Your browser is old and dusty. Try Google Chrome!

Details for slr2135

ORF slr2135
Accession NP_441036.1
Symbol hupE
Category Hydrogenase
Definition hydrogenase accessory protein HupE
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -322 -308 3.73617 0.16
NP_441061.1_2 Forward -140 -126 0.0979218 0.218
NP_441061.1_2 Reverse -315 -329 -2.16369 0.285
NP_440795.1_7 Forward -322 -315 14.6904 0.0123
NP_440795.1_7 Reverse -315 -322 14.6904 0.0123
NP_440795.1_7 Forward -140 -133 14.6904 0.0123
NP_440795.1_7 Reverse -133 -140 14.6904 0.0123
NP_440795.1_7 Reverse -342 -349 6.92228 0.26
NP_441418.1_6 Forward -141 -122 -2.36049 0.0184
NP_441418.1_6 Reverse -314 -333 -20.3551 0.111
NP_441418.1_6 Forward -323 -304 -20.8467 0.129
NP_441418.1_6 Reverse -275 -294 -29.7948 0.238
NP_441418.1_6 Reverse -278 -297 -30.6798 0.291
NP_442291.1_5 Forward -142 -126 -2.30141 0.215
NP_442272.1_1 Forward -128 -110 18.6229 0.0653
NP_441453.1_4 Reverse -314 -322 16.6374 0.00633
NP_441453.1_4 Reverse -132 -140 16.539 0.00633
NP_441453.1_4 Forward -323 -315 16.539 0.00633
NP_441453.1_4 Forward -141 -133 16.539 0.00633
NP_442151.1_6 Reverse -132 -146 16.9125 0.013
NP_442151.1_6 Forward -323 -309 6.48943 0.233
NP_441818.1_1 Forward -140 -129 9.30127 0.246
NP_441818.1_9 Reverse -269 -288 -3.93378 0.233
NP_440226.1_1 Forward -141 -122 14.7491 0.0291
NP_440226.1_1 Reverse -314 -333 12.2908 0.0456
NP_440150.1_6 Reverse -338 -357 1.96607 0.279
NP_442173.1_1 Forward -322 -314 17.3257 0.00633
NP_442173.1_1 Forward -140 -132 15.4574 0.00633
NP_442173.1_1 Reverse -315 -323 15.4574 0.00633
NP_442173.1_1 Reverse -133 -141 15.4574 0.00633
NP_442752.1_4 Forward -323 -316 13.8055 0.0199
NP_442752.1_4 Forward -141 -134 13.8055 0.0199
NP_442752.1_4 Reverse -132 -139 13.8055 0.0199
NP_443027.1_4 Reverse -130 -140 14.828 0.0437
NP_443027.1_4 Reverse -312 -322 7.94484 0.223
NP_443027.1_4 Forward -143 -133 7.25653 0.24
NP_443027.1_4 Forward -325 -315 5.87989 0.294
NP_441745.1_4 Reverse -222 -241 4.71854 0.25
NP_441812.1_3 Forward -142 -128 7.47274 0.272
NP_442975.1_10 Reverse -128 -142 21.6317 0.000774
NP_442975.1_10 Forward -145 -131 2.35894 0.276
NP_441225.1_4 Forward -145 -126 -3.14714 0.246
NP_440784.1_7 Forward -322 -315 15.9687 0.0123
NP_440784.1_7 Reverse -315 -322 15.9687 0.0123
NP_440784.1_7 Forward -140 -133 15.9687 0.0123
NP_440784.1_7 Reverse -133 -140 15.9687 0.0123
NP_440061.1_9 Forward -325 -311 15.7319 0.0384
NP_440061.1_9 Forward -353 -339 7.3738 0.209
NP_441476.1_5 Reverse -309 -328 7.47261 0.106
NP_442062.1_8 Forward -141 -131 19.4496 0.000558
NP_442062.1_8 Forward -323 -313 17.3846 0.00193
NP_442062.1_8 Reverse -314 -324 16.9913 0.00317
NP_442062.1_8 Reverse -132 -142 10.3048 0.0493
NP_441859.1_3 Forward -324 -305 8.84842 0.134
NP_441859.1_3 Forward -142 -123 5.30853 0.204
NP_440304.1_4 Forward -143 -133 10.8948 0.051
NP_440304.1_4 Reverse -130 -140 10.8948 0.051
NP_440304.1_4 Forward -396 -386 9.81313 0.0524
NP_440304.1_4 Reverse -312 -322 8.23984 0.0845
NP_440304.1_4 Forward -325 -315 1.84832 0.299
NP_442242.1_4 Forward -322 -315 14.3954 0.0124
NP_442242.1_4 Reverse -315 -322 14.3954 0.0124
NP_442242.1_4 Forward -140 -133 14.3954 0.0124
NP_442242.1_4 Reverse -133 -140 14.3954 0.0124
NP_440044.1_8 Forward -140 -121 8.84924 0.0723
NP_440044.1_8 Reverse -133 -152 1.57275 0.17
NP_441781.1_7 Reverse -341 -360 9.63589 0.138
NP_441035.1_9 Reverse -81 -100 21.4356 0.0441
NP_441208.1_9 Forward -144 -130 14.7492 0.093
NP_441594.1_6 Reverse -305 -324 12.8808 0.109
NP_440370.1_10 Reverse -305 -324 11.7008 0.176
NP_442742.1_9 Forward -227 -208 -5.40875 0.221
NP_442110.1_7 Reverse -132 -146 3.53951 0.21
NP_442110.1_7 Forward -323 -309 2.2612 0.222
NP_441925.1_4 Forward -310 -291 -7.57277 0.196
NP_441925.1_4 Forward -315 -296 -8.85106 0.212
NP_441925.1_4 Forward -306 -287 -15.7342 0.273
NP_440856.1_4 Reverse -235 -254 1.27776 0.159
NP_440856.1_4 Forward -148 -129 -5.50708 0.293
NP_440856.1_4 Reverse -307 -326 -5.70374 0.297
NP_441083.1_5 Forward -141 -131 11.3864 0.0159
NP_441083.1_5 Reverse -132 -142 11.2881 0.0159
NP_441083.1_5 Forward -323 -313 9.51814 0.026
NP_441083.1_5 Forward -357 -347 2.92996 0.187
NP_441083.1_5 Reverse -314 -324 2.14332 0.195
NP_442827.1_8 Forward -331 -312 -0.39464 0.226
NP_441434.1_7 Reverse -316 -330 13.2743 0.0961
NP_441141.1_4 Reverse -304 -323 12.8808 0.292
NP_441738.1_2 Reverse -316 -323 15.28 0.0102
NP_441738.1_2 Forward -139 -132 15.28 0.0102
NP_441738.1_2 Reverse -134 -141 15.28 0.0102
NP_441738.1_2 Forward -321 -314 11.5435 0.084
NP_441558.1_5 Reverse -312 -331 11.1109 0.0875
NP_440209.1_1 Reverse -132 -140 18.1123 0.00295
NP_440209.1_1 Forward -323 -315 18.1123 0.00295
NP_440209.1_1 Forward -141 -133 18.1123 0.00295
NP_440209.1_1 Reverse -314 -322 8.57422 0.0425
NP_442889.1_8 Reverse -129 -143 4.12889 0.27
NP_441713.1_1 Forward -147 -128 -5.60541 0.113
NP_441713.1_1 Reverse -308 -327 -6.39206 0.118
NP_440178.1_7 Reverse -341 -360 -14.9469 0.156
NP_440178.1_7 Forward -142 -123 -21.24 0.215
NP_440659.1_9 Reverse -123 -142 10.0292 0.252
NP_441716.1_1 Forward -141 -127 11.111 0.0936
NP_441716.1_1 Reverse -132 -146 3.8345 0.259
NP_442111.1_4 Reverse -313 -327 13.1759 0.0394
NP_442111.1_4 Reverse -131 -145 11.2093 0.0515
NP_442111.1_4 Forward -142 -128 5.21113 0.172
NP_442111.1_4 Forward -324 -310 3.53951 0.24
NP_442111.1_4 Reverse -196 -210 3.53951 0.24
NP_440906.1_5 Forward -322 -315 15.8704 0.0124
NP_440906.1_5 Reverse -315 -322 15.8704 0.0124
NP_440906.1_5 Forward -140 -133 15.8704 0.0124
NP_440906.1_5 Reverse -133 -140 15.8704 0.0124
NP_440747.1_10 Forward -144 -132 15.2803 0.0019
NP_440747.1_10 Reverse -311 -323 -1.92764 0.0192
NP_440747.1_10 Reverse -129 -141 -2.02597 0.0196
NP_440747.1_10 Forward -326 -314 -4.48425 0.101
NP_441486.1_1 Reverse -129 -143 14.0609 0.00683
NP_441486.1_1 Forward -326 -312 6.09611 0.0344
NP_441486.1_1 Forward -144 -130 2.35953 0.0844
NP_441486.1_1 Reverse -311 -325 -5.01529 0.218
NP_441880.2_10 Forward -140 -122 8.08229 0.284
NP_442634.1_4 Reverse -130 -144 -1.18038 0.149
NP_442634.1_4 Forward -325 -311 -2.36035 0.149
NP_442634.1_4 Forward -143 -129 -2.36035 0.149
NP_442634.1_4 Forward -396 -382 -4.62196 0.211
NP_441265.1_3 Reverse -308 -322 -0.787057 0.295
NP_440403.1_10 Forward -397 -378 3.73603 0.272
NP_440842.1_6 Forward -325 -306 12.29 0.25
NP_441014.1_8 Forward -292 -273 -4.42544 0.25
NP_441014.1_8 Forward -124 -105 -8.94866 0.288
NP_442848.1_1 Reverse -126 -140 -1.67204 0.263
NP_442848.1_1 Reverse -308 -322 -4.32697 0.287
NP_443018.1_3 Forward -322 -315 14.8871 0.0123
NP_443018.1_3 Reverse -315 -322 14.8871 0.0123
NP_443018.1_3 Forward -140 -133 14.8871 0.0123
NP_443018.1_3 Reverse -133 -140 14.8871 0.0123
NP_441316.1_7 Reverse -130 -145 13.1562 0.0486
NP_441634.1_8 Forward -166 -152 -3.24533 0.295
NP_441634.1_8 Forward -143 -129 -3.63866 0.295
NP_441634.1_8 Reverse -282 -296 -4.62196 0.295
NP_441634.1_9 Reverse -332 -351 9.43841 0.275
NP_440376.1_1 Forward -141 -132 19.4693 0.000692
NP_440376.1_1 Reverse -132 -141 19.4693 0.000692
