.288
NP_440760.1_1 Forward -222 -203 -0.4922 0.0279
NP_440760.1_1 Reverse -213 -232 -10.522 0.084
NP_440760.1_1 Reverse -115 -134 -14.3569 0.129
NP_442797.1_7 Forward -167 -149 14.5721 0.11
NP_442298.1_3 Reverse -327 -346 16.0348 0.155
NP_442353.1_4 Forward -228 -209 6.58682 0.175
NP_442510.1_9 Reverse -153 -167 18.2892 0.158
NP_439935.1_1 Reverse -336 -355 13.4708 0.206
NP_442968.1_8 Reverse -255 -274 16.6174 0.116
NP_442751.1_2 Reverse -154 -173 4.32522 0.261
NP_442489.1_7 Forward -222 -213 20.1576 0.000695
NP_442489.1_7 Reverse -213 -222 20.1576 0.000695
NP_442489.1_7 Reverse -243 -252 -1.6719 0.235
NP_442489.1_7 Forward -252 -243 -1.96689 0.28
NP_440757.1_6 Reverse -130 -149 10.1275 0.28
NP_440559.1_1 Reverse -214 -223 8.75118 0.0586
NP_440559.1_1 Forward -221 -212 8.75118 0.0586
NP_440559.1_1 Reverse -244 -253 4.32629 0.288
NP_441659.2_8 Forward -222 -212 11.9764 0.0147
NP_441659.2_8 Reverse -213 -223 11.9764 0.0147
NP_441659.2_8 Forward -252 -242 4.10993 0.144
NP_442913.1_9 Reverse -207 -226 8.84924 0.24
NP_442913.1_10 Forward -231 -212 -6.29373 0.3
NP_441040.1_2 Forward -168 -149 -15.0452 0.286
NP_439956.1_7 Reverse -70 -89 5.99764 0.257
NP_442346.1_5 Forward -223 -213 9.02648 0.118
NP_442346.1_5 Reverse -212 -222 9.02648 0.118
NP_442346.1_5 Forward -253 -243 6.37155 0.205
NP_442346.1_5 Reverse -242 -252 4.99491 0.267
NP_440545.1_3 Forward -226 -209 -3.99273 0.215
NP_441856.1_3 Forward -225 -206 -1.7705 0.241
NP_440831.1_1 Reverse -214 -233 8.75091 0.298
NP_441629.1_3 Forward -275 -256 -1.37794 0.263
NP_441629.1_7 Reverse -123 -142 11.7008 0.172
NP_440459.1_2 Forward -231 -214 13.3135 0.131
NP_442603.1_7 Forward -124 -110 10.1271 0.133
NP_441888.1_7 Forward -227 -213 2.45787 0.225
NP_441888.1_7 Reverse -318 -332 0.786239 0.281
NP_441833.1_4 Forward -221 -214 15.9687 0.0124
NP_441833.1_4 Reverse -214 -221 15.9687 0.0124
NP_441329.1_1 Forward -67 -48 7.59119 0.236
NP_441329.1_6 Reverse -28 -47 2.05265 0.231
NP_442162.1_9 Forward -221 -214 16.2637 0.0124
NP_442162.1_9 Reverse -214 -221 16.2637 0.0124
NP_440671.1_4 Forward -228 -214 7.66941 0.21
NP_440671.1_4 Forward -258 -244 5.50613 0.281
NP_442199.1_5 Reverse -205 -224 1.17943 0.165
NP_442140.1_3 Forward -221 -211 16.2046 0.0255
NP_442140.1_3 Reverse -214 -224 16.2046 0.0255
NP_442140.1_3 Forward -165 -155 7.45319 0.14
NP_442140.1_3 Reverse -116 -126 5.5849 0.202
NP_442723.1_1 Forward -284 -265 5.11187 0.276
