Your browser is old and dusty. Try Google Chrome!

Details for slr2136

ORF slr2136
Accession NP_441037.1
Symbol
Category Other
Definition GcpE protein homolog
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -190 -176 4.91614 0.142
NP_441061.1_2 Reverse -260 -274 0.392915 0.211
NP_441061.1_2 Forward -256 -242 -2.65535 0.3
NP_440557.1_1 Forward -59 -40 2.0644 0.244
NP_440557.1_1 Forward -379 -360 -1.27885 0.271
NP_440795.1_7 Forward -190 -183 14.6904 0.0123
NP_440795.1_7 Reverse -183 -190 14.6904 0.0123
NP_440795.1_7 Reverse -372 -379 10.8555 0.132
NP_440795.1_7 Forward -295 -288 7.80726 0.232
NP_441418.1_6 Forward -191 -172 -10.4236 0.035
NP_441418.1_6 Forward -305 -286 -20.7484 0.125
NP_442291.1_5 Reverse -181 -197 11.8583 0.0372
NP_441453.1_4 Forward -191 -183 16.6374 0.00633
NP_441453.1_4 Reverse -182 -190 16.539 0.00633
NP_441453.1_4 Forward -380 -372 3.756 0.288
NP_442151.1_6 Forward -191 -177 11.996 0.0854
NP_442151.1_6 Forward -324 -310 11.6026 0.0956
NP_442151.1_6 Reverse -371 -385 10.9143 0.113
NP_442151.1_6 Forward -170 -156 5.60446 0.27
NP_441818.1_1 Reverse -183 -194 15.8894 0.0244
NP_441818.1_1 Forward -190 -179 10.1862 0.232
NP_441818.1_9 Forward -298 -279 -9.34199 0.29
NP_440226.1_1 Forward -191 -172 9.83255 0.0687
NP_440226.1_1 Reverse -182 -201 8.55425 0.0849
NP_442744.1_8 Reverse -315 -334 -3.73712 0.297
NP_442287.1_3 Forward -199 -182 12.4278 0.3
NP_442655.1_10 Reverse -312 -331 -19.2734 0.282
NP_442173.1_1 Reverse -183 -191 17.3257 0.00633
NP_442173.1_1 Forward -190 -182 15.4574 0.00633
NP_442752.1_4 Reverse -182 -189 13.8055 0.0199
NP_443027.1_4 Reverse -180 -190 14.0414 0.0452
NP_443027.1_4 Forward -193 -183 12.5664 0.0683
NP_443027.1_4 Reverse -369 -379 7.15819 0.244
NP_439997.1_6 Forward -224 -205 10.9142 0.212
NP_442975.1_10 Forward -195 -181 3.44058 0.259
NP_440784.1_7 Forward -190 -183 15.9687 0.0123
NP_440784.1_7 Reverse -183 -190 15.9687 0.0123
NP_440784.1_7 Forward -379 -372 9.67555 0.104
NP_440061.1_9 Reverse -180 -194 8.25877 0.177
NP_440061.1_9 Forward -193 -179 8.06211 0.183
NP_442062.1_8 Reverse -182 -192 17.0896 0.0025
NP_442062.1_8 Forward -191 -181 14.9263 0.0108
NP_442062.1_8 Forward -380 -370 6.37155 0.127
NP_440761.1_4 Forward -196 -177 -13.3736 0.257
NP_441859.1_3 Forward -243 -224 3.53858 0.239
NP_441802.1_1 Reverse -348 -367 13.0775 0.175
NP_440304.1_4 Reverse -180 -190 10.8948 0.051
NP_440304.1_4 Reverse -313 -323 6.56821 0.15
NP_440304.1_4 Forward -62 -52 4.0116 0.281
NP_440304.1_4 Reverse -66 -76 2.63497 0.299
NP_442242.1_4 Forward -190 -183 14.3954 0.0124
NP_442242.1_4 Reverse -183 -190 14.3954 0.0124
NP_440044.1_8 Reverse -372 -391 1.27776 0.178
NP_440044.1_8 Reverse -183 -202 -1.7705 0.251
NP_440765.1_3 Forward -169 -150 10.8159 0.268
NP_441200.1_4 Reverse -225 -244 7.57094 0.272
NP_440370.1_10 Reverse -173 -192 7.66927 0.251
NP_442742.1_9 Reverse -11 -30 -13.2752 0.271
NP_440518.1_3 Forward -148 -129 10.4217 0.196
NP_442110.1_7 Forward -191 -177 21.1407 0.013
NP_442110.1_7 Forward -86 -72 -0.492064 0.291
NP_441925.1_2 Forward -28 -9 5.80098 0.262
NP_440856.1_4 Forward -166 -147 -1.27885 0.195
NP_441083.1_5 Forward -191 -181 11.0914 0.0166
NP_441083.1_5 Reverse -182 -192 10.5014 0.0197
NP_441083.1_5 Reverse -371 -381 8.04317 0.046
NP_441434.1_7 Reverse -373 -387 10.0294 0.188
NP_441738.1_2 Forward -189 -182 15.28 0.0102
NP_441738.1_2 Reverse -184 -191 11.5435 0.084
NP_441558.1_5 Forward -193 -174 9.93088 0.11
NP_441558.1_5 Reverse -313 -332 6.39097 0.217
NP_441558.1_5 Reverse -180 -199 5.211 0.257
NP_441942.1_3 Forward -340 -321 17.1812 0.228
NP_440209.1_1 Reverse -182 -190 18.1123 0.00295
NP_440209.1_1 Forward -191 -183 8.57422 0.0425
NP_442889.1_8 Reverse -368 -382 10.5204 0.0832
NP_442889.1_8 Forward -194 -180 3.73557 0.273
NP_442570.1_3 Forward -314 -295 -2.85214 0.215
NP_442570.1_3 Forward -193 -174 -6.68705 0.259
NP_442570.1_3 Forward -388 -369 -9.34199 0.298
NP_441716.1_1 Forward -191 -177 3.24451 0.272
NP_441716.1_2 Reverse -11 -30 -1.14243 0.286
NP_440644.1_5 Forward -244 -225 19.764 0.0268
NP_442111.1_4 Forward -192 -178 10.816 0.0518
NP_440906.1_5 Forward -190 -183 15.8704 0.0124
NP_440906.1_5 Reverse -183 -190 15.8704 0.0124
NP_440747.1_10 Reverse -179 -191 7.4138 0.00422
NP_440747.1_10 Forward -194 -182 7.11881 0.00789
NP_440747.1_10 Forward -383 -371 -4.68091 0.115
NP_440747.1_10 Reverse -368 -380 -12.1541 0.227
NP_441130.1_10 Reverse -180 -194 9.04604 0.131
NP_442973.1_5 Reverse -239 -258 10.4225 0.286
NP_441486.1_1 Forward -194 -180 11.3077 0.0164
NP_441486.1_1 Reverse -179 -193 6.48943 0.0344
NP_441486.1_1 Forward -383 -369 0.982901 0.122
NP_441486.1_1 Reverse -368 -382 -5.31028 0.231
NP_442634.1_4 Forward -193 -179 -1.96703 0.149
NP_441265.1_3 Reverse -176 -190 1.67122 0.2
NP_441014.1_5 Forward -339 -321 11.3272 0.258
NP_441014.1_10 Forward -381 -362 0.293673 0.244
NP_442848.1_1 Reverse -176 -190 -0.983719 0.263