NP_440376.1_1 Reverse -314 -323 9.73449 0.0365
NP_440376.1_1 Forward -323 -314 9.63616 0.0385
NP_440376.1_1 Reverse -341 -350 4.52295 0.156
NP_440376.1_1 Reverse -242 -251 3.44131 0.203
NP_440376.1_1 Reverse -110 -119 3.44131 0.203
NP_441588.1_4 Reverse -316 -326 14.238 0.0773
NP_441588.1_4 Reverse -134 -144 7.05986 0.178
NP_442730.1_8 Forward -149 -130 7.57013 0.199
NP_442687.1_7 Reverse -131 -141 15.8113 0.0125
NP_442687.1_7 Forward -324 -314 14.828 0.0247
NP_442687.1_7 Reverse -313 -323 9.02648 0.0994
NP_442687.1_7 Forward -142 -132 9.02648 0.0994
NP_442687.1_7 Forward -395 -385 5.87989 0.183
NP_442687.1_7 Forward -351 -341 4.89658 0.23
NP_440066.1_5 Forward -347 -328 6.39016 0.281
NP_442485.1_3 Forward -352 -333 9.83255 0.12
NP_442485.1_3 Forward -334 -315 -5.31042 0.289
NP_441846.1_10 Reverse -290 -309 -19.0768 0.256
NP_442583.1_3 Forward -379 -360 17.404 0.285
NP_442530.1_2 Forward -234 -224 12.3697 0.276
NP_441422.1_7 Forward -325 -308 0.530496 0.139
NP_441422.1_7 Reverse -130 -147 -2.3211 0.21
NP_440533.1_9 Forward -323 -304 4.42435 0.225
NP_441950.1_7 Reverse -105 -124 -8.06369 0.283
NP_442296.1_9 Reverse -315 -334 8.06259 0.0981
NP_442658.1_1 Reverse -312 -322 16.7941 0.00966
NP_442658.1_1 Reverse -130 -140 15.9091 0.00966
NP_442658.1_1 Forward -325 -315 15.9091 0.00966
NP_442658.1_1 Forward -143 -133 13.0576 0.04
NP_442658.1_1 Forward -37 -27 7.35439 0.214
NP_441855.2_4 Forward -331 -312 18.1997 0.0381
NP_442782.1_2 Forward -394 -380 8.75105 0.198
NP_442782.1_2 Forward -323 -309 2.85119 0.271
NP_442205.1_9 Reverse -126 -142 -0.826444 0.264
NP_440656.1_8 Reverse -121 -140 2.26107 0.113
NP_439968.1_2 Forward -357 -338 13.5683 0.257
NP_441487.1_9 Forward -142 -123 -2.16383 0.293
NP_441256.1_2 Reverse -327 -346 5.89931 0.245
NP_442937.1_5 Forward -328 -309 6.68596 0.272
NP_441958.1_5 Forward -142 -132 21.2195 0.000805
NP_441958.1_5 Reverse -131 -141 12.2714 0.00183
NP_441958.1_5 Forward -324 -314 10.9931 0.00875
NP_441958.1_5 Reverse -313 -323 10.7964 0.0099
NP_442486.1_4 Forward -321 -302 7.47261 0.273
NP_440203.1_5 Reverse -135 -145 13.4509 0.115
NP_440203.1_5 Reverse -254 -264 9.02601 0.275
NP_439990.1_5 Forward -146 -133 17.6205 0.0221
NP_442911.1_2 Reverse -122 -141 -3.93378 0.122
NP_442911.1_2 Forward -333 -314 -10.1286 0.27
NP_440153.1_5 Forward -140 -126 7.9644 0.149
NP_440153.1_8 Forward -293 -280 -3.12731 0.285
NP_441591.1_10 Reverse -149 -168 4.916 0.297
NP_443055.1_6 Forward -358 -340 1.78836 0.224
NP_440993.1_3 Forward -94 -75 -2.16459 0.297
NP_440827.1_9 Reverse -239 -258 17.7974 0.225
NP_440827.1_9 Forward -255 -236 11.0125 0.235
NP_441099.1_5 Reverse -304 -323 -7.86702 0.181
NP_442002.1_9 Reverse -313 -320 11.6422 0.185
NP_442002.1_9 Forward -324 -317 10.7572 0.185
NP_442002.1_9 Reverse -131 -138 10.7572 0.185
NP_440809.1_9 Reverse -123 -141 1.98577 0.118
NP_441294.1_7 Reverse -128 -142 12.4183 0.0994
NP_441294.1_7 Forward -297 -283 11.7463 0.129
NP_442438.1_10 Reverse -309 -323 11.111 0.0463
NP_442438.1_10 Reverse -127 -141 3.63784 0.159
NP_441000.1_6 Forward -142 -128 4.42448 0.0953
NP_441000.1_6 Reverse -313 -327 -1.37704 0.213
NP_441000.1_6 Forward -351 -337 -5.21195 0.266
NP_442771.1_1 Reverse -312 -330 3.55906 0.0672
NP_442771.1_1 Forward -325 -307 3.3624 0.0672
NP_440147.1_4 Forward -325 -312 20.2755 0.00228
NP_440147.1_4 Forward -143 -130 11.6223 0.0326
NP_440147.1_4 Reverse -346 -359 3.36254 0.188
NP_440147.1_4 Reverse -130 -143 2.87088 0.202
NP_440147.1_4 Reverse -312 -325 0.707601 0.247
NP_441550.1_8 Forward -143 -133 15.3192 0.0132
NP_441550.1_8 Reverse -312 -322 15.0242 0.0132
NP_441550.1_8 Forward -325 -315 8.3377 0.124
NP_441550.1_8 Reverse -130 -140 6.0761 0.214
NP_441916.1_7 Reverse -314 -324 19.1546 0.00144
NP_441916.1_7 Reverse -132 -142 18.9579 0.00144
NP_441916.1_7 Forward -141 -131 18.4663 0.00144
NP_441916.1_7 Forward -323 -313 14.828 0.0115
NP_440465.1_4 Forward -324 -305 11.7992 0.217
NP_441041.1_4 Reverse -132 -151 3.44104 0.065
NP_441041.1_4 Reverse -284 -303 1.47442 0.0808
NP_441041.1_4 Forward -141 -122 -11.4069 0.246
NP_441041.1_7 Reverse -311 -323 17.7184 0.00706
NP_441041.1_7 Forward -144 -132 14.4144 0.0348
NP_441041.1_7 Forward -326 -314 6.25147 0.216
NP_442396.1_5 Forward -327 -314 18.8988 0.0167
NP_442004.1_6 Forward -323 -309 14.0609 0.0811
NP_442004.1_6 Reverse -132 -146 3.8345 0.231
NP_442004.1_6 Reverse -314 -328 2.35953 0.266
NP_441725.1_4 Reverse -309 -323 9.04542 0.178
NP_441725.1_4 Forward -146 -132 3.93223 0.278
NP_441725.1_5 Forward -140 -130 11.2881 0.0247
NP_441725.1_5 Forward -322 -312 9.7148 0.0503
NP_441725.1_5 Reverse -315 -325 2.04498 0.115
NP_441725.1_5 Reverse -133 -143 1.94665 0.115
NP_439966.1_7 Reverse -130 -140 18.4657 0.00473
NP_439966.1_7 Forward -325 -315 9.91099 0.0968
NP_439966.1_7 Forward -143 -133 6.27276 0.185
NP_439966.1_9 Reverse -312 -321 0.983037 0.253
NP_439966.1_9 Reverse -130 -139 0.983037 0.253
NP_439966.1_9 Forward -325 -316 0.884706 0.253
NP_440736.1_3 Forward -143 -124 -1.27885 0.282
NP_440202.1_8 Reverse -333 -352 11.3625 0.282
NP_442941.1_3 Forward -140 -130 11.4848 0.0116
NP_442941.1_3 Reverse -133 -143 11.0914 0.0116
NP_442941.1_3 Reverse -315 -325 2.63497 0.14
NP_442941.1_3 Forward -322 -312 -0.118297 0.249
NP_440289.1_2 Reverse -129 -142 5.13249 0.0636
NP_440289.1_2 Forward -326 -313 -3.4223 0.267
NP_440289.1_2 Reverse -311 -324 -4.20895 0.283
NP_440983.1_5 Forward -293 -274 8.65258 0.151
NP_440260.1_8 Reverse -305 -323 -6.56903 0.293
NP_439908.1_6 Reverse -300 -319 11.5042 0.253
NP_442281.1_1 Reverse -309 -323 17.6985 0.00542
NP_442281.1_1 Reverse -127 -141 12.192 0.0396
NP_442281.1_1 Forward -146 -132 9.53707 0.0685
NP_441334.1_7 Reverse -312 -331 -11.6036 0.124
NP_441334.1_7 Forward -325 -306 -21.1417 0.29
NP_440437.1_1 Forward -147 -128 8.75091 0.0539
NP_440437.1_1 Forward -302 -283 -2.95047 0.23
NP_442500.1_2 Forward -325 -306 6.88262 0.283
NP_442012.1_1 Forward -329 -310 9.43923 0.0932
NP_442012.1_1 Forward -147 -128 0.294447 0.241
NP_442012.1_5 Reverse -283 -302 4.52268 0.261
NP_441457.1_7 Forward -143 -124 -0.197208 0.288
NP_441556.1_4 Forward -290 -271 12.8973 0.201
NP_440498.1_1 Reverse -123 -141 5.13236 0.11
NP_442982.1_5 Forward -187 -168 -2.36049 0.286
NP_441644.1_3 Forward -263 -244 17.404 0.252
NP_441644.1_6 Reverse -132 -142 19.0557 0.000803
NP_441644.1_6 Forward -141 -131 10.1076 0.0628
NP_441644.1_6 Reverse -314 -324 7.74772 0.117
NP_441644.1_6 Forward -323 -313 6.27276 0.163
NP_442215.1_2 Reverse -130 -146 -0.531451 0.168
NP_442215.1_2 Forward -325 -309 -0.826444 0.173
NP_442215.1_2 Reverse -228 -244 -6.03799 0.263
NP_442215.1_2 Forward -295 -279 -7.0213 0.284
NP_442029.1_1 Reverse -282 -301 -18.4868 0.272
NP_442247.1_8 Forward -325 -311 12.8809 0.247
NP_442247.1_8 Forward -143 -129 9.43936 0.247
NP_440253.1_2 Forward -141 -123 8.08229 0.0625
NP_440929.1_8 Forward -141 -132 19.2726 0.000701
NP_440929.1_8 Reverse -132 -141 19.2726 0.000701
NP_440929.1_8 Reverse -314 -323 9.93116 0.0249
NP_440929.1_8 Forward -323 -314 9.83282 0.0254
NP_442933.1_10 Forward -323 -314 17.601 0.00325