NP_440875.1_9 Forward -220 -210 9.15072 0.233
NP_440875.1_9 Reverse -215 -225 8.46937 0.233
NP_441813.1_5 Reverse -211 -221 9.91146 0.021
NP_441813.1_5 Forward -224 -214 9.91146 0.021
NP_441813.1_5 Reverse -113 -123 4.40493 0.159
NP_442028.1_1 Reverse -47 -60 7.60564 0.292
NP_440590.1_4 Reverse -214 -227 21.8488 0.00377
NP_440590.1_4 Forward -221 -208 1.88757 0.108
NP_440567.1_1 Forward -221 -207 15.1426 0.0179
NP_440567.1_1 Reverse -214 -228 7.66941 0.067
NP_440567.1_1 Forward -165 -151 -0.393733 0.281
NP_442497.1_10 Forward -221 -212 10.4228 0.0087
NP_442497.1_10 Reverse -214 -223 10.4228 0.0087
NP_442497.1_10 Reverse -244 -253 0.393051 0.175
NP_440821.1_4 Reverse -211 -221 10.2065 0.0163
NP_440821.1_4 Forward -224 -214 10.2065 0.0163
NP_440821.1_4 Forward -254 -244 0.176696 0.198
NP_440821.1_4 Forward -126 -116 -0.708283 0.287
NP_441239.1_9 Reverse -211 -223 14.887 0.0247
NP_441239.1_9 Forward -224 -212 14.887 0.0247
NP_441239.1_9 Reverse -241 -253 11.937 0.0529
NP_441892.1_1 Forward -261 -244 5.64371 0.0999
NP_442044.1_1 Forward -202 -183 -7.4737 0.224
NP_442216.1_4 Reverse -376 -384 8.1805 0.255
NP_440546.1_4 Forward -222 -212 11.8882 0.0679
NP_440546.1_4 Reverse -213 -223 11.8882 0.0679
NP_440546.1_4 Reverse -259 -269 6.65249 0.288
NP_440546.1_6 Reverse -117 -136 9.43923 0.247
NP_441230.1_5 Forward -227 -208 2.16274 0.223
NP_440462.1_4 Reverse -257 -271 4.91614 0.291
NP_440462.1_6 Forward -224 -214 9.02648 0.0498
NP_440462.1_6 Reverse -211 -221 9.02648 0.0498
NP_440868.1_4 Reverse -209 -221 17.7386 0.0124
NP_440868.1_4 Forward -226 -214 1.7106 0.174
NP_440868.1_4 Forward -128 -116 -0.354346 0.263
NP_440868.1_4 Reverse -153 -165 -1.14099 0.296
NP_441249.1_8 Reverse -259 -278 8.16093 0.19
NP_442402.1_1 Reverse -302 -321 14.6508 0.178
NP_442402.1_4 Reverse -302 -321 -1.08295 0.189
NP_441848.1_7 Reverse -304 -323 -3.34455 0.282
NP_440696.1_3 Reverse -249 -267 1.39578 0.217
NP_442039.1_4 Forward -221 -214 15.1821 0.0124
NP_442039.1_4 Reverse -214 -221 15.1821 0.0124
NP_442039.1_4 Reverse -158 -165 8.10225 0.221
NP_440825.1_7 Reverse -214 -224 12.4217 0.155
NP_440825.1_7 Forward -221 -211 12.4217 0.155
NP_441053.1_10 Forward -363 -353 17.2863 0.293
NP_442837.1_3 Forward -221 -214 15.7721 0.0124
NP_442837.1_3 Reverse -214 -221 15.7721 0.0124
NP_442053.1_1 Forward -222 -213 18.3876 0.0007
NP_442053.1_1 Reverse -213 -222 18.3876 0.0007
