Your browser is old and dusty. Try Google Chrome!

Details for slr2127

ORF slr2127
Accession NP_441384.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_4 Reverse -88 -96 4.93597 0.224
NP_443041.1_1 Reverse -185 -204 3.53937 0.252
NP_442151.1_6 Reverse -152 -166 7.37441 0.2
NP_442151.1_6 Reverse -88 -102 5.89945 0.256
NP_442752.1_4 Forward -97 -90 4.26735 0.293
NP_441812.1_3 Forward -362 -348 7.9644 0.254
NP_442975.1_10 Forward -157 -143 1.86729 0.29
NP_442909.1_7 Reverse -89 -103 8.16044 0.186
NP_441054.1_1 Forward -104 -90 15.5359 0.211
NP_441145.1_7 Reverse -245 -264 17.8957 0.0435
NP_442062.1_3 Forward -351 -332 -2.65548 0.272
NP_440304.1_4 Reverse -202 -212 3.71661 0.293
NP_440044.1_8 Reverse -89 -108 7.57094 0.0817
NP_440769.1_3 Forward -272 -253 11.2084 0.28
NP_440769.1_8 Forward -269 -250 13.0775 0.155
NP_441083.1_5 Forward -97 -87 15.2213 0.0126
NP_441083.1_5 Reverse -88 -98 9.41981 0.0267
NP_441955.1_8 Reverse -184 -201 9.18362 0.258
NP_442889.1_10 Forward -324 -305 10.3356 0.285
NP_439953.1_4 Forward -352 -333 20.8456 0.0618
NP_441716.1_1 Forward -391 -377 4.52282 0.255
NP_442111.1_4 Forward -362 -348 5.01447 0.181
NP_440747.1_10 Forward -100 -88 -4.48425 0.101
NP_440747.1_10 Reverse -85 -97 -4.77924 0.117
NP_441486.1_1 Forward -100 -86 4.42448 0.0446
NP_441486.1_1 Reverse -85 -99 -4.52363 0.201
NP_442848.1_1 Forward -103 -89 -3.44199 0.267
NP_440376.1_1 Forward -97 -88 5.99792 0.111
NP_440376.1_1 Reverse -88 -97 -0.000272808 0.285
NP_441588.1_4 Reverse -90 -100 8.33817 0.151
NP_441077.1_6 Forward -129 -113 5.50126 0.249
NP_441077.1_6 Forward -292 -276 2.89827 0.276
NP_440642.1_10 Forward -173 -159 9.04542 0.198
NP_441013.1_2 Forward -204 -186 0.412472 0.254
NP_440141.1_9 Reverse -310 -329 3.44104 0.27
NP_441414.1_9 Forward -97 -78 -0.885524 0.0949
NP_439968.1_8 Reverse -187 -203 16.2831 0.166
NP_442937.1_5 Forward -102 -83 12.2908 0.113
NP_442937.1_5 Reverse -83 -102 6.29264 0.282
NP_441958.1_5 Forward -98 -88 0.275027 0.162
NP_440318.1_1 Forward -177 -158 5.50599 0.218
NP_440950.1_8 Forward -134 -115 9.91929 0.27
NP_442690.1_1 Reverse -335 -354 -6.1954 0.165
NP_442911.1_1 Reverse -116 -129 16.3909 0.236
NP_440934.1_2 Reverse -89 -108 -0.295539 0.296
NP_441654.1_5 Forward -255 -236 13.0139 0.269
NP_440475.1_5 Reverse -158 -177 9.53756 0.175
NP_441294.1_7 Forward -101 -87 13.5701 0.0616
NP_440147.1_4 Forward -99 -86 6.60746 0.0881
NP_441550.1_8 Reverse -86 -96 11.091 0.0555
NP_441550.1_8 Forward -99 -89 8.23937 0.127
NP_441041.1_4 Reverse -88 -107 -13.2752 0.285
NP_442941.1_3 Forward -96 -86 -1.19994 0.288
NP_442941.1_5 Reverse -299 -313 14.334 0.293
NP_440983.1_5 Reverse -88 -107 -9.14533 0.3
NP_441079.1_7 Forward -259 -240 -4.32786 0.249
NP_442575.1_8 Reverse -191 -210 -3.54046 0.254
NP_442500.1_8 Reverse -161 -175 8.63588 0.291
NP_441644.1_6 Reverse -88 -98 7.25606 0.132
NP_441644.1_6 Forward -97 -87 4.50281 0.235
NP_443049.1_6 Forward -362 -352 11.0554 0.282
NP_442215.1_2 Reverse -86 -102 5.76173 0.0769
NP_442215.1_2 Forward -390 -374 -3.97304 0.225