NP_442848.1_4 Forward -114 -100 5.40779 0.296
NP_442848.1_5 Reverse -44 -62 -1.45582 0.276
NP_442848.1_9 Reverse -272 -291 -0.590531 0.278
NP_441012.1_4 Reverse -178 -191 9.75405 0.272
NP_441012.1_4 Forward -278 -265 6.70579 0.276
NP_443018.1_3 Forward -190 -183 14.8871 0.0123
NP_443018.1_3 Reverse -183 -190 14.8871 0.0123
NP_443018.1_3 Reverse -272 -279 10.2655 0.107
NP_443018.1_3 Reverse -177 -184 9.38056 0.128
NP_443018.1_3 Reverse -372 -379 4.07068 0.299
NP_443018.1_3 Reverse -316 -323 4.07068 0.299
NP_441634.1_1 Forward -175 -156 -2.55715 0.275
NP_441634.1_8 Reverse -385 -399 -4.22864 0.295
NP_441634.1_8 Reverse -285 -299 -4.32697 0.295
NP_440376.1_1 Forward -191 -182 9.73449 0.0365
NP_440376.1_1 Reverse -182 -191 9.63616 0.0385
NP_440376.1_1 Reverse -371 -380 6.48957 0.0963
NP_440376.1_1 Forward -305 -296 3.44131 0.203
NP_440376.1_1 Forward -380 -371 -0.000272808 0.285
NP_441857.1_5 Forward -198 -180 7.00065 0.189
NP_441588.1_4 Reverse -373 -383 14.6313 0.0719
NP_441588.1_4 Reverse -184 -194 9.41981 0.14
NP_442687.1_7 Reverse -181 -191 7.94484 0.121
NP_442687.1_7 Forward -61 -51 7.05986 0.142
NP_442687.1_7 Forward -381 -371 6.37155 0.171
NP_442485.1_3 Reverse -360 -379 -3.83545 0.277
NP_441388.1_10 Reverse -66 -83 16.9751 0.158
NP_441422.1_7 Forward -193 -176 -9.3026 0.297
NP_442658.1_1 Reverse -246 -256 11.2876 0.0874
NP_442658.1_1 Reverse -313 -323 7.0594 0.214
NP_442658.1_1 Forward -193 -183 7.0594 0.214
NP_442658.1_1 Reverse -180 -190 6.76441 0.214
NP_442658.1_1 Reverse -369 -379 6.56775 0.224
NP_440141.1_8 Reverse -306 -325 13.5691 0.156
NP_442782.1_7 Reverse -174 -193 1.67108 0.195
NP_441414.1_9 Reverse -182 -201 -4.52377 0.156
NP_441256.1_1 Forward -80 -61 4.62101 0.115
NP_442937.1_5 Forward -385 -366 14.4541 0.0758
NP_442937.1_5 Forward -295 -276 8.55425 0.219
NP_442937.1_5 Reverse -366 -385 7.96426 0.237
NP_441958.1_5 Reverse -181 -191 10.9931 0.00875
NP_441958.1_5 Forward -192 -182 2.53664 0.0409
NP_440203.1_5 Forward -188 -178 15.7125 0.0611
NP_439905.1_2 Reverse -260 -274 11.996 0.208
NP_440984.1_7 Forward -196 -182 5.60446 0.248
NP_439990.1_5 Reverse -177 -190 11.229 0.128
NP_442911.1_2 Reverse -172 -191 -6.88371 0.195
NP_441580.1_6 Reverse -171 -190 -7.67036 0.246
NP_440153.1_5 Forward -85 -71 10.7177 0.0916
NP_440153.1_5 Forward -190 -176 0.491246 0.299
NP_443055.1_6 Reverse -363 -381 0.0184138 0.251
NP_440993.1_3 Reverse -172 -191 6.39016 0.148
NP_440827.1_1 Reverse -71 -90 15.2408 0.226
NP_440602.1_8 Reverse -182 -196 10.226 0.29
NP_441294.1_7 Forward -195 -181 13.5701 0.0616
NP_441646.1_1 Forward -93 -74 0.196116 0.254
NP_441646.1_1 Reverse -241 -260 -1.08219 0.278
NP_442438.1_10 Reverse -177 -191 7.17775 0.0987
NP_442438.1_10 Forward -196 -182 -0.983719 0.287
NP_441000.1_6 Reverse -181 -195 4.81781 0.0933
NP_441000.1_6 Forward -381 -367 -4.81863 0.252
NP_440484.1_3 Forward -193 -179 10.816 0.242
NP_441110.1_10 Forward -119 -100 10.4225 0.291
NP_440147.1_4 Reverse -180 -193 7.6891 0.064
NP_440147.1_4 Forward -326 -313 7.59077 0.0657
NP_440147.1_4 Forward -193 -180 6.60746 0.0881
NP_440147.1_4 Forward -382 -369 5.62415 0.119
NP_440147.1_4 Reverse -49 -62 5.13249 0.136
NP_440147.1_4 Forward -88 -75 0.60927 0.249
NP_441550.1_8 Reverse -180 -190 12.3692 0.0336
NP_441550.1_8 Forward -193 -183 10.3043 0.0709
NP_441550.1_8 Forward -382 -372 8.92768 0.112
NP_441916.1_7 Forward -191 -181 10.9931 0.0261
NP_441916.1_7 Reverse -182 -192 8.23984 0.0476
NP_441041.1_4 Forward -191 -172 -3.14714 0.119
NP_441041.1_4 Reverse -155 -174 -7.37537 0.186
NP_441041.1_4 Forward -268 -249 -9.53865 0.218
NP_441041.1_7 Forward -194 -182 9.94422 0.104
NP_442004.1_6 Forward -191 -177 10.6193 0.14
NP_440703.1_9 Reverse -332 -345 5.0336 0.293
NP_441725.1_5 Forward -190 -180 11.2881 0.0247
NP_441725.1_5 Forward -323 -313 6.37155 0.115
NP_439966.1_7 Reverse -180 -190 15.8108 0.0124
NP_439966.1_7 Forward -193 -183 7.0594 0.157
NP_442941.1_3 Forward -190 -180 19.9412 0.00262
NP_442941.1_3 Reverse -183 -193 16.6963 0.0112
NP_442941.1_3 Reverse -372 -382 -1.19994 0.288
NP_440289.1_2 Forward -194 -181 3.65753 0.0754
NP_440289.1_2 Reverse -368 -381 1.39592 0.128
NP_440260.1_8 Forward -389 -371 -3.32411 0.251
NP_440260.1_8 Forward -227 -209 -4.50408 0.273
NP_440260.1_8 Forward -290 -272 -4.79907 0.273
NP_441678.1_4 Forward -247 -228 14.4541 0.16
NP_442281.1_1 Forward -196 -182 17.4035 0.00589
NP_442281.1_1 Reverse -177 -191 13.077 0.031
NP_442281.1_1 Reverse -366 -380 6.39049 0.127
NP_442281.1_1 Forward -385 -371 4.12889 0.206
NP_442281.1_1 Reverse -310 -324 3.24392 0.238
NP_442901.1_4 Reverse -303 -322 -1.57384 0.284
NP_442256.1_2 Forward -193 -175 -8.04399 0.217
NP_441556.1_10 Forward -329 -315 10.6112 0.266
NP_441644.1_6 Forward -191 -181 15.0242 0.00766
NP_441644.1_6 Reverse -371 -381 12.4676 0.0321
NP_441644.1_6 Reverse -182 -192 7.94438 0.113
NP_442215.1_2 Forward -193 -177 4.58176 0.0832