NP_442933.1_10 Reverse -314 -323 17.601 0.00325
NP_442933.1_10 Forward -141 -132 17.601 0.00325
NP_442933.1_10 Reverse -132 -141 17.601 0.00325
NP_441751.2_8 Forward -322 -308 4.32615 0.0511
NP_441751.2_8 Reverse -133 -147 -2.45868 0.132
NP_442554.1_8 Reverse -133 -143 16.4013 0.0065
NP_442554.1_8 Forward -140 -130 13.8447 0.0145
NP_442554.1_8 Reverse -315 -325 13.2547 0.0187
NP_442554.1_8 Forward -322 -312 7.35486 0.0931
NP_441762.1_7 Reverse -313 -325 20.4918 0.00342
NP_441762.1_7 Reverse -131 -143 9.47875 0.0142
NP_441762.1_7 Forward -324 -312 4.26721 0.0518
NP_441762.1_7 Forward -142 -130 2.98891 0.0676
NP_442142.1_4 Forward -144 -131 14.1783 0.0311
NP_442142.1_4 Reverse -311 -324 8.86849 0.106
NP_442142.1_4 Reverse -129 -142 8.57349 0.112
NP_442292.1_1 Reverse -133 -142 17.5026 0.00435
NP_442292.1_1 Reverse -315 -324 9.63616 0.0183
NP_442292.1_1 Forward -140 -131 9.63616 0.0183
NP_442292.1_1 Forward -322 -313 0.589713 0.23
NP_440511.1_1 Reverse -301 -319 5.91901 0.241
NP_442476.1_6 Forward -140 -126 4.62115 0.142
NP_442476.1_6 Reverse -315 -329 2.06454 0.195
NP_442476.1_6 Forward -322 -308 1.27789 0.223
NP_441711.1_4 Reverse -77 -96 4.22769 0.219
NP_443009.1_5 Forward -142 -131 19.626 0.00102
NP_443009.1_5 Reverse -313 -324 16.5777 0.00867
NP_443009.1_5 Forward -324 -313 8.02298 0.118
NP_443009.1_5 Reverse -131 -142 7.82632 0.118
NP_443009.1_5 Forward -351 -340 7.72798 0.122
NP_442301.1_2 Forward -300 -281 4.22689 0.281
NP_441715.1_4 Forward -140 -130 16.303 0.0117
NP_441715.1_4 Reverse -315 -325 9.41981 0.097
NP_441715.1_4 Reverse -133 -143 7.35486 0.108
NP_440015.1_9 Forward -323 -305 -0.669169 0.264
NP_440183.1_1 Forward -322 -303 9.63589 0.244
NP_441198.1_8 Reverse -312 -322 14.7362 0.0644
NP_441198.1_8 Forward -143 -133 12.783 0.116
NP_441468.1_1 Forward -322 -315 15.8704 0.0124
NP_441468.1_1 Reverse -315 -322 15.8704 0.0124
NP_441468.1_1 Forward -140 -133 15.8704 0.0124
NP_441468.1_1 Reverse -133 -140 15.8704 0.0124
NP_441020.2_6 Reverse -312 -329 20.3934 0.00602
NP_441020.2_6 Forward -325 -308 8.29864 0.203
NP_441020.2_6 Reverse -130 -147 7.512 0.229
NP_441015.1_10 Reverse -288 -307 -2.75381 0.182
NP_441015.1_10 Reverse -309 -328 -6.68705 0.253
NP_441015.1_10 Reverse -297 -316 -11.3086 0.294
NP_441015.1_10 Reverse -282 -301 -11.7019 0.3
NP_441015.1_10 Reverse -34 -53 -11.7019 0.3
NP_441673.1_1 Forward -141 -132 20.8459 0.000698
NP_441673.1_1 Reverse -132 -141 20.8459 0.000698
NP_441673.1_1 Reverse -314 -323 11.1111 0.0121
NP_441673.1_1 Forward -323 -314 11.0128 0.018
NP_441673.1_1 Reverse -341 -350 -8.06341 0.254
NP_441731.1_1 Reverse -50 -68 13.8483 0.281
NP_441731.1_9 Reverse -328 -345 15.1818 0.209
NP_441876.1_9 Forward -249 -239 11.3859 0.275
NP_441826.1_2 Reverse -308 -322 5.40779 0.0975
NP_441826.1_2 Reverse -126 -140 -0.393733 0.212
NP_441826.1_2 Forward -147 -133 -3.83532 0.288
NP_441826.1_5 Reverse -272 -291 6.4893 0.222
NP_441330.1_1 Reverse -309 -328 -13.5702 0.195
NP_442063.1_9 Forward -364 -345 2.65439 0.267
NP_442490.1_1 Reverse -204 -223 17.109 0.218
NP_442490.1_9 Reverse -302 -321 0.687771 0.167
NP_442868.1_6 Reverse -312 -322 7.94484 0.0657
NP_442868.1_6 Forward -396 -386 4.60159 0.171
NP_442868.1_6 Forward -143 -133 0.963343 0.205
NP_442868.1_6 Reverse -130 -140 0.963343 0.205
NP_442868.1_6 Forward -325 -315 0.865012 0.205
NP_442808.1_1 Reverse -131 -141 18.4657 0.00201
NP_442808.1_1 Forward -142 -132 8.73102 0.0481
NP_442808.1_1 Forward -324 -314 8.63269 0.0481
NP_441101.1_10 Forward -145 -126 -7.37537 0.29
NP_440145.1_3 Forward -151 -132 15.7324 0.0108
NP_440145.1_3 Reverse -304 -323 8.45592 0.0446
NP_441906.1_5 Forward -313 -294 8.06178 0.289
NP_442050.1_5 Reverse -312 -322 14.0409 0.0259
NP_442050.1_5 Forward -143 -133 9.22267 0.193
NP_442050.1_5 Reverse -130 -140 9.12434 0.193
NP_442342.1_9 Reverse -130 -146 8.90832 0.178
NP_440093.1_1 Reverse -285 -304 12.6841 0.28
NP_440093.1_7 Forward -82 -63 15.4374 0.158
NP_441878.1_6 Reverse -313 -323 10.5014 0.0176
NP_441878.1_6 Forward -142 -132 10.5014 0.0176
NP_441878.1_6 Reverse -131 -141 10.4031 0.0176
NP_441878.1_6 Reverse -301 -311 1.25834 0.108
NP_441878.1_6 Forward -324 -314 0.57002 0.14
NP_441878.1_6 Forward -351 -341 -0.118297 0.167
NP_441878.1_6 Reverse -340 -350 -7.19813 0.21
NP_441036.1_8 Reverse -131 -141 17.7779 0.000554
NP_441036.1_8 Forward -142 -132 15.713 0.00724
NP_441036.1_8 Forward -324 -314 13.8447 0.0353
NP_441036.1_8 Reverse -313 -323 8.1415 0.176
NP_441036.1_8 Reverse -340 -350 5.78156 0.258
NP_442650.1_2 Forward -323 -309 7.07942 0.13
NP_441557.1_5 Forward -141 -132 19.9609 0.000699
NP_441557.1_5 Reverse -132 -141 19.9609 0.000699
NP_441557.1_5 Forward -323 -314 18.6826 0.0015
NP_441557.1_5 Reverse -314 -323 10.5211 0.00695
NP_441445.1_1 Reverse -123 -142 6.98095 0.138
NP_441445.1_1 Forward -332 -313 0.491109 0.275
NP_441590.1_4 Forward -351 -332 7.4718 0.249
NP_441590.1_4 Forward -315 -296 4.91521 0.279
NP_442066.2_4 Forward -323 -304 9.53756 0.0742
NP_442066.2_4 Reverse -132 -151 0.294447 0.171
NP_441433.1_8 Forward -33 -14 -1.27885 0.258
NP_442419.1_2 Reverse -309 -328 1.67108 0.238
NP_441308.1_8 Reverse -130 -140 10.1081 0.22
NP_440101.1_3 Forward -328 -309 3.04771 0.239
NP_440101.1_10 Forward -329 -310 20.354 0.0526
NP_441458.1_10 Forward -150 -131 7.37428 0.196
NP_441458.1_10 Forward -332 -313 1.47442 0.288
NP_442183.1_1 Forward -141 -127 17.4042 0.011
NP_442183.1_1 Forward -323 -309 7.17775 0.147
NP_442183.1_9 Reverse -338 -348 9.02648 0.296
NP_442166.1_7 Reverse -133 -147 8.94771 0.21
NP_441116.1_8 Reverse -218 -237 15.9291 0.212
NP_440979.1_6 Reverse -184 -203 13.2741 0.282
NP_441574.1_1 Forward -335 -316 -2.0655 0.224
NP_440276.1_8 Reverse -9 -28 7.96426 0.27
NP_441549.1_9 Reverse -304 -322 -5.68405 0.198
NP_442347.1_2 Reverse -315 -324 11.1111 0.056
NP_442347.1_2 Forward -140 -131 11.1111 0.056
NP_442347.1_2 Reverse -133 -142 3.34298 0.284
NP_442965.1_2 Reverse -93 -112 -6.39206 0.257
NP_441037.1_4 Forward -143 -133 15.0168 0.028
NP_441037.1_4 Forward -325 -315 14.7245 0.028
NP_441037.1_4 Reverse -312 -322 9.85159 0.21
NP_441037.1_4 Reverse -130 -140 7.02532 0.237
NP_442317.1_6 Forward -146 -127 2.85105 0.268
NP_441633.1_3 Forward -325 -312 12.8023 0.0192
NP_441633.1_3 Forward -143 -130 1.29759 0.109
NP_441633.1_3 Forward -37 -24 -2.93064 0.177
NP_441633.1_3 Reverse -130 -143 -3.81562 0.177
NP_440136.1_2 Forward -322 -315 15.9687 0.0123
NP_440136.1_2 Reverse -315 -322 15.9687 0.0123
NP_440136.1_2 Forward -140 -133 15.9687 0.0123
NP_440136.1_2 Reverse -133 -140 15.9687 0.0123
NP_442998.1_5 Forward -233 -223 9.91146 0.232
NP_442998.1_5 Forward -273 -263 7.25653 0.298
NP_442998.1_10 Reverse -316 -323 15.5754 0.0102
NP_442998.1_10 Forward -139 -132 15.5754 0.0102
NP_442998.1_10 Reverse -134 -141 15.5754 0.0102
NP_442998.1_10 Forward -321 -314 5.74231 0.255
NP_440299.1_1 Forward -327 -314 16.9316 0.00805
NP_440299.1_1 Reverse -310 -323 15.1616 0.0189
NP_440299.1_1 Forward -145 -132 13.195 0.0319
NP_440299.1_1 Reverse -128 -141 8.18017 0.0964
NP_440299.1_1 Forward -297 -284 2.87033 0.269