NP_442053.1_1 Forward -166 -157 10.3245 0.0537
NP_440505.1_3 Forward -224 -214 6.76487 0.169
NP_440505.1_3 Reverse -211 -221 6.76487 0.169
NP_441102.1_2 Reverse -35 -54 5.211 0.298
NP_441252.1_6 Reverse -240 -247 14.1004 0.25
NP_442532.1_1 Forward -60 -46 14.0007 0.215
NP_442532.1_7 Reverse -115 -129 2.16287 0.252
NP_440914.1_1 Forward -124 -114 9.29824 0.186
NP_440914.1_1 Forward -222 -212 8.6151 0.186
NP_440914.1_1 Reverse -213 -223 8.6151 0.186
NP_441011.1_8 Forward -221 -212 16.9127 0.00602
NP_441011.1_8 Reverse -214 -223 16.9127 0.00602
NP_441011.1_8 Reverse -158 -167 5.70292 0.237
NP_442533.1_6 Forward -222 -213 17.2076 0.00137
NP_442533.1_6 Reverse -213 -222 17.2076 0.00137
NP_442533.1_6 Forward -268 -259 2.75299 0.241
NP_442322.1_4 Forward -276 -259 0.0381458 0.21
NP_440854.1_7 Forward -33 -19 14.6205 0.246
NP_442229.1_1 Reverse -211 -225 20.3534 0.0686
NP_442229.1_1 Forward -224 -210 19.3701 0.0734
NP_441482.1_7 Reverse -207 -221 -8.94853 0.193
NP_441482.1_7 Forward -258 -244 -9.73518 0.209
NP_439944.1_9 Reverse -244 -254 5.38824 0.254
NP_440116.1_8 Reverse -214 -233 0.392778 0.0979
NP_440007.1_9 Reverse -31 -45 2.35953 0.281
NP_441680.1_4 Reverse -355 -374 -2.26216 0.267
NP_441602.1_3 Forward -129 -110 -0.590531 0.224
NP_441972.1_5 Reverse -244 -263 -1.96717 0.178
NP_441106.1_1 Reverse -212 -221 18.191 0.0028
NP_441106.1_1 Forward -223 -214 18.191 0.0028
NP_439903.1_6 Reverse -204 -223 -1.27961 0.295
NP_440797.1_2 Forward -233 -214 12.1802 0.282
NP_441286.1_1 Forward -223 -211 -3.50094 0.145
NP_441286.1_1 Reverse -212 -224 -3.50094 0.145
NP_441286.1_1 Reverse -114 -126 -6.15587 0.251
NP_441286.1_1 Reverse -242 -254 -6.2542 0.254
NP_440670.1_8 Forward -222 -213 18.3876 0.000699
NP_440670.1_8 Reverse -213 -222 18.3876 0.000699
NP_440670.1_8 Forward -124 -115 6.48957 0.118
NP_440670.1_8 Forward -252 -243 3.24465 0.29
NP_441930.1_3 Forward -344 -325 6.9054 0.263
NP_440886.1_7 Forward -223 -213 17.7774 0.0011
NP_440886.1_7 Reverse -212 -222 17.7774 0.0011
NP_440886.1_7 Reverse -156 -166 4.20782 0.249
NP_442614.1_2 Reverse -151 -165 10.521 0.234
NP_442614.1_2 Forward -222 -208 8.35772 0.255
NP_442614.1_2 Forward -124 -110 7.07942 0.275
NP_442072.1_9 Reverse -212 -230 -13.6489 0.118
NP_442072.1_9 Forward -223 -205 -21.8103 0.212
NP_442401.1_2 Forward -152 -133 9.63507 0.201
NP_442213.1_5 Reverse -259 -278 2.16274 0.239
NP_440907.2_8 Forward -221 -211 14.2375 0.0312