NP_442215.1_2 Forward -326 -310 3.59845 0.094
NP_442215.1_2 Forward -172 -156 -4.95634 0.242
NP_442215.1_2 Reverse -239 -255 -7.31629 0.291
NP_442215.1_2 Reverse -146 -162 -7.41462 0.294
NP_442029.1_6 Forward -196 -177 14.1591 0.125
NP_440253.1_2 Reverse -182 -200 4.44404 0.104
NP_440929.1_8 Forward -191 -182 9.93116 0.0249
NP_440929.1_8 Reverse -182 -191 9.83282 0.0254
NP_442933.1_10 Forward -191 -182 17.601 0.00325
NP_442933.1_10 Reverse -182 -191 17.601 0.00325
NP_442933.1_10 Reverse -371 -380 4.52295 0.24
NP_442933.1_10 Forward -380 -371 4.12963 0.28
NP_440576.1_3 Forward -115 -96 11.4058 0.247
NP_441751.2_8 Forward -190 -176 -0.787057 0.129
NP_442926.1_3 Forward -267 -248 2.94938 0.294
NP_442554.1_8 Forward -190 -180 15.9097 0.00747
NP_442554.1_8 Reverse -183 -193 6.56821 0.112
NP_442554.1_8 Reverse -316 -326 6.17489 0.125
NP_442554.1_8 Forward -323 -313 6.07655 0.126
NP_442554.1_8 Forward -184 -174 5.97822 0.13
NP_442554.1_8 Reverse -372 -382 4.50326 0.184
NP_442554.1_8 Forward -379 -369 3.51995 0.222
NP_442554.1_8 Forward -163 -153 3.32329 0.23
NP_441762.1_7 Forward -192 -180 -5.07423 0.187
NP_441762.1_7 Reverse -286 -298 -5.46756 0.212
NP_442142.1_4 Reverse -179 -192 13.8833 0.0324
NP_442142.1_4 Reverse -368 -381 8.57349 0.112
NP_442142.1_4 Forward -194 -181 5.32859 0.194
NP_442142.1_4 Reverse -245 -258 4.34528 0.223
NP_442142.1_4 Forward -383 -370 3.46031 0.255
NP_442292.1_1 Forward -190 -181 18.486 0.00229
NP_442292.1_1 Reverse -183 -192 9.53783 0.0183
NP_442292.1_5 Reverse -311 -330 -1.96717 0.273
NP_442476.1_6 Reverse -183 -197 4.03116 0.151
NP_442476.1_6 Forward -190 -176 3.44117 0.156
NP_443009.1_5 Forward -381 -370 12.7428 0.0435
NP_443009.1_5 Reverse -181 -192 7.82632 0.118
NP_443009.1_5 Forward -61 -50 7.03967 0.141
NP_443009.1_5 Forward -192 -181 4.8764 0.226
NP_442301.1_2 Reverse -292 -311 5.01354 0.269
NP_441715.1_4 Reverse -183 -193 16.1063 0.0144
NP_441715.1_4 Forward -190 -180 14.828 0.0268
NP_442305.1_6 Reverse -207 -217 15.9091 0.285
NP_441468.1_1 Forward -190 -183 15.8704 0.0124
NP_441468.1_1 Reverse -183 -190 15.8704 0.0124
NP_441468.1_1 Reverse -316 -323 10.9539 0.0726
NP_441468.1_1 Reverse -372 -379 4.07068 0.263
NP_441020.2_6 Reverse -322 -339 8.29864 0.203
NP_441020.2_6 Forward -298 -281 6.03703 0.28
NP_441673.1_1 Forward -191 -182 11.1111 0.0121
NP_441673.1_1 Reverse -182 -191 11.0128 0.018
NP_441673.1_1 Reverse -371 -380 1.37636 0.114
NP_441673.1_1 Forward -380 -371 1.1797 0.163
NP_440265.1_4 Forward -335 -316 15.3958 0.297
NP_441876.1_9 Reverse -240 -250 13.9425 0.267
NP_441826.1_2 Reverse -176 -190 15.5359 0.0196
NP_441330.1_1 Forward -196 -177 -13.1769 0.183
NP_441330.1_1 Reverse -150 -169 -15.3402 0.275
NP_442868.1_6 Forward -193 -183 10.4031 0.038
NP_442868.1_6 Reverse -180 -190 9.91146 0.038
NP_441612.1_2 Reverse -371 -381 11.4537 0.21
NP_442227.1_2 Forward -328 -309 -0.295539 0.253
NP_442361.1_3 Reverse -176 -189 9.36073 0.276
NP_440789.1_8 Reverse -313 -332 18.0924 0.169
NP_442427.1_8 Forward -200 -181 17.699 0.0442
NP_440145.1_3 Forward -390 -371 -3.04881 0.185
NP_440145.1_4 Forward -323 -313 16.5975 0.123
NP_442050.1_5 Reverse -180 -190 16.4991 0.00812
NP_442050.1_5 Forward -193 -183 13.4509 0.0343
NP_442342.1_9 Reverse -313 -329 5.76173 0.233
NP_440558.1_2 Reverse -173 -192 2.3594 0.169
NP_440558.1_2 Forward -179 -160 -4.81876 0.249
NP_440558.1_2 Reverse -268 -287 -6.29373 0.273
NP_441878.1_6 Reverse -314 -324 1.74999 0.0642
NP_441878.1_6 Reverse -370 -380 1.65166 0.0795
NP_441878.1_6 Forward -192 -182 0.668351 0.139
NP_441878.1_6 Reverse -181 -191 0.57002 0.14
NP_441878.1_6 Forward -381 -371 -0.41329 0.177
NP_441036.1_8 Forward -192 -182 8.04317 0.177
NP_441557.1_5 Reverse -182 -191 18.6826 0.0015
NP_441557.1_5 Forward -191 -182 10.5211 0.00695
NP_441557.1_5 Reverse -371 -380 0.491382 0.144
NP_441557.1_5 Forward -380 -371 0.29472 0.174
NP_441520.1_7 Forward -278 -259 6.09597 0.298
NP_441445.1_1 Forward -389 -370 15.6341 0.0437
NP_441445.1_1 Reverse -173 -192 6.39097 0.15
NP_441445.1_1 Reverse -167 -186 0.884433 0.266
NP_441458.1_10 Forward -389 -370 1.47442 0.288
NP_442183.1_1 Forward -191 -177 5.50613 0.215
NP_442632.1_3 Reverse -61 -80 -1.96717 0.212
NP_442347.1_2 Forward -190 -181 12.4878 0.056
NP_442347.1_2 Forward -379 -370 3.53964 0.284
NP_442347.1_2 Reverse -183 -192 2.94966 0.292
NP_442645.1_2 Forward -388 -369 -13.9635 0.168
NP_442645.1_2 Forward -94 -75 -22.715 0.293
NP_441037.1_4 Reverse -313 -323 13.3601 0.0659
NP_441633.1_3 Forward -326 -313 5.72248 0.0481
NP_441633.1_3 Forward -382 -369 -2.83231 0.177
NP_441633.1_3 Forward -193 -180 -4.01229 0.179
NP_441633.1_3 Reverse -369 -382 -6.2739 0.242
NP_441633.1_3 Reverse -49 -62 -7.15888 0.294
NP_440136.1_2 Forward -190 -183 15.9687 0.0123
NP_440136.1_2 Reverse -183 -190 15.9687 0.0123
NP_442998.1_10 Forward -189 -182 15.5754 0.0102
NP_442998.1_10 Reverse -184 -191 5.74231 0.255
NP_440299.1_1 Reverse -178 -191 22.4381 0.000547