NP_440810.1_8 Reverse -61 -80 20.0581 0.0899
NP_441799.1_1 Reverse -128 -142 13.4703 0.032
NP_441799.1_1 Forward -145 -131 12.5853 0.0421
NP_441799.1_1 Reverse -310 -324 8.25877 0.12
NP_441799.1_1 Forward -327 -313 6.19383 0.179
NP_441007.1_10 Reverse -279 -292 4.64084 0.182
NP_441007.1_10 Reverse -309 -322 2.67422 0.183
NP_442334.1_1 Reverse -302 -321 -5.40875 0.268
NP_442334.1_2 Reverse -304 -321 -13.6292 0.297
NP_442333.2_5 Reverse -303 -322 -12.9802 0.249
NP_440256.1_1 Forward -144 -125 21.3373 0.00365
NP_440256.1_1 Reverse -311 -330 -1.27885 0.102
NP_441229.1_10 Forward -151 -132 -4.42544 0.288
NP_440456.1_7 Forward -202 -188 15.8309 0.268
NP_441559.1_8 Forward -146 -132 10.6193 0.0574
NP_441559.1_8 Reverse -336 -350 9.43936 0.0645
NP_441559.1_8 Forward -222 -208 -6.39192 0.277
NP_441559.1_8 Reverse -127 -141 -6.88358 0.281
NP_441559.1_8 Reverse -337 -351 -7.47356 0.294
NP_442860.1_3 Forward -325 -306 10.5209 0.258
NP_440915.1_6 Reverse -310 -324 13.3726 0.0187
NP_440915.1_6 Forward -145 -131 3.73617 0.1
NP_440915.1_6 Forward -327 -313 0.88457 0.151
NP_440915.1_6 Forward -399 -385 -0.590395 0.202
NP_440915.1_6 Reverse -128 -142 -2.55701 0.276
NP_440915.1_6 Reverse -337 -351 -3.147 0.29
NP_440997.1_6 Reverse -146 -165 12.1925 0.228
NP_441261.1_1 Forward -358 -339 -4.42544 0.26
NP_442785.1_7 Forward -359 -345 10.521 0.228
NP_442785.1_7 Forward -143 -129 8.45605 0.297
NP_442967.1_2 Forward -356 -337 10.5209 0.254
NP_442452.1_3 Reverse -91 -110 8.16093 0.212
NP_442866.1_1 Forward -328 -309 -5.31042 0.24
NP_440026.1_7 Reverse -337 -352 13.9429 0.276
NP_440695.1_5 Reverse -120 -139 1.57275 0.282
NP_441199.1_6 Reverse -128 -147 2.26107 0.198
NP_441199.1_6 Forward -327 -308 1.17943 0.224
NP_441494.1_6 Reverse -309 -322 19.4888 0.057
NP_441494.1_6 Forward -399 -386 7.09911 0.267
NP_442993.1_1 Forward -323 -307 -7.11963 0.146
NP_442993.1_1 Forward -141 -125 -7.80794 0.146
NP_442993.1_1 Forward -394 -378 -9.28291 0.181
NP_442993.1_1 Forward -260 -244 -9.87289 0.197
NP_442386.1_9 Reverse -131 -140 15.7322 0.0144
NP_442386.1_9 Forward -324 -315 15.7322 0.0144
NP_442386.1_9 Reverse -313 -322 7.37413 0.219
NP_442386.1_9 Forward -142 -133 6.39082 0.219
NP_441750.1_1 Forward -286 -267 -11.7019 0.3
NP_441750.1_1 Reverse -293 -312 -13.3736 0.3
NP_441340.1_5 Forward -322 -315 15.6737 0.0124
NP_441340.1_5 Reverse -315 -322 15.6737 0.0124
NP_441340.1_5 Forward -140 -133 15.6737 0.0124
NP_441340.1_5 Reverse -133 -140 15.6737 0.0124
NP_441947.1_4 Reverse -121 -140 14.6508 0.168
NP_442484.1_2 Forward -334 -315 2.55606 0.224
NP_442791.1_5 Forward -331 -312 -9.24366 0.279
NP_442240.1_2 Reverse -133 -152 -10.1286 0.137
NP_442240.1_2 Forward -322 -303 -20.7484 0.295
NP_440161.1_3 Reverse -312 -331 7.37428 0.299
NP_440161.1_3 Reverse -130 -149 7.27595 0.299
NP_440586.1_1 Reverse -280 -299 -0.0988766 0.237
NP_440586.1_8 Forward -322 -315 13.2151 0.026
NP_440586.1_8 Forward -140 -133 13.2151 0.026
NP_440586.1_8 Reverse -315 -322 13.2151 0.026
NP_440586.1_8 Reverse -133 -140 13.2151 0.026
NP_442251.1_6 Forward -322 -315 15.2804 0.0124
NP_442251.1_6 Reverse -315 -322 15.2804 0.0124
NP_442251.1_6 Forward -140 -133 15.2804 0.0124
NP_442251.1_6 Reverse -133 -140 15.2804 0.0124
NP_440192.1_5 Reverse -283 -302 14.9458 0.116
NP_440684.1_9 Reverse -126 -140 7.66941 0.256
NP_440684.1_9 Forward -329 -315 6.58777 0.298
NP_441262.1_3 Reverse -132 -139 14.7888 0.0223
NP_441262.1_3 Forward -323 -316 14.7888 0.0223
NP_441262.1_3 Forward -141 -134 14.7888 0.0223
NP_441262.1_3 Reverse -314 -321 13.9038 0.0336
NP_440027.1_3 Forward -350 -332 7.29487 0.211
NP_440027.1_3 Forward -356 -338 5.22993 0.245
NP_443051.1_1 Forward -142 -133 19.5676 0.00335
NP_443051.1_1 Reverse -131 -140 10.4228 0.00754
NP_443051.1_1 Forward -324 -315 10.4228 0.00754
NP_443051.1_1 Reverse -313 -322 8.75118 0.027
NP_441232.1_10 Forward -334 -315 9.73422 0.133
NP_441232.1_10 Reverse -121 -140 3.04771 0.236
NP_439937.1_9 Reverse -207 -224 -5.66502 0.157
NP_439937.1_9 Forward -142 -125 -6.74666 0.157
NP_439937.1_9 Forward -351 -334 -8.31994 0.176
NP_439937.1_9 Reverse -131 -148 -8.61494 0.176
NP_441595.1_5 Reverse -307 -325 9.75391 0.217
NP_440626.1_1 Reverse -315 -334 16.2232 0.124
NP_440439.1_1 Reverse -129 -142 17.5222 0.0105
NP_440439.1_1 Forward -144 -131 9.2624 0.0465
NP_440439.1_1 Forward -326 -313 3.95252 0.108
NP_440439.1_1 Reverse -338 -351 3.46087 0.114
NP_440439.1_1 Reverse -311 -324 -1.06236 0.249
NP_439943.1_1 Reverse -263 -282 -0.000545616 0.19
NP_440372.1_2 Forward -322 -315 16.3621 0.0124
NP_440372.1_2 Reverse -315 -322 16.3621 0.0124
NP_440372.1_2 Forward -140 -133 16.3621 0.0124
NP_440372.1_2 Reverse -133 -140 16.3621 0.0124
NP_440171.1_3 Forward -25 -6 2.94938 0.284
NP_441181.1_6 Reverse -315 -333 6.11567 0.219
NP_441803.1_2 Reverse -380 -399 -1.18052 0.294
NP_439977.1_5 Forward -329 -310 5.70265 0.146
NP_440139.1_1 Forward -329 -310 15.1416 0.0474
NP_440139.1_1 Reverse -126 -145 7.96345 0.12
NP_441572.1_7 Reverse -308 -327 8.06259 0.0744
NP_441572.1_7 Forward -363 -344 -0.688862 0.182
NP_442384.1_10 Reverse -132 -145 15.4572 0.00986
NP_442384.1_10 Reverse -314 -327 14.5723 0.0144
NP_442384.1_10 Forward -141 -128 8.37742 0.0656
NP_442384.1_10 Forward -323 -310 2.08423 0.237
NP_442114.1_4 Reverse -314 -325 10.4818 0.17
NP_442790.1_4 Reverse -305 -324 -9.047 0.179
NP_442790.1_4 Reverse -123 -142 -15.7335 0.297
NP_442262.1_10 Forward -322 -315 14.1988 0.0123
NP_442262.1_10 Reverse -315 -322 14.1988 0.0123
NP_442262.1_10 Forward -140 -133 14.1988 0.0123
NP_442262.1_10 Reverse -133 -140 14.1988 0.0123
NP_441689.1_5 Reverse -130 -140 8.53436 0.132
NP_441689.1_5 Forward -143 -133 8.3377 0.132
NP_440344.1_10 Reverse -125 -142 1.8088 0.0294
NP_440344.1_10 Forward -148 -131 -0.256152 0.0402
NP_440344.1_10 Reverse -307 -324 -9.99092 0.163
NP_440344.1_10 Forward -330 -313 -11.9575 0.235
NP_441060.1_3 Reverse -334 -353 17.109 0.184
NP_441965.1_10 Reverse -129 -145 11.6616 0.107
NP_440297.1_9 Forward -140 -130 9.32148 0.0917
NP_440297.1_9 Forward -322 -312 0.963343 0.282
NP_440297.1_9 Reverse -315 -325 -0.118297 0.282
NP_440297.1_9 Reverse -133 -143 -0.216628 0.282
NP_442280.1_10 Forward -110 -92 5.45442 0.284
NP_442280.1_10 Reverse -227 -245 4.96742 0.291
NP_441592.1_4 Forward -323 -304 -1.47551 0.254
NP_441896.1_2 Forward -328 -309 22.3206 0.0636
NP_440999.1_9 Reverse -310 -324 4.22782 0.116
NP_440999.1_9 Forward -297 -283 1.08123 0.171
NP_440999.1_9 Reverse -128 -142 0.0979218 0.193
NP_440888.1_2 Forward -141 -127 14.2569 0.0193
NP_440888.1_2 Forward -350 -336 11.5037 0.0657
NP_440888.1_2 Reverse -314 -328 8.06211 0.172
NP_440888.1_2 Reverse -132 -146 7.17714 0.205
NP_440600.1_4 Forward -149 -131 -4.50408 0.262
NP_440491.1_1 Reverse -311 -330 7.30684 0.273
NP_440052.1_5 Forward -334 -315 8.75091 0.095
NP_440052.1_5 Reverse -273 -292 -3.3438 0.234
NP_442948.1_2 Forward -142 -123 15.7324 0.105
NP_442033.1_10 Reverse -130 -149 2.75272 0.0882
NP_442033.1_10 Forward -325 -306 -5.9004 0.181
NP_442033.1_10 Reverse -302 -321 -8.85033 0.207