NP_440907.2_8 Reverse -214 -224 14.2375 0.0312
NP_440907.2_8 Reverse -116 -126 6.0761 0.179
NP_442264.1_2 Reverse -147 -164 10.5603 0.188
NP_441021.1_8 Forward -227 -209 1.69077 0.259
NP_441463.1_3 Reverse -138 -157 -6.98204 0.253
NP_441463.1_3 Reverse -203 -222 -8.35868 0.268
NP_441626.1_2 Forward -221 -214 15.7721 0.0124
NP_441626.1_2 Reverse -214 -221 15.7721 0.0124
NP_442365.1_5 Reverse -149 -168 7.27595 0.257
NP_442794.1_1 Reverse -111 -123 14.4936 0.0654
NP_442794.1_1 Forward -226 -214 2.89058 0.286
NP_442794.1_1 Reverse -209 -221 2.59558 0.287
NP_442615.1_1 Reverse -204 -222 9.55725 0.0249
NP_441962.1_4 Forward -165 -146 -10.7186 0.232
NP_440387.1_1 Forward -222 -206 20.0197 0.00318
NP_440387.1_1 Reverse -213 -229 -1.12144 0.142
NP_440855.1_5 Forward -276 -257 2.55527 0.288
NP_441431.1_2 Reverse -210 -224 17.6985 0.0257
NP_441431.1_2 Forward -225 -211 15.4369 0.0488
NP_441431.1_2 Reverse -154 -168 6.39049 0.272
NP_441431.1_2 Forward -278 -264 5.89884 0.284
NP_441836.1_2 Forward -130 -111 -3.3438 0.237
NP_441993.1_1 Reverse -243 -262 2.8238 0.25
NP_440814.1_4 Forward -231 -212 -12.0953 0.229
NP_440467.1_3 Reverse -244 -263 10.7679 0.296
NP_440114.1_10 Forward -222 -208 7.66941 0.229
NP_440114.1_10 Reverse -243 -257 7.17775 0.243
NP_440935.1_6 Reverse -45 -62 15.7128 0.064
NP_442323.1_7 Reverse -110 -129 2.55527 0.265
NP_441510.2_7 Forward -21 -7 10.3237 0.28
NP_440293.1_3 Forward -204 -185 -1.7705 0.239
NP_440293.1_3 Reverse -257 -276 -5.01543 0.269
NP_440766.1_4 Reverse -153 -167 9.43936 0.0871
NP_440766.1_4 Forward -226 -212 9.34103 0.0871
NP_440766.1_5 Forward -247 -235 6.60538 0.296
NP_441421.1_6 Forward -62 -45 18.1001 0.197
NP_441421.1_6 Reverse -332 -349 10.6517 0.279
NP_439988.1_3 Reverse -122 -136 3.53951 0.298
NP_441237.1_9 Forward -251 -241 13.5497 0.0769
NP_441311.1_2 Reverse -207 -221 11.1104 0.257
NP_441246.1_7 Reverse -8 -27 2.0644 0.258
NP_442930.1_1 Forward -344 -334 13.0576 0.239
NP_439910.1_2 Forward -230 -213 -2.91109 0.0305
NP_439910.1_2 Reverse -205 -222 -21.3973 0.183
NP_442867.1_8 Reverse -252 -271 5.211 0.276
NP_440457.1_1 Forward -256 -244 -0.0593532 0.25
NP_440798.1_6 Forward -221 -208 3.26421 0.151
NP_440942.1_6 Forward -277 -258 5.70185 0.259
NP_440473.1_9 Forward -168 -149 -7.27704 0.236
NP_442509.1_9 Forward -222 -212 16.2041 0.00739
NP_442509.1_9 Reverse -213 -223 16.2041 0.00739
NP_442509.1_9 Reverse -115 -125 9.321 0.192