NP_442215.1_2 Forward -208 -192 -5.34967 0.249
NP_440929.1_8 Reverse -88 -97 6.68623 0.0887
NP_440780.1_1 Forward -348 -329 7.78217 0.274
NP_440780.1_1 Reverse -239 -258 7.30471 0.276
NP_442933.1_10 Reverse -88 -97 4.42462 0.246
NP_442554.1_8 Forward -96 -86 3.22496 0.235
NP_442142.1_4 Reverse -187 -200 13.2934 0.0375
NP_442142.1_4 Reverse -385 -398 3.7553 0.246
NP_442292.1_1 Reverse -89 -98 -0.786921 0.287
NP_440464.1_10 Reverse -353 -363 12.6262 0.202
NP_441673.1_1 Forward -97 -88 1.37636 0.114
NP_441673.1_1 Reverse -88 -97 1.1797 0.163
NP_441876.1_9 Forward -207 -197 15.8108 0.267
NP_441826.1_2 Reverse -88 -102 -0.0987402 0.204
NP_441764.1_1 Forward -286 -267 8.65258 0.248
NP_441764.1_8 Forward -296 -286 10.9279 0.291
NP_442719.1_2 Reverse -72 -90 -7.94636 0.239
NP_442719.1_2 Forward -266 -248 -11.7812 0.296
NP_441944.1_4 Forward -362 -343 18.7025 0.277
NP_442808.1_1 Forward -74 -64 1.35624 0.287
NP_442630.1_5 Forward -357 -338 26.8438 0.00202
NP_440145.1_3 Forward -107 -88 -4.91709 0.254
NP_442576.1_2 Reverse -240 -259 6.98095 0.271
NP_441557.1_5 Forward -97 -88 0.491382 0.144
NP_441557.1_5 Reverse -88 -97 0.29472 0.174
NP_442419.1_2 Forward -20 -1 1.27776 0.238
NP_441458.1_8 Reverse -274 -293 13.9214 0.229
NP_441458.1_10 Forward -106 -87 6.88262 0.196
NP_441819.1_5 Reverse -249 -268 9.21455 0.27
NP_441467.1_5 Forward -323 -313 15.3197 0.247
NP_442347.1_2 Reverse -89 -98 12.5861 0.056
NP_442347.1_2 Reverse -353 -362 8.35786 0.0927
NP_442645.1_2 Forward -105 -86 -22.715 0.293
NP_442317.1_3 Reverse -196 -215 16.5191 0.214
NP_442998.1_5 Reverse -201 -211 8.04317 0.274
NP_442998.1_10 Reverse -90 -97 5.93897 0.206
NP_441229.1_10 Forward -107 -88 2.26107 0.288
NP_442158.1_2 Forward -292 -273 16.5674 0.247
NP_440164.1_2 Forward -345 -326 10.0292 0.132
NP_440164.1_2 Forward -290 -271 7.7676 0.18
NP_440702.1_2 Forward -195 -176 -5.21209 0.257
NP_440695.1_6 Forward -337 -323 10.2174 0.269
NP_440677.1_8 Reverse -99 -118 14.7491 0.281
NP_440586.1_8 Forward -202 -195 7.02027 0.279
NP_442251.1_8 Forward -207 -193 16.7159 0.23
NP_442959.1_5 Forward -348 -329 11.4058 0.224
NP_440684.1_9 Reverse -82 -96 17.4042 0.0562
NP_443051.1_5 Reverse -241 -260 5.211 0.256
NP_440372.1_2 Forward -96 -89 4.07068 0.262
NP_440991.1_6 Forward -281 -262 14.1583 0.249
NP_440819.1_5 Forward -322 -314 7.68924 0.266
NP_442384.1_10 Reverse -88 -101 5.82081 0.118
NP_442384.1_10 Forward -97 -84 3.75586 0.179
NP_442384.1_10 Forward -388 -375 2.77255 0.213
NP_442339.1_9 Forward -373 -354 8.94757 0.263
NP_442790.1_4 Reverse -79 -98 -13.9635 0.27
NP_440344.1_10 Forward -104 -87 -7.92597 0.12
NP_440350.1_5 Reverse -295 -314 -3.73712 0.266
NP_440888.1_2 Reverse -88 -102 6.88214 0.217
NP_440060.1_2 Reverse -51 -70 14.4533 0.274
NP_441949.1_5 Forward -343 -324 13.1865 0.2
NP_440575.1_8 Forward -289 -270 -5.31042 0.27
NP_442077.1_4 Reverse -350 -369 9.93088 0.154
NP_441543.1_2 Forward -96 -87 4.52295 0.234
NP_443064.1_6 Forward -97 -87 15.2817 0.0796
NP_441462.1_2 Forward -97 -87 0.0783647 0.168
NP_440936.1_10 Reverse -277 -296 4.24897 0.178