NP_440575.1_8 Reverse -59 -78 -0.4922 0.193
NP_440575.1_8 Forward -374 -355 -4.32711 0.265
NP_441759.1_2 Reverse -124 -143 -0.000545616 0.249
NP_441543.1_2 Forward -140 -131 18.486 0.00236
NP_441543.1_2 Reverse -315 -324 18.486 0.00236
NP_441543.1_2 Reverse -133 -142 15.9293 0.00518
NP_441543.1_2 Forward -322 -313 6.29291 0.153
NP_442845.1_2 Reverse -308 -322 8.75105 0.187
NP_441551.1_5 Reverse -128 -144 10.0876 0.199
NP_441178.1_6 Forward -303 -284 4.22689 0.269
NP_441469.1_8 Reverse -131 -140 16.126 0.00797
NP_441469.1_8 Forward -324 -315 16.126 0.00797
NP_441469.1_8 Forward -142 -133 6.5879 0.227
NP_441469.1_8 Reverse -313 -322 5.3096 0.277
NP_443064.1_5 Reverse -309 -328 17.3433 0.243
NP_443064.1_6 Reverse -132 -142 10.8217 0.13
NP_443064.1_6 Forward -323 -313 10.2399 0.166
NP_443064.1_7 Forward -53 -34 15.3186 0.262
NP_442337.1_8 Forward -215 -196 0.294447 0.255
NP_442578.1_7 Forward -322 -315 14.5921 0.026
NP_442578.1_7 Forward -140 -133 14.5921 0.026
NP_442578.1_7 Reverse -315 -322 14.5921 0.026
NP_442578.1_7 Reverse -133 -140 14.5921 0.026
NP_440710.1_1 Forward -331 -313 -8.14232 0.257
NP_441462.1_2 Reverse -132 -142 20.2362 0.000805
NP_441462.1_2 Forward -323 -313 19.1546 0.00206
NP_441462.1_2 Forward -141 -131 11.5831 0.00406
NP_441462.1_2 Reverse -314 -324 1.84832 0.081
NP_441621.1_7 Reverse -130 -144 4.32615 0.0934
NP_441621.1_7 Forward -325 -311 -1.47537 0.18
NP_441621.1_7 Reverse -312 -326 -3.147 0.188
NP_441929.1_3 Forward -72 -53 0.786102 0.298
NP_443062.1_1 Forward -141 -123 12.1537 0.0851
NP_443062.1_1 Reverse -132 -150 9.13097 0.14
NP_443062.1_6 Forward -331 -312 2.26107 0.258
NP_443062.1_6 Forward -149 -130 1.27776 0.276
NP_442204.1_1 Forward -145 -134 18.2499 0.0189
NP_442204.1_1 Forward -361 -350 -0.0396598 0.285
NP_442204.1_5 Reverse -304 -323 2.0644 0.22
NP_442204.1_6 Reverse -328 -347 4.03102 0.297
NP_440516.1_2 Forward -147 -129 4.54237 0.138
NP_440516.1_8 Forward -141 -132 16.9127 0.00442
NP_440516.1_8 Reverse -132 -141 16.9127 0.00442
NP_440516.1_8 Forward -323 -314 9.4395 0.0183
NP_440516.1_8 Reverse -314 -323 7.17789 0.0754
NP_442080.1_7 Forward -146 -127 6.09597 0.122
NP_442428.1_5 Forward -322 -315 15.8704 0.0124
NP_442428.1_5 Reverse -315 -322 15.8704 0.0124
NP_442428.1_5 Forward -140 -133 15.8704 0.0124
NP_442428.1_5 Reverse -133 -140 15.8704 0.0124
NP_441443.1_2 Forward -331 -312 -2.95047 0.26
NP_442859.1_2 Forward -322 -303 6.68596 0.199
NP_442120.1_10 Reverse -126 -145 -16.2252 0.297
NP_440673.1_2 Forward -58 -39 10.9749 0.19
NP_440673.1_3 Forward -321 -314 14.0021 0.0426
NP_440673.1_3 Forward -139 -132 12.4288 0.0426
NP_440673.1_3 Reverse -316 -323 12.4288 0.0426
NP_440673.1_3 Reverse -134 -141 12.4288 0.0426
NP_440077.1_7 Reverse -301 -320 12.4875 0.268
NP_440865.1_9 Reverse -379 -398 -3.14714 0.191
NP_440865.1_9 Reverse -126 -145 -9.047 0.273
NP_440865.1_9 Reverse -308 -327 -9.24366 0.282
NP_441052.1_2 Forward -141 -131 10.5014 0.0285
NP_441052.1_2 Reverse -132 -142 10.4031 0.0285
NP_441052.1_2 Reverse -314 -324 2.04498 0.22
NP_441052.1_2 Forward -323 -313 0.57002 0.256
NP_440992.1_2 Reverse -309 -328 9.43923 0.273
NP_442219.1_9 Forward -322 -313 8.94785 0.0681
NP_442219.1_9 Reverse -315 -324 8.35786 0.0681
NP_442219.1_9 Forward -140 -131 8.35786 0.0681
NP_442219.1_9 Reverse -133 -142 8.25953 0.0681
NP_440436.1_4 Forward -140 -131 18.1905 0.00233
NP_440436.1_4 Reverse -315 -324 18.1905 0.00233
NP_440436.1_4 Forward -322 -313 14.6506 0.0111
NP_440436.1_4 Reverse -133 -142 9.24241 0.0871
NP_441884.1_8 Reverse -131 -150 -0.39387 0.138
NP_441884.1_8 Forward -324 -305 -7.57203 0.254
NP_440314.1_9 Forward -322 -303 -7.08038 0.237
NP_442907.1_9 Reverse -309 -328 4.12936 0.171
NP_441719.1_4 Forward -322 -315 16.3621 0.0124
NP_441719.1_4 Reverse -315 -322 16.3621 0.0124
NP_441719.1_4 Forward -140 -133 16.3621 0.0124
NP_441719.1_4 Reverse -133 -140 16.3621 0.0124
NP_441733.1_10 Reverse -311 -324 15.0639 0.0646
NP_441733.1_10 Forward -326 -313 6.90245 0.166
NP_441733.1_10 Forward -144 -131 5.82081 0.203
NP_441004.1_1 Reverse -278 -297 -11.0136 0.231
NP_441004.1_1 Reverse -93 -112 -12.0953 0.244
NP_441004.1_1 Reverse -308 -327 -17.7001 0.294
NP_442366.1_3 Reverse -131 -149 6.70565 0.0773
NP_442366.1_3 Reverse -313 -331 -3.22577 0.244
NP_442366.1_3 Forward -324 -306 -4.99573 0.28
NP_442366.1_5 Forward -144 -134 14.0409 0.0497
NP_442366.1_5 Forward -326 -316 13.3526 0.0775
NP_442366.1_5 Forward -353 -343 10.796 0.233
NP_442873.1_5 Forward -291 -272 10.2251 0.248
NP_442873.1_5 Reverse -19 -38 9.14342 0.25
NP_442873.1_5 Forward -345 -326 7.27514 0.278
NP_440296.1_10 Reverse -311 -330 -13.9635 0.269
NP_441115.1_4 Reverse -131 -149 18.8979 0.0117
NP_441115.1_4 Forward -324 -306 8.17984 0.257
NP_442694.1_9 Reverse -67 -86 9.53756 0.244
NP_442206.1_10 Reverse -132 -147 1.55319 0.226
NP_440328.1_8 Forward -353 -334 19.2773 0.249
NP_443054.1_2 Reverse -339 -353 12.291 0.0722
NP_443054.1_2 Forward -399 -385 3.34284 0.24
NP_443054.1_2 Reverse -384 -398 2.5562 0.244
NP_443054.1_2 Reverse -130 -144 1.76955 0.245
NP_440508.1_4 Forward -363 -344 11.2092 0.256
NP_440508.1_4 Forward -264 -245 11.2092 0.256
NP_441851.1_10 Forward -324 -314 17.188 0.00552
NP_441851.1_10 Reverse -131 -141 16.008 0.00552
NP_441851.1_10 Forward -142 -132 8.53483 0.114
NP_441851.1_10 Reverse -313 -323 8.23984 0.12
NP_442208.1_5 Reverse -299 -318 -6.68705 0.269
NP_442814.1_3 Reverse -203 -221 20.3737 0.0635
NP_442814.1_10 Reverse -78 -97 4.12936 0.269
NP_441157.1_1 Reverse -114 -128 5.60385 0.235
NP_442622.1_1 Forward -142 -123 -12.2919 0.262
NP_442622.1_8 Forward -398 -380 -18.4671 0.222
NP_442011.1_1 Forward -324 -305 12.6841 0.16
NP_441668.1_5 Forward -241 -222 6.29264 0.288
NP_442515.1_1 Forward -142 -128 1.17956 0.168
NP_441396.1_5 Reverse -103 -112 8.75118 0.21
NP_440593.1_3 Forward -328 -309 1.27776 0.19
NP_440593.1_3 Reverse -279 -298 -5.40875 0.259
NP_440593.1_3 Reverse -309 -328 -5.60541 0.264
NP_440165.1_5 Forward -324 -305 1.47442 0.126
NP_440165.1_5 Reverse -131 -150 -8.35868 0.298
NP_440940.1_7 Reverse -304 -322 4.14829 0.261
NP_441349.1_10 Forward -151 -132 6.09597 0.0384
NP_441349.1_10 Reverse -122 -141 2.65439 0.0738
NP_442024.1_4 Forward -316 -297 11.3075 0.199
NP_442024.1_4 Reverse -123 -142 8.84924 0.29
NP_441409.1_6 Forward -147 -128 -6.98204 0.14
NP_441409.1_6 Reverse -126 -145 -14.8485 0.269
NP_440474.1_8 Forward -140 -126 11.012 0.119
NP_440474.1_8 Reverse -315 -329 9.53707 0.16
NP_440431.1_3 Forward -229 -210 -5.80207 0.185
NP_442450.1_5 Reverse -130 -140 9.32148 0.115
NP_442450.1_5 Forward -143 -133 7.64985 0.13
NP_442450.1_5 Forward -325 -315 7.55152 0.13
NP_442168.1_5 Reverse -315 -334 -2.65548 0.264
NP_440588.1_2 Forward -150 -131 5.11266 0.0712
NP_442006.1_2 Forward -35 -18 -13.7275 0.197
NP_442006.1_2 Reverse -152 -169 -16.7758 0.264
NP_442006.1_2 Reverse -123 -140 -17.1691 0.27
NP_442243.1_1 Forward -246 -228 -3.02983 0.298
NP_441570.1_1 Reverse -132 -150 -7.06068 0.0841
NP_441570.1_1 Forward -141 -123 -8.04399 0.101
NP_441570.1_1 Reverse -321 -339 -8.53565 0.115