NP_440299.1_1 Forward -328 -315 14.5717 0.0241
NP_441799.1_1 Forward -195 -181 10.422 0.0747
NP_441799.1_1 Forward -384 -370 6.78381 0.162
NP_441799.1_1 Forward -90 -76 4.91554 0.232
NP_441799.1_1 Reverse -178 -192 4.52221 0.247
NP_441007.1_10 Reverse -310 -323 9.55739 0.0928
NP_441007.1_10 Reverse -177 -190 -0.570702 0.287
NP_440256.1_1 Reverse -179 -198 12.1925 0.0125
NP_440256.1_1 Forward -194 -175 8.16093 0.0239
NP_440256.1_1 Forward -383 -364 2.85105 0.0589
NP_441559.1_8 Forward -291 -277 1.67122 0.155
NP_440915.1_6 Forward -195 -181 -0.0987402 0.182
NP_440717.1_2 Reverse -68 -87 -9.73531 0.238
NP_441704.1_8 Reverse -171 -190 12.29 0.122
NP_442555.1_2 Forward -268 -249 13.5691 0.236
NP_442452.1_8 Reverse -176 -190 12.9786 0.273
NP_440657.1_5 Reverse -200 -219 10.8159 0.219
NP_441464.1_1 Reverse -60 -79 7.96426 0.261
NP_440306.1_8 Forward -218 -199 -1.37794 0.228
NP_441939.1_3 Forward -379 -360 8.65258 0.167
NP_441939.1_3 Forward -256 -237 5.89931 0.259
NP_441199.1_10 Forward -125 -107 15.6627 0.232
NP_441494.1_6 Forward -65 -52 11.524 0.225
NP_442993.1_1 Forward -380 -364 -9.77456 0.194
NP_442386.1_9 Forward -192 -183 14.8472 0.0287
NP_442386.1_9 Reverse -181 -190 13.8639 0.0289
NP_442386.1_9 Reverse -175 -184 7.07914 0.219
NP_440570.1_5 Reverse -151 -170 -3.54046 0.29
NP_441340.1_5 Forward -190 -183 15.6737 0.0124
NP_441340.1_5 Reverse -183 -190 15.6737 0.0124
NP_441271.1_8 Reverse -157 -167 14.4347 0.266
NP_442484.1_2 Forward -322 -303 8.06259 0.144
NP_442484.1_2 Reverse -171 -190 7.7676 0.148
NP_442484.1_2 Forward -202 -183 2.26107 0.226
NP_442791.1_2 Forward -297 -278 14.5524 0.0505
NP_442791.1_5 Forward -388 -369 -0.4922 0.21
NP_440168.1_4 Reverse -255 -274 -7.27704 0.278
NP_440586.1_8 Forward -190 -183 13.2151 0.026
NP_440586.1_8 Reverse -183 -190 13.2151 0.026
NP_440586.1_8 Reverse -272 -279 9.08521 0.178
NP_440586.1_8 Reverse -372 -379 7.41359 0.251
NP_442251.1_6 Forward -190 -183 15.2804 0.0124
NP_442251.1_6 Reverse -183 -190 15.2804 0.0124
NP_441262.1_3 Reverse -182 -189 14.7888 0.0223
NP_441262.1_3 Forward -191 -184 13.9038 0.0336
NP_440027.1_8 Forward -194 -175 7.17681 0.269
NP_440027.1_8 Reverse -151 -170 6.58682 0.27
NP_443051.1_1 Reverse -181 -190 10.4228 0.00754
NP_443051.1_1 Forward -192 -183 1.08137 0.123
NP_440439.1_1 Reverse -179 -192 0.805932 0.175
NP_439943.1_4 Forward -79 -60 6.19431 0.275
NP_440372.1_2 Forward -190 -183 16.3621 0.0124
NP_440372.1_2 Reverse -183 -190 16.3621 0.0124
NP_441803.1_2 Reverse -177 -196 6.4893 0.152
NP_439977.1_5 Forward -197 -178 0.884433 0.199
NP_440139.1_1 Forward -197 -178 11.7 0.0797
NP_442416.1_1 Forward -121 -102 16.4719 0.147
NP_441572.1_7 Reverse -309 -328 2.0644 0.139
NP_440267.1_2 Forward -196 -182 13.2736 0.125
NP_442384.1_10 Forward -191 -178 16.9322 0.00688
NP_441877.1_7 Reverse -366 -385 -0.591301 0.291
NP_441018.1_7 Forward -345 -326 9.43923 0.223
NP_442262.1_10 Forward -190 -183 14.1988 0.0123
NP_442262.1_10 Reverse -183 -190 14.1988 0.0123
NP_442262.1_10 Reverse -316 -323 9.47889 0.187
NP_442262.1_10 Reverse -177 -184 9.47889 0.187
NP_442262.1_10 Reverse -272 -279 9.18389 0.211
NP_441689.1_5 Reverse -180 -190 15.3192 0.0403
NP_441689.1_5 Forward -240 -230 9.91099 0.132
NP_441689.1_5 Forward -193 -183 8.04271 0.166
NP_440163.1_10 Reverse -179 -189 12.4681 0.159
NP_440163.1_10 Reverse -290 -300 8.1415 0.287
NP_440344.1_10 Reverse -289 -306 -5.86102 0.11
NP_440344.1_10 Reverse -175 -192 -7.72931 0.119
NP_440344.1_10 Forward -198 -181 -13.6292 0.29
NP_440531.1_6 Reverse -174 -193 1.47442 0.176
NP_440531.1_6 Reverse -147 -166 -4.72043 0.286
NP_440531.1_8 Reverse -376 -395 7.47261 0.221
NP_442910.1_1 Reverse -175 -194 -6.39206 0.254
NP_442832.1_3 Forward -341 -322 12.1925 0.288
NP_441965.1_10 Forward -194 -178 5.07341 0.219
NP_442693.1_2 Reverse -286 -305 12.1925 0.169
NP_442556.1_10 Forward -218 -199 19.9078 0.113
NP_440297.1_9 Forward -190 -180 9.32148 0.0917
NP_440297.1_9 Reverse -272 -282 0.176696 0.282
NP_440297.1_9 Forward -323 -313 -0.0199663 0.282
NP_440297.1_9 Forward -184 -174 -0.118297 0.282
NP_440350.1_5 Forward -361 -342 -5.40875 0.289
NP_440894.1_10 Reverse -164 -183 4.32602 0.254
NP_440999.1_9 Forward -328 -314 4.22782 0.116
NP_440999.1_9 Forward -195 -181 1.86788 0.157
NP_440999.1_9 Forward -87 -73 -1.96703 0.254
NP_440888.1_2 Forward -191 -177 16.6169 0.00609
NP_440888.1_2 Reverse -182 -196 12.9786 0.0354
NP_440888.1_2 Forward -380 -366 11.897 0.0562
NP_440888.1_2 Forward -86 -72 6.98048 0.212
NP_440600.1_4 Forward -199 -181 -2.43913 0.197
NP_441543.1_2 Forward -190 -181 16.9127 0.00359
NP_441543.1_2 Reverse -183 -192 13.8644 0.021
NP_441543.1_2 Forward -379 -370 6.39124 0.153
NP_441543.1_2 Reverse -372 -381 4.32629 0.26
NP_442845.1_2 Reverse -176 -190 14.4542 0.0801
NP_442845.1_2 Forward -191 -177 7.47274 0.195
NP_442845.1_2 Forward -170 -156 5.1128 0.243
NP_442845.1_2 Forward -197 -183 4.32615 0.261