NP_442509.1_9 Reverse -157 -167 8.73102 0.192
NP_442509.1_9 Forward -166 -156 6.66608 0.259
NP_442514.1_5 Forward -276 -257 -1.67294 0.202
NP_440554.1_4 Forward -221 -211 7.35486 0.103
NP_440554.1_4 Reverse -214 -224 7.35486 0.103
NP_441845.1_6 Forward -234 -216 -1.94747 0.299
NP_441885.1_5 Forward -222 -212 11.4848 0.00668
NP_441885.1_5 Reverse -213 -223 11.4848 0.00668
NP_441885.1_5 Forward -124 -114 0.0783647 0.183
NP_442341.1_7 Reverse -212 -226 19.7641 0.00702
NP_442341.1_7 Forward -223 -209 14.0609 0.0326
NP_442341.1_9 Forward -224 -210 9.83206 0.144
NP_442341.1_9 Reverse -4 -18 8.16044 0.178
NP_442341.1_9 Reverse -211 -225 7.96378 0.182
NP_441756.1_5 Forward -272 -253 -5.11376 0.298
NP_441173.1_9 Reverse -58 -66 10.6388 0.261
NP_443000.1_7 Forward -224 -214 1.94665 0.226
NP_443000.1_7 Reverse -211 -221 1.94665 0.226
NP_440552.1_8 Reverse -48 -65 11.0337 0.262
NP_440275.1_3 Forward -224 -214 8.33817 0.0602
NP_440275.1_3 Reverse -211 -221 8.33817 0.0602
NP_440275.1_3 Forward -126 -116 5.68323 0.136
NP_440091.1_1 Forward -226 -214 3.18557 0.166
NP_442354.1_2 Forward -144 -125 0.58944 0.299
NP_439962.1_4 Reverse -149 -168 -4.42544 0.269
NP_440175.1_7 Reverse -255 -273 16.7801 0.0997
NP_442591.1_7 Forward -337 -318 8.16093 0.219
NP_440149.1_8 Forward -222 -203 -6.1954 0.244
NP_441105.1_3 Reverse -202 -221 -2.0655 0.156
NP_441105.1_3 Forward -233 -214 -8.06369 0.265
NP_440216.1_1 Reverse -213 -227 -1.37704 0.0312
NP_440216.1_1 Forward -222 -208 -2.16369 0.0482
NP_440216.1_9 Forward -250 -241 5.50626 0.292
NP_440172.1_1 Forward -222 -212 8.73149 0.0586
NP_440172.1_1 Reverse -213 -223 8.73149 0.0586
NP_440249.1_2 Forward -347 -337 14.4342 0.273
NP_442015.1_10 Reverse -111 -124 18.3088 0.00686
NP_442015.1_10 Forward -226 -213 11.6223 0.0372
NP_442015.1_10 Reverse -209 -222 10.344 0.0391
NP_441226.1_7 Forward -221 -214 14.4934 0.0123
NP_441226.1_7 Reverse -214 -221 14.4934 0.0123
NP_441226.1_7 Reverse -158 -165 9.77352 0.131
NP_442446.1_4 Forward -223 -204 15.2408 0.179
NP_441111.1_7 Forward -221 -213 18.7023 0.00294
NP_441111.1_7 Reverse -214 -222 18.7023 0.00294
NP_441766.1_2 Forward -222 -213 17.5026 0.00297
NP_441766.1_2 Reverse -213 -222 17.5026 0.00297
NP_441766.1_2 Reverse -115 -124 2.85133 0.248
NP_441766.1_9 Reverse -251 -270 6.39097 0.18
NP_442252.1_4 Reverse -254 -273 13.6675 0.258
NP_440416.1_1 Reverse -213 -232 -11.2103 0.272
NP_440416.1_9 Reverse -206 -225 -5.40875 0.0797