NP_441570.1_1 Forward -323 -305 -17.2871 0.269
NP_440078.1_10 Forward -323 -304 8.55425 0.208
NP_441078.1_4 Forward -141 -132 19.6659 0.0007
NP_441078.1_4 Reverse -132 -141 19.6659 0.0007
NP_441078.1_4 Reverse -314 -323 9.93116 0.0203
NP_441078.1_4 Forward -323 -314 9.83282 0.0226
NP_441078.1_4 Reverse -341 -350 -1.77023 0.266
NP_441078.1_4 Forward -350 -341 -1.77023 0.266
NP_442729.1_8 Reverse -310 -323 5.91914 0.223
NP_442388.1_3 Reverse -324 -343 5.99764 0.282
NP_442443.1_1 Forward -365 -346 5.60432 0.157
NP_442443.1_1 Reverse -306 -325 -6.09707 0.293
NP_440526.1_3 Forward -322 -311 9.10461 0.0988
NP_441432.1_8 Forward -142 -133 16.8143 0.00595
NP_441432.1_8 Reverse -131 -140 8.25953 0.0755
NP_441432.1_8 Forward -324 -315 8.25953 0.0755
NP_441432.1_9 Reverse -4 -17 9.08315 0.282
NP_442320.1_8 Reverse -126 -140 13.9626 0.0144
NP_442320.1_8 Reverse -308 -322 -1.18038 0.0817
NP_442320.1_8 Forward -329 -315 -1.27871 0.0817
NP_442320.1_8 Reverse -278 -292 -5.9986 0.261
NP_441732.1_2 Forward -145 -129 11.7599 0.00594
NP_441732.1_2 Reverse -128 -144 -17.2477 0.247
NP_440629.1_6 Forward -147 -128 16.1163 0.105
NP_440760.1_1 Forward -323 -304 -21.9284 0.246
NP_440760.1_1 Reverse -314 -333 -23.1083 0.283
NP_442797.1_1 Forward -321 -302 -4.81876 0.286
NP_440199.1_10 Reverse -129 -139 13.2547 0.108
NP_441057.1_4 Reverse -268 -286 2.37909 0.253
NP_440913.1_1 Reverse -267 -285 15.5554 0.103
NP_441072.1_2 Reverse -303 -322 8.45592 0.24
NP_440713.1_4 Reverse -304 -323 3.73603 0.239
NP_440713.1_4 Forward -151 -132 1.0811 0.294
NP_442489.1_7 Forward -141 -132 20.1576 0.000695
NP_442489.1_7 Reverse -132 -141 20.1576 0.000695
NP_442489.1_7 Reverse -314 -323 10.4228 0.0151
NP_442489.1_7 Forward -323 -314 10.3245 0.0193
NP_442489.1_7 Reverse -341 -350 -1.27858 0.185
NP_440565.1_7 Reverse -304 -323 0.392778 0.249
NP_442079.1_7 Reverse -133 -152 8.16093 0.125
NP_442079.1_7 Forward -140 -121 1.17943 0.26
NP_440559.1_1 Forward -322 -313 17.4043 0.00658
NP_440559.1_1 Reverse -315 -324 8.75118 0.0586
NP_440559.1_1 Forward -140 -131 8.75118 0.0586
NP_440559.1_1 Reverse -133 -142 8.65285 0.0586
NP_441659.2_8 Reverse -132 -142 20.9245 0.000805
NP_441659.2_8 Forward -141 -131 11.9764 0.0147
NP_441659.2_8 Forward -323 -313 9.7148 0.0271
NP_441659.2_8 Reverse -314 -324 9.7148 0.0271
NP_441022.1_1 Reverse -59 -68 13.2728 0.216
NP_441040.1_2 Reverse -276 -295 -15.7335 0.286
NP_441040.1_5 Forward -328 -309 4.71934 0.245
NP_442008.1_2 Forward -144 -125 2.94938 0.27
NP_441800.1_7 Forward -301 -283 -0.177514 0.222
NP_440779.1_5 Reverse -314 -331 -14.4158 0.246
NP_442346.1_2 Reverse -303 -322 11.0125 0.216
NP_442346.1_5 Forward -142 -132 16.303 0.00248
NP_442346.1_5 Reverse -313 -323 15.8113 0.0045
NP_442346.1_5 Reverse -131 -141 9.02648 0.118
NP_442346.1_5 Forward -324 -314 8.53483 0.133
NP_440352.1_5 Forward -82 -63 13.5318 0.186
NP_440545.1_3 Forward -145 -128 12.2319 0.0214
NP_440545.1_3 Forward -327 -310 -0.0594896 0.147
NP_440545.1_3 Reverse -128 -145 -0.452814 0.154
NP_440545.1_3 Forward -354 -337 -2.3211 0.183
NP_440545.1_3 Reverse -310 -327 -2.71443 0.191
NP_441856.1_3 Reverse -129 -148 1.17943 0.213
NP_440025.1_4 Forward -171 -152 15.3391 0.222
NP_440831.1_3 Reverse -305 -324 15.3182 0.106
NP_441629.1_1 Forward -358 -339 7.07928 0.253
NP_440459.1_3 Forward -81 -62 13.7658 0.105
NP_440010.1_1 Reverse -285 -304 10.0292 0.196
NP_440010.1_4 Reverse -116 -135 -0.197979 0.25
NP_442603.1_7 Forward -323 -309 7.27547 0.211
NP_442603.1_7 Forward -42 -28 6.48882 0.24
NP_441888.1_7 Reverse -127 -141 3.93283 0.225
NP_441948.1_4 Forward -330 -312 -0.472507 0.139
NP_441948.1_4 Forward -148 -130 -0.570838 0.139
NP_441833.1_4 Forward -322 -315 15.9687 0.0124
NP_441833.1_4 Reverse -315 -322 15.9687 0.0124
NP_441833.1_4 Forward -140 -133 15.9687 0.0124
NP_441833.1_4 Reverse -133 -140 15.9687 0.0124
NP_441329.1_6 Forward -231 -212 2.91208 0.217
NP_441895.1_2 Forward -26 -7 -26.9432 0.275
NP_442060.1_10 Reverse -340 -359 9.63589 0.25
NP_442162.1_9 Forward -322 -315 16.2637 0.0124
NP_442162.1_9 Reverse -315 -322 16.2637 0.0124
NP_442162.1_9 Forward -140 -133 16.2637 0.0124
NP_442162.1_9 Reverse -133 -140 16.2637 0.0124
NP_440671.1_4 Reverse -308 -322 10.3243 0.161
NP_440671.1_4 Reverse -126 -140 8.65272 0.193
NP_440671.1_4 Forward -147 -133 7.86607 0.207
NP_440224.1_4 Reverse -262 -281 5.01433 0.225
NP_442199.1_5 Reverse -124 -143 3.6377 0.12
NP_442140.1_3 Reverse -315 -325 16.2046 0.0255
NP_442140.1_3 Forward -322 -312 14.533 0.0486
NP_442140.1_3 Forward -140 -130 8.33817 0.119
NP_442140.1_3 Reverse -133 -143 6.66654 0.159
NP_442140.1_3 Reverse -285 -295 5.28991 0.216
NP_442723.1_1 Forward -65 -46 4.32522 0.276
NP_442021.1_3 Forward -329 -310 3.34271 0.168
NP_442778.1_7 Forward -325 -306 20.3531 0.183
NP_440875.1_9 Reverse -134 -144 8.37203 0.233
NP_441813.1_5 Reverse -130 -140 17.188 0.00979
NP_441813.1_5 Forward -325 -315 9.91146 0.021
NP_441813.1_5 Forward -143 -133 8.63316 0.0367
NP_441813.1_5 Reverse -312 -322 8.1415 0.0478
NP_440590.1_4 Reverse -315 -328 8.47575 0.0446
NP_440590.1_4 Reverse -133 -146 4.54251 0.0601
NP_440590.1_4 Forward -292 -279 -2.73398 0.249
NP_440590.1_4 Forward -140 -127 -3.52063 0.255
NP_440590.1_4 Forward -322 -309 -5.38892 0.277
NP_440567.1_1 Reverse -315 -329 17.2075 0.0153
NP_440567.1_1 Forward -322 -308 16.8142 0.0165
NP_440567.1_1 Forward -140 -126 8.94771 0.0517
NP_442497.1_10 Forward -322 -313 17.9943 0.00813
NP_442497.1_10 Reverse -133 -142 17.601 0.00813
NP_442497.1_10 Forward -140 -131 10.4228 0.0087
NP_442497.1_10 Reverse -315 -324 10.4228 0.0087
NP_440821.1_4 Reverse -130 -140 19.0562 0.00399
NP_440821.1_4 Reverse -312 -322 10.7964 0.0146
NP_440821.1_4 Forward -325 -315 10.2065 0.0163
NP_440821.1_4 Forward -143 -133 2.24165 0.131
NP_441239.1_9 Reverse -312 -324 15.4769 0.0197
NP_441239.1_9 Forward -143 -131 13.707 0.0355
NP_441239.1_9 Reverse -130 -142 13.3137 0.037
NP_441239.1_9 Forward -325 -313 11.7404 0.0551
NP_441239.1_9 Forward -37 -25 4.95553 0.234
NP_441239.1_9 Reverse -339 -351 4.46387 0.253
NP_441727.1_3 Reverse -319 -338 2.85105 0.299
NP_440400.1_1 Forward -302 -283 7.27514 0.22
NP_441892.1_1 Reverse -305 -322 15.9685 0.0286
NP_441892.1_1 Forward -150 -133 8.88863 0.0757
NP_440604.1_6 Reverse -132 -151 -4.42544 0.249
NP_440604.1_6 Forward -323 -304 -5.60541 0.282
NP_442643.1_1 Reverse -126 -145 -1.7705 0.143
NP_442643.1_1 Forward -329 -310 -1.86883 0.143
NP_440863.1_1 Reverse -55 -69 13.3215 0.263
NP_440354.1_7 Forward -176 -158 11.1305 0.224
NP_440354.1_7 Reverse -308 -326 6.80398 0.278
NP_442052.1_8 Forward -352 -342 12.0747 0.287
NP_440546.1_4 Forward -323 -313 14.5061 0.0459
NP_440546.1_4 Reverse -132 -142 13.5365 0.0459
NP_440546.1_4 Reverse -314 -324 12.6639 0.0641
NP_440546.1_4 Forward -141 -131 11.8882 0.0679
NP_440546.1_4 Reverse -348 -358 6.65249 0.288
NP_440462.1_6 Reverse -130 -140 15.418 0.0142
NP_440462.1_6 Forward -143 -133 10.5014 0.0396
NP_440462.1_6 Reverse -312 -322 9.7148 0.0429
NP_440462.1_6 Forward -325 -315 9.02648 0.0498
NP_440868.1_4 Reverse -128 -140 18.0335 0.0124