NP_441469.1_8 Reverse -370 -379 11.7011 0.152
NP_441469.1_8 Reverse -314 -323 10.3245 0.223
NP_441469.1_8 Reverse -181 -190 6.48957 0.227
NP_441469.1_8 Forward -325 -316 6.39124 0.227
NP_443064.1_6 Forward -191 -181 9.75513 0.199
NP_443064.1_6 Reverse -182 -192 8.97947 0.254
NP_442578.1_7 Forward -190 -183 14.5921 0.026
NP_442578.1_7 Reverse -183 -190 14.5921 0.026
NP_441462.1_2 Reverse -182 -192 10.5998 0.0068
NP_441462.1_2 Forward -191 -181 1.84832 0.081
NP_441621.1_7 Reverse -285 -299 2.85119 0.123
NP_443062.1_1 Reverse -182 -200 13.3238 0.0638
NP_443062.1_1 Forward -191 -173 7.47334 0.175
NP_443062.1_6 Reverse -174 -193 0.687771 0.291
NP_440349.1_3 Reverse -288 -307 10.4217 0.283
NP_442204.1_1 Reverse -178 -189 9.69511 0.0736
NP_442204.1_1 Reverse -73 -84 0.0586712 0.284
NP_442204.1_5 Reverse -305 -324 2.3594 0.213
NP_441560.1_3 Reverse -288 -306 7.00065 0.28
NP_441351.1_8 Reverse -369 -388 0.884433 0.28
NP_440516.1_2 Forward -379 -361 1.49411 0.194
NP_440516.1_8 Reverse -182 -191 9.4395 0.0183
NP_440516.1_8 Forward -191 -182 7.17789 0.0754
NP_441785.1_1 Forward -305 -291 12.2535 0.259
NP_442428.1_5 Forward -190 -183 15.8704 0.0124
NP_442428.1_5 Reverse -183 -190 15.8704 0.0124
NP_442428.1_5 Reverse -316 -323 4.66067 0.244
NP_442428.1_5 Reverse -372 -379 4.56234 0.249
NP_441353.1_8 Forward -306 -287 17.4892 0.245
NP_442859.1_2 Reverse -177 -196 2.85105 0.262
NP_442859.1_6 Reverse -46 -65 0.981987 0.297
NP_442120.1_10 Reverse -248 -267 -8.16202 0.23
NP_442120.1_10 Forward -358 -339 -15.5368 0.294
NP_442120.1_10 Forward -292 -273 -15.6352 0.294
NP_442120.1_10 Forward -229 -210 -15.8318 0.296
NP_440673.1_2 Forward -290 -271 11.7553 0.165
NP_440673.1_3 Reverse -184 -191 14.0021 0.0426
NP_440673.1_3 Forward -189 -182 12.4288 0.0426
NP_440673.1_3 Forward -378 -371 9.38056 0.192
NP_440673.1_3 Forward -231 -224 6.23397 0.283
NP_440718.1_2 Forward -273 -254 10.4225 0.285
NP_443048.1_5 Reverse -364 -377 19.1938 0.222
NP_441052.1_2 Reverse -371 -381 13.7464 0.0275
NP_441052.1_2 Forward -191 -181 11.4848 0.0285
NP_441052.1_2 Reverse -182 -192 10.1081 0.0295
NP_441052.1_2 Forward -380 -370 5.19158 0.128
NP_442219.1_8 Forward -291 -272 9.23007 0.234
NP_442219.1_8 Forward -390 -371 7.68394 0.265
NP_442219.1_9 Reverse -183 -192 18.486 0.00718
NP_442219.1_9 Forward -190 -181 17.7976 0.00718
NP_440436.1_4 Forward -190 -181 17.2072 0.00233
NP_440436.1_4 Reverse -183 -192 15.9289 0.00508
NP_440436.1_4 Forward -256 -247 8.75075 0.0995
NP_440436.1_4 Forward -379 -370 5.40752 0.204
NP_441884.1_9 Forward -194 -175 -22.9117 0.284
NP_442086.1_3 Forward -190 -171 6.68596 0.285
NP_441719.1_4 Forward -190 -183 16.3621 0.0124
NP_441719.1_4 Reverse -183 -190 16.3621 0.0124
NP_441004.1_1 Reverse -309 -328 -0.590531 0.124
NP_441004.1_1 Forward -66 -47 -17.4051 0.291
NP_441004.1_2 Forward -71 -52 1.76941 0.217
NP_441004.1_4 Forward -63 -53 8.73149 0.267
NP_442366.1_3 Forward -258 -240 3.26407 0.113
NP_440129.1_9 Reverse -303 -322 9.53756 0.182
NP_442873.1_3 Forward -332 -313 4.52188 0.263
NP_443054.1_2 Forward -307 -293 9.63603 0.0918
NP_443054.1_2 Reverse -369 -383 -0.0987402 0.284
NP_442586.1_6 Forward -71 -52 10.0292 0.227
NP_441851.1_10 Reverse -181 -191 16.9913 0.00552
NP_441851.1_10 Forward -192 -182 6.56821 0.161
NP_441851.1_10 Reverse -314 -324 6.56821 0.161
NP_441851.1_10 Reverse -370 -380 5.19158 0.221
NP_442622.1_1 Reverse -166 -185 -11.8986 0.257
NP_442856.1_7 Reverse -68 -87 -0.000545616 0.203
NP_442856.1_7 Reverse -362 -381 -0.983855 0.214
NP_442856.1_7 Forward -333 -314 -5.11376 0.272
NP_442856.1_7 Reverse -173 -192 -6.39206 0.297
NP_442515.1_1 Reverse -181 -195 0.392915 0.193
NP_442473.1_1 Forward -307 -288 6.19431 0.237
NP_440463.1_6 Reverse -245 -264 12.1925 0.157
NP_441349.1_10 Forward -201 -182 -0.590531 0.0947
NP_441409.1_6 Reverse -176 -195 9.0459 0.0249
NP_440432.1_9 Reverse -183 -198 2.24151 0.123
NP_440432.1_9 Forward -323 -308 -5.32998 0.245
NP_442843.1_1 Reverse -372 -391 -4.42544 0.239
NP_439960.1_10 Reverse -175 -193 3.75572 0.163
NP_440431.1_3 Forward -192 -173 -11.8986 0.292
NP_442450.1_5 Reverse -180 -190 9.32148 0.115
NP_442168.1_5 Forward -174 -155 3.14605 0.232
NP_442006.1_2 Reverse -62 -79 -16.3824 0.25
NP_442006.1_2 Forward -395 -378 -16.5791 0.256
NP_441003.1_9 Reverse -152 -171 2.94938 0.3
NP_441570.1_1 Forward -191 -173 -0.964162 0.0525
NP_441570.1_1 Reverse -371 -389 -1.84914 0.0598
NP_441570.1_1 Forward -262 -244 -10.9939 0.184
NP_441570.1_1 Reverse -182 -200 -17.2871 0.269
NP_441570.1_1 Reverse -297 -315 -17.4838 0.278
NP_440078.1_10 Reverse -315 -334 3.93269 0.256
NP_441078.1_4 Forward -191 -182 9.93116 0.0203
NP_441078.1_4 Reverse -182 -191 9.83282 0.0226
NP_441078.1_4 Reverse -371 -380 7.86621 0.0432
NP_441078.1_4 Forward -380 -371 0.491382 0.188
NP_441078.1_4 Reverse -315 -324 -2.06522 0.295
NP_442906.1_3 Forward -80 -61 5.80098 0.2
NP_440526.1_3 Forward -323 -312 11.6612 0.0646