NP_440416.1_9 Forward -229 -210 -17.1101 0.231
NP_440416.1_9 Reverse -108 -127 -17.5035 0.241
NP_440416.1_9 Reverse -242 -261 -21.6334 0.295
NP_443052.1_8 Forward -232 -213 -8.35868 0.173
NP_442116.1_6 Reverse -325 -342 14.2804 0.16
NP_442116.1_6 Reverse -326 -343 9.50584 0.227
NP_441940.1_4 Forward -92 -73 6.98095 0.286
NP_440261.1_5 Forward -221 -208 -0.964025 0.0655
NP_440261.1_5 Forward -159 -146 -11.7804 0.266
NP_440261.1_5 Reverse -214 -227 -12.2721 0.277
NP_440988.1_4 Forward -324 -305 7.37428 0.295
NP_440988.1_10 Forward -23 -9 11.1917 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CACTGACTAGTCAAGTGGGGATTTAGTTTTCTGCGTTTCCTGATGGGGCACCAATCTAAAATTTCTCTAGAAATTTCTGCGGTGGAAAAACTTTGCAGTAACCAAGTAACCCCGAAAAGAGTAGCCCCCCCAGCCCAGAGCCAGGAAGGGCCATTGCACAATACTTTCTCGATTCATCGGCGATCGCCGAGACGTTGTGGCCTAGGCTTCGCGACCTAAAACGTCCTGTAACTGCCGGATCGCGGCGGCCCCAATATTGATAGCGGCCCAAGTTGCGGCGATCAGAAGGGGGCTAACAACTACAATTACACGCCAATCCATTGCTGTACCTCGTTTTGTTAAAAGAATATAAATTTTCCGAACACTCTTAATCTTATATCCTAATCCCGACCCCTTGGGA

CDS

ATGGAAACCGGGCCACAGGTCTGGGCAATGACCAAGCCGGCAAACAGGAAAAACTCTGTTAAGATCTCCTGTCAGAGAGGCAGTCACCGCTCCCAACTCAAACCACCGTTGTCCCCATTGGATGTAATGACCATTAGCCGGTTTCGTCAGGCAGCCGAAGCGAAGGAATTTTTGATCACCGCAGAAGTTACCCCCCCCAAAGGCGGTAATCCCGAGCGGATGTTGGCGGTGGCGGCAAAGTTACGGGGCCGGGTCCATGGGGTTAACGTCACCGATGGTAGTCGGGCGGTGTTGCGTATGTCTTCCATTGCGGCCTGTGTGTTGTTGCAGCAACGGGGTATTGAAGCCATTTGTCAGATGACCTGCCGGGACCGTAATTTGATTGGTTTGCAAGCTGATCTGATGGGGGCCTATGCCCTCGGTTTACGCAATGTTTTAGCTTTAACCGGCGATCCGCTCAAAGCAGGGGACCATGCCAAGGCCAGACCTGTCTACGATTTAGAGTCTGTCAGACTTTTAAGTTTAATCCGCTCCCTCAACCAGGGGTTAGATTTTAACCAAGCTCCTTTGGTGGATGGCAGGCTAGATTTATTTCCTGGGGCGGCGGTGGACCCCCAGCTCAAAAGTTGGTCTGGCCTACAAAGTCGTTTTGAAAGGAAACTAACAGCGGGAGCACAATTTTTCCAAAGTCAGTTAATTACGGATTTCGATCGCCTGGATAAATTTATGACCCAGGTGGCTGTGGGCTGTGGCAAACCAATTTTGGCGGGTATATTTCTGTTCAAATCGGCTAAAAATGCGACTTTTATCAAGCGGGTGGTACCGGGGGTAAATATTCCCGATGCGCTGATTGATCGCCTGGCCCGGGCCGAAGATCCTTTAAAAGAAGGGGTGGCGATCGCCGCCGAACAGGTAAAACTGGCCAAAGAGCTATGCCAGGGAGTGCACTTGATGGCGATTAAAAAAGAAGAATTAATTCCCGAAATCCTCGACCAGGCCGGCATTGCCCCTCTGGAAAATTAA

Protein

METGPQVWAMTKPANRKNSVKISCQRGSHRSQLKPPLSPLDVMTISRFRQAAEAKEFLITAEVTPPKGGNPERMLAVAAKLRGRVHGVNVTDGSRAVLRMSSIAACVLLQQRGIEAICQMTCRDRNLIGLQADLMGAYALGLRNVLALTGDPLKAGDHAKARPVYDLESVRLLSLIRSLNQGLDFNQAPLVDGRLDLFPGAAVDPQLKSWSGLQSRFERKLTAGAQFFQSQLITDFDRLDKFMTQVAVGCGKPILAGIFLFKSAKNATFIKRVVPGVNIPDALIDRLARAEDPLKEGVAIAAEQVKLAKELCQGVHLMAIKKEELIPEILDQAGIAPLEN