NP_440868.1_4 Forward -327 -315 8.6921 0.0582
NP_440868.1_4 Forward -145 -133 6.1355 0.0878
NP_442499.1_3 Forward -324 -306 12.1139 0.199
NP_442402.1_1 Reverse -5 -24 24.2872 0.00887
NP_442402.1_2 Reverse -10 -24 16.0269 0.263
NP_442402.1_4 Reverse -5 -24 3.63691 0.15
NP_442402.1_4 Forward -128 -109 -9.73604 0.292
NP_442402.1_6 Forward -25 -16 16.0277 0.241
NP_440036.1_1 Reverse -22 -41 13.4708 0.238
NP_441848.1_7 Reverse -220 -239 1.08032 0.228
NP_441848.1_7 Forward -69 -50 -0.197979 0.235
NP_441084.1_6 Reverse -312 -326 14.5798 0.0972
NP_440843.1_3 Reverse -330 -349 8.45592 0.29
NP_442039.1_4 Forward -322 -315 15.1821 0.0124
NP_442039.1_4 Reverse -315 -322 15.1821 0.0124
NP_442039.1_4 Forward -140 -133 15.1821 0.0124
NP_442039.1_4 Reverse -133 -140 15.1821 0.0124
NP_441811.1_1 Reverse -10 -29 5.11266 0.28
NP_441811.1_8 Reverse -308 -322 9.93102 0.224
NP_441811.1_8 Forward -166 -152 6.48943 0.272
NP_442679.1_2 Forward -24 -5 7.27595 0.279
NP_440825.1_7 Reverse -315 -325 12.4217 0.155
NP_440825.1_7 Forward -322 -312 11.4458 0.239
NP_442837.1_3 Forward -322 -315 15.7721 0.0124
NP_442837.1_3 Reverse -315 -322 15.7721 0.0124
NP_442837.1_3 Forward -140 -133 15.7721 0.0124
NP_442837.1_3 Reverse -133 -140 15.7721 0.0124
NP_440160.1_2 Forward -352 -333 -8.85033 0.291
NP_442053.1_1 Forward -141 -132 18.3876 0.0007
NP_442053.1_1 Reverse -132 -141 18.3876 0.0007
NP_442053.1_1 Forward -323 -314 9.24284 0.068
NP_442053.1_1 Reverse -314 -323 8.94785 0.07
NP_440505.1_3 Reverse -130 -140 13.8447 0.0247
NP_440505.1_3 Forward -143 -133 8.04317 0.147
NP_440505.1_3 Forward -325 -315 6.76487 0.169
NP_441203.1_1 Forward -322 -303 -5.01543 0.0882
NP_441203.1_2 Reverse -269 -288 -4.81876 0.249
NP_442532.1_7 Forward -141 -127 3.44117 0.197
NP_440914.1_1 Reverse -132 -142 16.3248 0.00196
NP_440914.1_1 Forward -141 -131 8.6151 0.186
NP_440914.1_1 Reverse -314 -324 7.34642 0.241
NP_440914.1_1 Reverse -321 -331 6.46809 0.279
NP_441011.1_8 Forward -140 -131 16.9127 0.00602
NP_441011.1_8 Reverse -315 -324 16.9127 0.00602
NP_441011.1_8 Reverse -133 -142 16.6177 0.00602
NP_441011.1_8 Forward -322 -313 15.6344 0.00738
NP_441011.1_8 Reverse -245 -254 5.60459 0.247
NP_442101.1_10 Forward -149 -130 -6.68705 0.196
NP_440724.1_10 Reverse -302 -321 15.4374 0.222
NP_442533.1_1 Reverse -284 -303 -11.1119 0.236
NP_442533.1_6 Forward -141 -132 17.2076 0.00137
NP_442533.1_6 Reverse -132 -141 17.2076 0.00137
NP_442533.1_6 Forward -323 -314 15.1427 0.00675
NP_442533.1_6 Forward -350 -341 7.47288 0.0898
NP_442533.1_6 Reverse -314 -323 7.47288 0.0898
NP_442533.1_6 Reverse -341 -350 3.83464 0.202
NP_442533.1_6 Forward -311 -302 2.94966 0.232
NP_442232.1_3 Reverse -306 -325 5.99764 0.0823
NP_442232.1_3 Forward -149 -130 -15.0452 0.288
NP_442229.1_1 Forward -325 -311 10.8154 0.18
NP_443016.1_1 Forward -329 -310 -2.65548 0.225
NP_441482.1_7 Forward -147 -133 8.55439 0.0162
NP_441482.1_7 Reverse -308 -322 0.786239 0.0554
NP_441482.1_7 Forward -329 -315 -10.7185 0.213
NP_441482.1_7 Reverse -126 -140 -10.9151 0.222
NP_439944.1_9 Forward -322 -312 15.8113 0.0144
NP_439944.1_9 Forward -140 -130 10.3048 0.0887
NP_439944.1_9 Reverse -133 -143 9.12481 0.1
NP_440816.1_2 Forward -22 -3 6.33814 0.281
NP_441028.1_6 Reverse -4 -14 7.35439 0.229
NP_441028.1_6 Reverse -14 -24 4.89613 0.275
NP_441028.1_6 Reverse -66 -76 3.42118 0.296
NP_440116.1_8 Reverse -133 -152 -3.04881 0.145
NP_440115.1_6 Reverse -311 -321 17.9746 0.0163
NP_440115.1_6 Forward -144 -134 7.35486 0.147
NP_439965.1_1 Forward -332 -313 -9.44032 0.288
NP_441602.1_3 Forward -328 -309 5.01433 0.145
NP_441972.1_5 Reverse -315 -334 -5.01543 0.213
NP_441106.1_1 Forward -142 -133 18.486 0.0028
NP_441106.1_1 Reverse -131 -140 18.191 0.0028
NP_441106.1_1 Forward -324 -315 18.191 0.0028
NP_441106.1_1 Reverse -313 -322 8.84951 0.0431
NP_440429.1_2 Reverse -315 -334 8.45592 0.272
NP_442306.1_10 Forward -146 -127 -19.9617 0.201
NP_441286.1_1 Forward -324 -312 5.44718 0.0259
NP_441286.1_1 Forward -142 -130 5.05386 0.0259
NP_441286.1_1 Reverse -131 -143 -3.59927 0.145
NP_440670.1_8 Forward -141 -132 18.3876 0.000699
NP_440670.1_8 Reverse -132 -141 18.3876 0.000699
NP_440670.1_8 Forward -323 -314 8.94785 0.0606
NP_440670.1_8 Reverse -314 -323 8.84951 0.0606
NP_441930.1_1 Forward -145 -126 5.80098 0.266
NP_440886.1_7 Reverse -131 -141 17.7774 0.0011
NP_440886.1_7 Forward -324 -314 8.43603 0.0805
NP_440886.1_7 Forward -142 -132 8.04271 0.0805
NP_440886.1_7 Reverse -74 -84 7.15773 0.103
NP_440886.1_7 Forward -351 -341 4.10949 0.253
NP_440828.1_1 Forward -294 -275 4.81688 0.207
NP_442614.1_2 Forward -323 -309 8.25939 0.255
NP_442382.1_9 Reverse -176 -195 9.14342 0.281
NP_442213.1_5 Reverse -330 -349 -0.4922 0.291
NP_441069.1_5 Reverse -322 -340 1.98577 0.236
NP_440907.2_8 Forward -322 -312 16.5975 0.0115
NP_440907.2_8 Reverse -133 -143 15.9091 0.0161
NP_440907.2_8 Reverse -315 -325 14.2375 0.0312
NP_440907.2_8 Forward -140 -130 7.84605 0.117
NP_442264.1_2 Reverse -304 -321 5.54538 0.275
NP_441021.1_1 Forward -322 -303 2.16274 0.083
NP_441021.1_1 Reverse -315 -334 -8.06369 0.193
NP_441463.1_3 Reverse -122 -141 19.6656 0.00847
NP_441626.1_2 Forward -322 -315 15.7721 0.0124
NP_441626.1_2 Reverse -315 -322 15.7721 0.0124
NP_441626.1_2 Forward -140 -133 15.7721 0.0124
NP_441626.1_2 Reverse -133 -140 15.7721 0.0124
NP_442365.1_5 Forward -322 -303 15.6341 0.0883
NP_442365.1_7 Reverse -310 -329 -5.70374 0.277
NP_441589.1_3 Reverse -382 -396 19.3708 0.15
NP_442794.1_1 Forward -145 -133 12.527 0.0721
NP_442615.1_1 Forward -332 -314 8.67227 0.0275
NP_442615.1_1 Forward -150 -132 7.29564 0.0322
NP_442615.1_1 Reverse -305 -323 4.6407 0.0444
NP_441962.1_4 Reverse -309 -328 -0.688862 0.117
NP_441962.1_4 Reverse -279 -298 -11.8003 0.245
NP_440387.1_1 Forward -323 -307 6.54838 0.0282
NP_440387.1_1 Reverse -314 -330 5.56507 0.0315
NP_440387.1_1 Reverse -132 -148 5.07341 0.0353
NP_440387.1_1 Forward -141 -125 -1.02311 0.142
NP_440855.1_5 Forward -319 -300 7.66846 0.285
NP_441431.1_2 Reverse -311 -325 20.1568 0.00685
NP_441431.1_2 Reverse -129 -143 11.5037 0.136
NP_441431.1_2 Forward -349 -335 10.0287 0.17
NP_441431.1_2 Forward -326 -312 5.50552 0.298
NP_441431.1_3 Reverse -329 -348 5.89931 0.254
NP_441488.1_8 Forward -146 -132 11.7987 0.146
NP_441488.1_8 Forward -265 -251 6.88214 0.289
NP_441836.1_2 Forward -329 -310 7.07928 0.11
NP_441993.1_1 Reverse -296 -315 2.04414 0.265
NP_440114.1_10 Forward -141 -127 13.8643 0.0481
NP_440114.1_10 Reverse -314 -328 11.996 0.0955
NP_441858.1_2 Reverse -320 -339 11.401 0.255
NP_442437.1_8 Reverse -303 -322 6.39097 0.242
NP_442437.1_8 Reverse -315 -334 5.211 0.256
NP_442698.1_10 Reverse -45 -64 3.14605 0.279
NP_440766.1_4 Reverse -310 -324 10.7177 0.0853
NP_440766.1_4 Forward -145 -131 7.76774 0.0871
NP_439988.1_7 Reverse -316 -330 16.5185 0.292
NP_442743.1_4 Forward -131 -112 -4.91709 0.255
NP_442743.1_5 Reverse -315 -334 10.6192 0.143
NP_441311.1_2 Forward -329 -315 10.717 0.285
NP_442930.1_1 Reverse -222 -232 11.1893 0.26
NP_442930.1_1 Reverse -60 -70 10.796 0.275