NP_440526.1_3 Forward -190 -179 7.92465 0.126
NP_440526.1_3 Reverse -183 -194 0.943182 0.267
NP_441432.1_8 Reverse -181 -190 16.8143 0.00595
NP_441432.1_8 Forward -192 -183 7.07956 0.105
NP_441432.1_8 Reverse -160 -169 3.34298 0.248
NP_442320.1_8 Reverse -176 -190 13.1759 0.0144
NP_442320.1_8 Forward -197 -183 13.1759 0.0144
NP_442344.1_7 Reverse -183 -202 -8.85033 0.229
NP_441732.1_2 Reverse -178 -194 -7.90627 0.0983
NP_442797.1_6 Forward -84 -65 10.3581 0.238
NP_440131.1_4 Forward -171 -152 11.4058 0.243
NP_440199.1_10 Reverse -179 -189 7.64985 0.231
NP_440199.1_10 Forward -383 -373 6.56821 0.296
NP_440913.1_1 Forward -193 -175 5.62401 0.237
NP_441072.1_2 Forward -202 -183 6.29264 0.283
NP_440713.1_4 Reverse -172 -191 12.5858 0.105
NP_442489.1_2 Forward -202 -183 8.35759 0.168
NP_442489.1_7 Forward -191 -182 10.4228 0.0151
NP_442489.1_7 Reverse -182 -191 10.3245 0.0193
NP_442489.1_7 Reverse -371 -380 8.1612 0.0294
NP_442489.1_7 Forward -380 -371 0.491382 0.178
NP_442489.1_7 Reverse -315 -324 -1.57357 0.213
NP_441706.1_10 Forward -383 -364 23.0089 0.0209
NP_441452.1_1 Forward -88 -69 17.994 0.117
NP_442079.1_7 Forward -190 -171 2.94938 0.22
NP_440559.1_1 Reverse -183 -192 17.5026 0.00658
NP_440559.1_1 Forward -190 -181 17.4043 0.00658
NP_441659.2_8 Forward -191 -181 15.9097 0.00467
NP_441659.2_8 Reverse -182 -192 8.53483 0.0412
NP_441659.2_8 Forward -380 -370 0.0783647 0.277
NP_441022.1_1 Reverse -21 -30 11.4503 0.284
NP_442913.1_10 Forward -200 -181 -1.37718 0.17
NP_440779.1_5 Forward -324 -307 -6.05768 0.159
NP_442346.1_5 Reverse -181 -191 16.2046 0.00277
NP_442346.1_5 Forward -192 -182 14.533 0.0127
NP_442346.1_5 Forward -381 -371 11.0914 0.0764
NP_442346.1_5 Reverse -314 -324 6.27322 0.208
NP_442346.1_5 Reverse -370 -380 4.89658 0.269
NP_440486.1_6 Reverse -314 -333 8.84924 0.235
NP_440459.1_2 Forward -193 -176 15.3785 0.113
NP_441653.1_2 Reverse -171 -190 7.10507 0.223
NP_440010.1_4 Reverse -280 -299 0.785326 0.243
NP_440010.1_4 Reverse -172 -191 -0.984623 0.267
NP_440847.1_5 Reverse -243 -262 12.9791 0.281
NP_442603.1_7 Forward -191 -177 17.3052 0.0233
NP_441888.1_7 Reverse -243 -257 1.86788 0.235
NP_441050.1_7 Reverse -156 -174 8.18062 0.251
NP_440449.1_6 Forward -342 -324 13.2163 0.105
NP_440170.1_6 Forward -91 -72 21.3373 0.0959
NP_441502.1_3 Forward -62 -43 8.35759 0.215
NP_441833.1_4 Forward -190 -183 15.9687 0.0124
NP_441833.1_4 Reverse -183 -190 15.9687 0.0124
NP_441112.1_6 Forward -396 -377 -2.75381 0.296
NP_442699.1_8 Forward -253 -234 -2.95047 0.218
NP_442162.1_9 Forward -190 -183 16.2637 0.0124
NP_442162.1_9 Reverse -183 -190 16.2637 0.0124
NP_440788.1_8 Reverse -214 -233 7.47261 0.286
NP_440671.1_4 Reverse -176 -190 18.6825 0.012
NP_440224.1_1 Reverse -171 -190 19.9606 0.0127
NP_440224.1_1 Forward -202 -183 -0.295539 0.141
NP_442199.1_5 Reverse -363 -382 7.86593 0.0719
NP_442199.1_5 Forward -199 -180 -3.93378 0.216
NP_442140.1_3 Reverse -183 -193 10.0098 0.0949
NP_442140.1_3 Reverse -316 -326 6.46988 0.168
NP_442140.1_3 Forward -190 -180 4.40493 0.243
NP_440875.1_9 Reverse -250 -260 9.05339 0.233
NP_440875.1_9 Forward -378 -368 8.85871 0.233
NP_440875.1_9 Forward -161 -151 7.59334 0.255
NP_441813.1_5 Forward -193 -183 17.3846 0.00979
NP_441813.1_5 Reverse -180 -190 15.9097 0.01
NP_441813.1_5 Reverse -369 -379 -0.0199663 0.227
NP_440590.1_4 Forward -190 -177 4.14919 0.0632
NP_440590.1_4 Reverse -183 -196 1.39592 0.125
NP_440590.1_4 Reverse -365 -378 0.904263 0.14
NP_440567.1_1 Forward -190 -176 14.5526 0.0187
NP_440567.1_1 Reverse -183 -197 1.96621 0.188
NP_440904.1_2 Forward -243 -224 10.9142 0.272
NP_442497.1_10 Forward -190 -181 10.4228 0.0087
NP_442497.1_10 Reverse -183 -192 8.55452 0.0294
NP_442497.1_10 Forward -323 -314 0.196389 0.208
NP_440821.1_4 Reverse -180 -190 18.2696 0.00448
NP_440821.1_4 Forward -193 -183 0.668351 0.159
NP_440821.1_4 Reverse -313 -323 0.275027 0.19
NP_441239.1_9 Reverse -313 -325 8.29878 0.137
NP_441239.1_9 Forward -326 -314 6.62715 0.182
NP_441239.1_9 Reverse -369 -381 3.97222 0.269
NP_441239.1_9 Forward -193 -181 3.67722 0.279
NP_441009.1_4 Forward -175 -156 15.1424 0.167
NP_441009.1_4 Forward -274 -255 14.6508 0.167
NP_442568.1_8 Reverse -104 -118 15.7325 0.192
NP_441727.1_3 Forward -198 -179 7.27595 0.226
NP_441892.1_1 Forward -389 -372 6.03703 0.0995
NP_441892.1_1 Forward -194 -177 -1.73112 0.212
NP_441892.1_1 Forward -289 -272 -2.02611 0.217
NP_441892.1_1 Reverse -173 -190 -5.27103 0.276
NP_441017.1_6 Forward -195 -181 11.2087 0.273
NP_441017.1_8 Forward -260 -245 10.2063 0.201
NP_440573.1_3 Forward -29 -16 16.2954 0.19
NP_442138.1_10 Forward -191 -172 -2.16383 0.195
NP_442138.1_10 Forward -380 -361 -6.78538 0.286
NP_440546.1_4 Reverse -182 -192 11.6943 0.0748
NP_440546.1_4 Forward -191 -181 10.8217 0.104
NP_441230.1_5 Forward -196 -177 4.71934 0.185
NP_440462.1_6 Forward -193 -183 8.92815 0.0537