NP_439910.1_2 Reverse -124 -141 -12.2525 0.0788
NP_440457.1_1 Reverse -310 -322 6.92215 0.108
NP_440457.1_1 Reverse -337 -349 3.38223 0.196
NP_440457.1_1 Reverse -128 -140 1.90727 0.223
NP_440457.1_1 Forward -327 -315 0.825626 0.25
NP_440457.1_1 Forward -145 -133 -0.354346 0.262
NP_440798.1_6 Reverse -315 -328 4.8375 0.143
NP_440798.1_6 Forward -140 -127 4.73917 0.143
NP_440798.1_6 Reverse -133 -146 1.49425 0.212
NP_440142.1_7 Forward -322 -303 6.4893 0.259
NP_440473.1_9 Reverse -303 -322 -11.1119 0.288
NP_442509.1_9 Forward -141 -131 16.2041 0.00739
NP_442509.1_9 Reverse -132 -142 8.04271 0.192
NP_442509.1_9 Forward -323 -313 8.04271 0.192
NP_442509.1_9 Reverse -314 -324 6.66608 0.259
NP_442509.1_9 Forward -119 -109 6.56775 0.263
NP_442514.1_5 Forward -353 -334 -0.591301 0.187
NP_440554.1_4 Forward -140 -130 14.6313 0.02
NP_440554.1_4 Reverse -133 -143 8.82982 0.0646
NP_440554.1_4 Forward -322 -312 8.33817 0.0773
NP_440554.1_4 Reverse -315 -325 7.35486 0.103
NP_441885.1_5 Forward -141 -131 11.4848 0.00668
NP_441885.1_5 Reverse -132 -142 11.3864 0.00668
NP_441885.1_5 Forward -323 -313 10.1081 0.0145
NP_441885.1_5 Reverse -314 -324 1.74999 0.0991
NP_441885.1_5 Forward -42 -32 -1.69159 0.277
NP_440478.1_10 Forward -325 -311 5.99778 0.3
NP_442341.1_7 Reverse -131 -145 8.55439 0.0864
NP_442341.1_7 Forward -324 -310 7.27608 0.109
NP_442341.1_7 Forward -177 -163 6.09611 0.135
NP_442341.1_7 Reverse -109 -123 1.37622 0.292
NP_442341.1_7 Forward -142 -128 1.17956 0.297
NP_442341.1_9 Reverse -130 -144 14.0603 0.0713
NP_442341.1_9 Forward -143 -129 8.65209 0.166
NP_442341.1_9 Forward -313 -299 8.45543 0.17
NP_442341.1_9 Reverse -339 -353 5.80051 0.255
NP_441756.1_5 Reverse -338 -357 -2.26216 0.272
NP_441173.1_9 Reverse -15 -23 10.9338 0.242
NP_442395.2_4 Forward -324 -305 7.4718 0.139
NP_442395.2_4 Reverse -74 -93 1.57197 0.237
NP_440191.1_2 Reverse -4 -23 8.06178 0.0709
NP_440423.1_3 Reverse -99 -118 15.1424 0.201
NP_443000.1_7 Forward -143 -133 10.6981 0.0345
NP_443000.1_7 Reverse -130 -140 8.73149 0.0437
NP_443000.1_7 Forward -325 -315 1.94665 0.226
NP_443000.1_7 Reverse -312 -322 1.455 0.247
NP_440507.2_3 Reverse -305 -324 12.1917 0.164
NP_441842.1_10 Forward -330 -316 14.0609 0.0636
NP_441842.1_10 Reverse -125 -139 14.0609 0.0636
NP_440275.1_3 Reverse -312 -322 10.9931 0.0397
NP_440275.1_3 Forward -143 -133 9.02648 0.0563
NP_440275.1_3 Reverse -130 -140 8.4365 0.0602
NP_440275.1_3 Forward -325 -315 8.33817 0.0602
NP_440091.1_1 Reverse -128 -140 15.8703 0.0161
NP_440091.1_1 Forward -327 -315 3.2839 0.163
NP_443060.1_2 Reverse -122 -141 8.94757 0.128
NP_442275.1_1 Forward -350 -331 6.39097 0.264
NP_440679.1_10 Reverse -280 -299 -13.0786 0.221
NP_440679.1_10 Forward -330 -311 -20.4534 0.284
NP_442451.1_2 Forward -331 -312 -7.67036 0.237
NP_439962.1_4 Reverse -306 -325 -0.197208 0.197
NP_442495.1_5 Reverse -303 -322 17.994 0.103
NP_440149.1_8 Reverse -314 -333 2.65439 0.107
NP_441105.1_3 Reverse -303 -322 4.71934 0.0765
NP_441105.1_3 Forward -152 -133 4.62101 0.077
NP_441105.1_3 Forward -40 -21 -9.63698 0.292
NP_442373.1_1 Forward -128 -109 -3.93378 0.249
NP_442373.1_2 Reverse -284 -303 -6.98204 0.233
NP_440216.1_1 Forward -141 -127 6.58777 0.0145
NP_440216.1_1 Reverse -132 -146 -2.36035 0.0494
NP_440216.1_1 Reverse -314 -328 -3.04867 0.0682
NP_440216.1_1 Forward -350 -336 -11.4068 0.184
NP_440216.1_1 Forward -323 -309 -12.0951 0.24
NP_440172.1_1 Forward -323 -313 18.5646 0.00421
NP_440172.1_1 Reverse -132 -142 17.5813 0.00421
NP_440172.1_1 Forward -141 -131 8.73149 0.0586
NP_440167.1_3 Reverse -304 -323 11.2092 0.231
NP_442015.1_10 Forward -145 -132 12.2123 0.0372
NP_442015.1_10 Reverse -128 -141 9.85238 0.0433
NP_442015.1_10 Reverse -310 -323 6.1158 0.124
NP_441226.1_7 Forward -322 -315 14.4934 0.0123
NP_441226.1_7 Reverse -315 -322 14.4934 0.0123
NP_441226.1_7 Forward -140 -133 14.4934 0.0123
NP_441226.1_7 Reverse -133 -140 14.4934 0.0123
NP_441111.1_7 Forward -140 -132 18.7023 0.00294
NP_441111.1_7 Reverse -315 -323 18.7023 0.00294
NP_441111.1_7 Reverse -133 -141 18.7023 0.00294
NP_441111.1_7 Forward -322 -314 8.86921 0.0589
NP_439971.2_5 Forward -219 -200 14.1591 0.194
NP_441766.1_2 Forward -323 -314 17.896 0.00297
NP_441766.1_2 Forward -141 -132 17.5026 0.00297
NP_441766.1_2 Reverse -132 -141 17.5026 0.00297
NP_441766.1_2 Reverse -314 -323 9.4395 0.0285
NP_442417.1_5 Reverse -132 -146 7.76774 0.176
NP_440416.1_1 Reverse -102 -121 -13.5702 0.281
NP_440416.1_9 Forward -330 -311 -0.000545616 0.0566
NP_440416.1_9 Forward -148 -129 -5.70374 0.0814
NP_440416.1_9 Forward -318 -299 -14.9469 0.182
NP_440416.1_9 Forward -357 -338 -19.4701 0.275
NP_443052.1_8 Reverse -122 -141 7.47261 0.028
NP_443052.1_8 Reverse -304 -323 -2.75381 0.0942
NP_443052.1_8 Reverse -378 -397 -13.4719 0.286
NP_443052.1_9 Forward -297 -278 3.73603 0.161
NP_443052.1_9 Forward -37 -18 2.65439 0.169
NP_443052.1_9 Reverse -267 -286 0.884433 0.191
NP_443052.1_9 Forward -303 -284 -4.72043 0.26
NP_443052.1_9 Forward -294 -275 -5.9004 0.274
NP_442116.1_6 Reverse -211 -228 13.23 0.172
NP_440591.1_9 Reverse -307 -325 14.9655 0.0839
NP_442154.1_1 Reverse -270 -288 -0.669169 0.117
NP_442154.1_1 Reverse -285 -303 -4.01242 0.125
NP_442154.1_1 Reverse -342 -360 -17.5821 0.26
NP_442154.1_6 Forward -324 -305 1.47442 0.27
NP_440261.1_5 Forward -322 -309 -1.16069 0.0662
NP_440261.1_5 Reverse -133 -146 -2.93064 0.0983
NP_440261.1_5 Reverse -386 -399 -11.7804 0.266
NP_440261.1_5 Forward -140 -127 -12.1738 0.272
NP_440988.1_10 Forward -137 -123 3.44663 0.293
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCGGGGGCACCCGCTTTGTGCCCTTAAAAATCATGTGTTCCAGCAGATGGGCCACCCCCGGCCAAGCATCCGGTTCGGCGATCGCTCCGGCCCGCACCCACACATCTACCACCGCCACAGGAACCGTGGGCACATCCTGGTGGATCAGGGTTAACCCCTGGTCAAAGGTAAAAATTTTGGCCGGAAAATCCGGTTTGGTCGGGCACAGTTGCACAGACACAAGGCGTATATCCATTGGGGTCTATGCCTTCTATCCTAGGCGATCGCCGTCTTAACCGTCGGTTAACCCCCCATCATTTTGTCTGCCTTTCGTGACAAGGTTGCCGGGAGTAAAATTTTTTGTCCCCCTACAGCTAAGGCTACCTGCACAGGCCCCTGTGGAAAAAGGGAGGAAAATCC

CDS

ATGCTAGGGTTGGGGACTAAGTTTAGTTGGTTCCATTGGGTAACAGCCAGTGGAGGTAACGGGGAAAAGCTGGTGCAAAGCCAATACTGTCCCGCAACTGTGATGGGCCCAGGCCCTAAGTCAGGATGCCCGCCAACGATGGCCGATTCCGTTAATCAAATCTGCGAGGTACAGGTTGTGAATGTTACAGGTTTATCTAATTTACTGACTTTCCCCCGGCTCCTAGCCCACCATCCCTTTGGGGGCCATACCCCCAGTAATTTCCTGGAAGGTTTCCTCTCCGGCCTGGGGCACCCCGTCATTGGCCTAGACCACCTTGCTTTTGTCATTGCCATTGGCCTGATTGCCGCTGGGTTACGCTACGGTTGGCTAATGCCCCTCATTTTTGTCGCCACGGCGATCACCGGCACAGGGTTGCATTTAATTGGGGCTAATCTGCCCCAGCCAGAATTGGTCATCGCCGGTTCCGTACTTTTATTCGGCATCTTCCTTGCTTTGGGTCGTCCTCTGCCATCTCCCCTAGTAATGGGATTAGCCGCTGTGGCCGGTATGTTCCATGGCTACGCCTATGGAGAAGCCATTGTCGGGGCGCAAATGAATCCCGTTGCCGCCTATTTGCTCGGTTTTTCCTTCATTCAACTAGCGATCGCCATGGGAGTCTATGCCTTAGCCAAGGGCTGGTACGAAACCAAAGAAACCTTGCTCAATCTAAGATTTATTGGCTTTCTGCTAACAGGAGTAGGACTAGCCTTCACCTCCGGCGCCTTGTTGGGGTAA

Protein

MLGLGTKFSWFHWVTASGGNGEKLVQSQYCPATVMGPGPKSGCPPTMADSVNQICEVQVVNVTGLSNLLTFPRLLAHHPFGGHTPSNFLEGFLSGLGHPVIGLDHLAFVIAIGLIAAGLRYGWLMPLIFVATAITGTGLHLIGANLPQPELVIAGSVLLFGIFLALGRPLPSPLVMGLAAVAGMFHGYAYGEAIVGAQMNPVAAYLLGFSFIQLAIAMGVYALAKGWYETKETLLNLRFIGFLLTGVGLAFTSGALLG