NP_440462.1_6 Reverse -180 -190 7.74818 0.0699
NP_440868.1_4 Reverse -178 -190 6.1355 0.0878
NP_440868.1_4 Forward -195 -183 -0.157684 0.248
NP_442499.1_1 Forward -145 -126 12.9791 0.201
NP_440653.1_10 Forward -190 -171 11.7992 0.126
NP_440653.1_10 Reverse -155 -174 2.16274 0.29
NP_441843.2_9 Reverse -184 -202 16.3278 0.116
NP_442039.1_4 Forward -190 -183 15.1821 0.0124
NP_442039.1_4 Reverse -183 -190 15.1821 0.0124
NP_440825.1_6 Reverse -1 -20 10.4225 0.285
NP_442837.1_3 Forward -190 -183 15.7721 0.0124
NP_442837.1_3 Reverse -183 -190 15.7721 0.0124
NP_440160.1_2 Reverse -149 -168 0.196116 0.228
NP_442053.1_1 Reverse -182 -191 9.24284 0.068
NP_442053.1_1 Forward -191 -182 8.94785 0.07
NP_440505.1_3 Reverse -180 -190 16.303 0.00696
NP_440505.1_3 Forward -193 -183 8.63316 0.138
NP_441203.1_1 Forward -190 -171 -11.7019 0.139
NP_441203.1_1 Forward -346 -327 -17.8968 0.297
NP_440914.1_1 Forward -191 -181 16.3248 0.00196
NP_440914.1_1 Reverse -371 -381 14.5682 0.0112
NP_440914.1_1 Reverse -182 -192 8.51751 0.186
NP_441011.1_8 Reverse -183 -192 9.53783 0.123
NP_441011.1_8 Forward -190 -181 8.25953 0.144
NP_442533.1_6 Reverse -182 -191 15.1427 0.00675
NP_442533.1_6 Reverse -371 -380 13.6677 0.0192
NP_442533.1_6 Forward -380 -371 7.66954 0.0897
NP_442533.1_6 Forward -191 -182 7.47288 0.0898
NP_442533.1_6 Reverse -155 -164 2.16301 0.27
NP_442232.1_3 Forward -265 -246 -15.5368 0.292
NP_442229.1_1 Forward -326 -312 6.68548 0.212
NP_441482.1_7 Reverse -176 -190 0.589577 0.0554
NP_439944.1_9 Forward -190 -180 19.0562 0.00329
NP_439944.1_9 Reverse -183 -193 8.82982 0.101
NP_442269.1_10 Forward -352 -333 4.03102 0.248
NP_440816.1_2 Reverse -100 -119 8.95209 0.235
NP_441749.1_8 Reverse -68 -87 22.0256 0.052
NP_441028.1_6 Forward -208 -198 6.76441 0.23
NP_442664.1_3 Forward -344 -330 10.4227 0.288
NP_440116.1_8 Reverse -183 -202 -0.983855 0.115
NP_440116.1_8 Forward -190 -171 -4.72043 0.178
NP_441527.1_5 Reverse -201 -220 11.6293 0.297
NP_441527.1_7 Forward -235 -216 7.07848 0.298
NP_440115.1_6 Reverse -179 -189 9.41981 0.115
NP_440115.1_6 Forward -194 -184 5.5849 0.236
NP_440007.1_9 Reverse -178 -192 10.0294 0.163
NP_440007.1_9 Reverse -340 -354 3.73617 0.267
NP_440007.1_9 Reverse -262 -276 2.16287 0.281
NP_439965.1_1 Reverse -173 -192 -6.39206 0.213
NP_442492.1_2 Reverse -182 -201 8.75091 0.123
NP_441961.1_4 Forward -304 -285 2.16274 0.299
NP_441602.1_4 Reverse -57 -76 11.6025 0.278
NP_441972.1_5 Forward -190 -171 9.0459 0.0678
NP_441972.1_5 Reverse -372 -391 -2.55715 0.186
NP_441972.1_5 Reverse -52 -71 -7.37537 0.248
NP_441106.1_1 Reverse -181 -190 9.63616 0.0311
NP_441106.1_1 Forward -192 -183 8.75118 0.0469
NP_441106.1_1 Reverse -370 -379 5.3096 0.162
NP_441286.1_1 Forward -192 -180 12.232 0.00999
NP_441286.1_1 Reverse -181 -193 3.67722 0.0467
NP_441286.1_1 Forward -325 -313 -6.2542 0.254
NP_442674.1_3 Reverse -307 -326 9.83173 0.174
NP_440670.1_8 Reverse -182 -191 8.94785 0.0606
NP_440670.1_8 Forward -191 -182 8.84951 0.0606
NP_442881.1_3 Reverse -243 -262 13.0766 0.283
NP_440886.1_7 Reverse -370 -380 7.45273 0.093
NP_440886.1_7 Forward -325 -315 6.76441 0.114
NP_440886.1_7 Reverse -286 -296 5.48612 0.181
NP_440828.1_4 Forward -87 -68 -8.06442 0.296
NP_441753.1_10 Reverse -62 -81 11.4058 0.123
NP_442264.1_2 Forward -195 -178 17.3451 0.101
NP_441021.1_8 Reverse -366 -384 1.29745 0.276
NP_440841.1_4 Reverse -180 -199 3.34271 0.0964
NP_441463.1_3 Forward -201 -182 1.76941 0.124
NP_441463.1_5 Reverse -181 -195 13.7659 0.188
NP_441463.1_6 Forward -193 -179 5.73949 0.287
NP_441626.1_2 Forward -190 -183 15.7721 0.0124
NP_441626.1_2 Reverse -183 -190 15.7721 0.0124
NP_442794.1_1 Reverse -178 -190 19.7052 0.00523
NP_442794.1_1 Reverse -157 -169 7.4138 0.138
NP_442794.1_1 Reverse -244 -256 4.07055 0.279
NP_442615.1_1 Forward -200 -182 0.904127 0.0943
NP_442615.1_1 Reverse -173 -191 -3.52077 0.163
NP_441962.1_4 Reverse -266 -285 -13.5702 0.275
NP_441431.1_2 Reverse -151 -165 9.6354 0.181
NP_441431.1_2 Reverse -284 -298 7.17714 0.247
NP_441431.1_2 Reverse -368 -382 6.39049 0.272
NP_441993.1_1 Reverse -176 -195 10.4255 0.126
NP_441993.1_1 Forward -386 -367 9.4509 0.136
NP_441993.1_1 Forward -170 -151 2.04414 0.265
NP_441993.1_1 Reverse -71 -90 0.874656 0.29
NP_440114.1_10 Reverse -248 -262 10.6193 0.142
NP_440114.1_10 Reverse -182 -196 7.86607 0.223
NP_442698.1_10 Reverse -317 -336 1.86774 0.291
NP_442323.1_7 Reverse -223 -242 2.85027 0.258
NP_441720.1_2 Forward -237 -218 4.52188 0.231
NP_440293.1_3 Forward -171 -152 -5.80207 0.282
NP_440766.1_4 Reverse -178 -192 9.2427 0.0871
NP_441133.1_1 Forward -304 -285 12.6841 0.262
NP_439910.1_2 Forward -199 -182 -3.40274 0.0452
NP_442867.1_8 Forward -75 -56 11.4058 0.198
NP_442867.1_8 Reverse -90 -109 6.19431 0.267
NP_440457.1_1 Reverse -178 -190 8.29878 0.101
NP_440213.1_5 Forward -175 -156 11.4058 0.214
NP_440801.1_8 Reverse -370 -389 -1.96717 0.284
NP_440142.1_7 Forward -190 -171 7.17762 0.259
NP_441436.1_8 Reverse -313 -332 10.6192 0.262
NP_441436.1_9 Forward -397 -387 18.4657 0.168
NP_442509.1_9 Forward -380 -370 6.46942 0.268
NP_440554.1_4 Reverse -183 -193 10.9931 0.0429
NP_440554.1_4 Forward -190 -180 7.05986 0.106
NP_440554.1_4 Forward -379 -369 3.91327 0.211
NP_442737.1_5 Forward -192 -173 14.9151 0.178
NP_441885.1_5 Reverse -182 -192 19.6462 0.00179
NP_441885.1_5 Forward -191 -181 11.1898 0.00775
NP_441885.1_5 Reverse -371 -381 1.74999 0.0991
NP_441275.1_6 Reverse -219 -232 13.589 0.212
NP_442341.1_7 Forward -192 -178 6.3911 0.127
NP_442341.1_7 Forward -306 -292 5.60446 0.151
NP_442341.1_7 Reverse -258 -272 3.44117 0.224
NP_442341.1_7 Forward -325 -311 3.34284 0.227
NP_442369.1_6 Reverse -16 -26 16.5414 0.127
NP_440423.1_10 Reverse -175 -194 11.7008 0.218
NP_443000.1_7 Forward -193 -183 19.2529 0.00489
NP_443000.1_7 Reverse -180 -190 17.0896 0.00865
NP_443000.1_7 Forward -88 -78 4.0116 0.225
NP_441842.1_10 Reverse -308 -322 7.37441 0.258
NP_440275.1_3 Reverse -180 -190 8.1415 0.0602
NP_440275.1_3 Forward -193 -183 6.56821 0.101
NP_440091.1_1 Forward -195 -183 11.1504 0.0429
NP_440091.1_1 Reverse -178 -190 -0.452677 0.273
NP_442354.1_8 Forward -70 -51 14.1591 0.22
NP_440149.1_8 Forward -191 -172 -2.45882 0.171
NP_441105.1_3 Forward -196 -177 -5.50708 0.22
NP_441105.1_3 Reverse -171 -190 -5.60541 0.222
NP_441105.1_3 Forward -202 -183 -6.78538 0.241
NP_441105.1_3 Reverse -360 -379 -8.45701 0.272
NP_441105.1_3 Forward -71 -52 -9.14533 0.284
NP_440216.1_1 Reverse -182 -196 7.9644 0.00737
NP_440216.1_1 Forward -380 -366 -3.54032 0.0833
NP_440216.1_1 Forward -191 -177 -10.3252 0.145
NP_440216.1_9 Reverse -273 -282 6.39124 0.289
NP_440216.1_9 Reverse -334 -343 5.89959 0.289
NP_440172.1_1 Reverse -182 -192 17.2863 0.00544
NP_440172.1_1 Reverse -371 -381 9.41981 0.0586
NP_440172.1_1 Forward -191 -181 5.28991 0.146
NP_440172.1_1 Reverse -248 -258 4.3066 0.194
NP_440172.1_1 Forward -60 -50 3.71661 0.219
NP_442015.1_10 Reverse -178 -191 9.06573 0.0553
NP_442015.1_10 Forward -328 -315 2.96921 0.187
NP_441226.1_7 Forward -190 -183 14.4934 0.0123
NP_441226.1_7 Reverse -183 -190 14.4934 0.0123
NP_441757.1_3 Reverse -239 -258 -0.590531 0.231
NP_441111.1_7 Forward -190 -182 18.7023 0.00294
NP_441111.1_7 Reverse -183 -191 8.86921 0.0589
NP_441766.1_2 Reverse -182 -191 17.896 0.00297
NP_441766.1_2 Forward -191 -182 9.4395 0.0285
NP_441766.1_2 Forward -324 -315 2.55633 0.257
NP_442417.1_5 Forward -191 -177 10.7177 0.11
NP_440416.1_1 Reverse -182 -201 -2.0655 0.116
NP_440416.1_9 Reverse -175 -194 -8.26035 0.112
NP_443052.1_8 Forward -201 -182 -10.1286 0.203
NP_442564.1_9 Forward -280 -266 14.5086 0.227
NP_440261.1_5 Forward -190 -177 -1.06236 0.0655
NP_440261.1_5 Forward -323 -310 -1.55401 0.0842
NP_440988.1_7 Reverse -259 -278 -2.55715 0.289
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATCTGCCCCAGCCAGAATTGGTCATCGCCGGTTCCGTACTTTTATTCGGCATCTTCCTTGCTTTGGGTCGTCCTCTGCCATCTCCCCTAGTAATGGGATTAGCCGCTGTGGCCGGTATGTTCCATGGCTACGCCTATGGAGAAGCCATTGTCGGGGCGCAAATGAATCCCGTTGCCGCCTATTTGCTCGGTTTTTCCTTCATTCAACTAGCGATCGCCATGGGAGTCTATGCCTTAGCCAAGGGCTGGTACGAAACCAAAGAAACCTTGCTCAATCTAAGATTTATTGGCTTTCTGCTAACAGGAGTAGGACTAGCCTTCACCTCCGGCGCCTTGTTGGGGTAATTGCTTATGGGATAATAGGTTGCCTACAGTTTTTGATTAAAAACTAAACCTTCCC

CDS

ATGGTAACCGCTTCCCTGCCGACCCCTGTCCAGCCCGAGTTCGACACTACTATCCATCGCCGCAAAACCCGCCCTGTACCAGTAGGCGCTGTCACCGTTGGCGGTGGCCATCCTGTGGTGGTGCAATCCATGATTAATGAAGACACCCTCGATGTGGATGGTTCCGTCGCTGGCATTCGTCGCCTCCACGAAATTGGTTGTGAAATTGTCCGGGTAACGGTGCCCAGCATGGCCCACGCCAAAGCCCTAGCGGATATCAAGCAGAAATTACAAGCTACTTACCAAGCCGTGCCCCTGGTGGCAGACGTACATCACAACGGCATGAAAATTGCTCTGGAAGTAGCCAAACACGTCGATAAAGTCAGGATTAACCCAGGGCTATACGTTTTTGAAAAGCCCGATGCCCAACGGGAAGGCTACAGCGACCAGGAATTTGCTGAAATTGGCGAAAAAATTCGTGAAACCCTGGAACCATTGGTAATTTCCCTACGAGATCAAGGGAAATCGATGCGGATCGGCGTTAACCATGGTTCTCTCTCCGAAAGAATGCTTTTTACCTACGGGGATACCCCCGAGGGCATGGTGCAATCGGCCCTGGAATTCATCAAAATTTGTGAGTCCTTAGATTTCCGCAACCTAGTCGTTTCCATGAAAGCGTCCCGGGTACCGGTAATGTTGGCCGCCTATCGCCTCATGGTGAAACGTATGGACGAGTTGGGCATGGATTATCCCCTCCATCTAGGGGTTACCGAAGCCGGGGATGGGGAATATGGCCGCATTAAATCCACCGCTGGCATTGCCACCCTTTTAGCTGATGGCATTGGCGATACTATCCGGGTATCCCTCACCGAAGCCCCCGAAAAAGAAATTCCCGTTTGCTACAGCATTCTCCAGGCGCTGGGTTTGCGGAAAACCATGGTGGAATATGTGGCCTGTCCTTCCTGTGGCCGCACGTTGTTCAACTTGGAAGACGTGTTACATGAAGTCCGAGAAGCCACTAAACATCTAACGGGTTTAGACATCGCCGTCATGGGCTGTATTGTCAATGGCCCCGGGGAAATGGCCGATGCCGACTATGGCTATGTGGGTAAACAAGCCGGTTACATTGCCCTCTACCGTGGTCGGGAAGAAATTAAACGAGTACCCGAAACCGACGGCGTACAGGAATTAATTAACCTGATCAAGGCCGATGGCCGTTGGGTTGACCCTTAA

Protein

MVTASLPTPVQPEFDTTIHRRKTRPVPVGAVTVGGGHPVVVQSMINEDTLDVDGSVAGIRRLHEIGCEIVRVTVPSMAHAKALADIKQKLQATYQAVPLVADVHHNGMKIALEVAKHVDKVRINPGLYVFEKPDAQREGYSDQEFAEIGEKIRETLEPLVISLRDQGKSMRIGVNHGSLSERMLFTYGDTPEGMVQSALEFIKICESLDFRNLVVSMKASRVPVMLAAYRLMVKRMDELGMDYPLHLGVTEAGDGEYGRIKSTAGIATLLADGIGDTIRVSLTEAPEKEIPVCYSILQALGLRKTMVEYVACPSCGRTLFNLEDVLHEVREATKHLTGLDIAVMGCIVNGPGEMADADYGYVGKQAGYIALYRGREEIKRVPETDGVQELINLIKADGRWVDP