NP_440516.1_8 Forward -97 -88 7.17789 0.0754
NP_440516.1_8 Reverse -88 -97 5.01461 0.118
NP_440673.1_3 Reverse -90 -97 10.1672 0.149
NP_441052.1_2 Reverse -88 -98 7.84651 0.0605
NP_441052.1_2 Forward -97 -87 7.35486 0.0742
NP_442219.1_9 Reverse -89 -98 4.71961 0.198
NP_442219.1_9 Reverse -353 -362 2.35967 0.28
NP_442366.1_5 Forward -100 -90 13.9425 0.0549
NP_442011.1_1 Forward -98 -79 4.22769 0.232
NP_441396.1_5 Reverse -195 -204 18.191 0.141
NP_442689.1_8 Reverse -339 -356 -8.81095 0.298
NP_441409.1_8 Forward -93 -74 7.59493 0.279
NP_440431.1_3 Forward -271 -252 -10.4236 0.275
NP_440483.1_1 Reverse -189 -208 1.96607 0.185
NP_441078.1_4 Forward -97 -88 0.393051 0.205
NP_441078.1_4 Reverse -88 -97 -0.000272808 0.205
NP_440793.1_1 Reverse -307 -321 17.5018 0.182
NP_441432.1_8 Forward -98 -89 11.0128 0.0629
NP_441432.1_8 Forward -104 -95 2.55633 0.298
NP_441333.1_1 Reverse -307 -317 12.4479 0.235
NP_441732.1_2 Reverse -375 -391 -16.6577 0.186
NP_441945.1_10 Reverse -184 -203 14.8474 0.168
NP_442353.1_4 Forward -103 -84 1.76863 0.242
NP_441072.1_2 Reverse -77 -96 9.0459 0.225
NP_442489.1_7 Forward -97 -88 0.688044 0.152
NP_442489.1_7 Reverse -88 -97 0.688044 0.152
NP_440559.1_1 Forward -96 -87 4.91628 0.175
NP_441659.2_8 Reverse -88 -98 5.19158 0.113
NP_442346.1_5 Forward -98 -88 4.20827 0.296
NP_440352.1_5 Reverse -192 -211 10.125 0.278
NP_441329.1_6 Forward -327 -308 -1.76702 0.293
NP_441895.1_10 Forward -354 -335 -19.1751 0.282
NP_442943.1_1 Forward -345 -330 4.34977 0.235
NP_442028.1_1 Reverse -305 -318 7.51014 0.292
NP_442254.1_1 Reverse -27 -46 2.94938 0.218
NP_440590.1_4 Reverse -89 -102 0.215946 0.165
NP_440156.1_4 Reverse -339 -349 14.2375 0.176
NP_440624.1_5 Reverse -330 -348 7.8602 0.287
NP_440665.1_1 Reverse -184 -203 -14.5535 0.262
NP_442270.1_9 Forward -108 -89 3.83436 0.14
NP_440219.1_1 Forward -248 -229 13.9873 0.218
NP_442643.1_3 Reverse -185 -204 -1.67217 0.252
NP_441874.1_1 Reverse -35 -49 9.5377 0.277
NP_440212.1_9 Reverse -240 -259 15.362 0.114
NP_442809.1_6 Forward -387 -368 5.01433 0.256
NP_442592.1_3 Reverse -54 -73 8.65258 0.278
NP_442479.1_9 Forward -38 -19 -13.7669 0.29
NP_442479.1_9 Reverse -70 -89 -14.0619 0.294
NP_442402.1_4 Reverse -344 -363 0.293673 0.182
NP_442402.1_10 Forward -209 -199 13.1559 0.204
NP_441848.1_4 Forward -354 -338 12.1343 0.211
NP_441848.1_7 Forward -260 -241 -4.03287 0.287
NP_440825.1_7 Reverse -89 -99 10.8602 0.286
NP_442837.1_3 Reverse -353 -360 6.52896 0.2
NP_442053.1_1 Reverse -88 -97 6.8829 0.111
NP_442532.1_1 Forward -319 -305 9.43337 0.283
NP_442532.1_2 Reverse -222 -241 0.333799 0.283
NP_442532.1_4 Reverse -240 -258 7.86797 0.289
NP_440914.1_1 Forward -97 -87 11.5428 0.0887
NP_440914.1_7 Forward -249 -230 4.72643 0.29
NP_442533.1_6 Forward -97 -88 4.91628 0.165
NP_442533.1_6 Reverse -88 -97 4.42462 0.179
NP_442535.1_6 Reverse -110 -128 17.5003 0.198
NP_441697.1_5 Reverse -329 -348 -9.31089 0.268
NP_440816.1_2 Forward -351 -332 9.0489 0.235
NP_441028.1_4 Forward -196 -182 21.2391 0.0662
NP_441028.1_5 Forward -167 -155 19.0169 0.231
NP_441028.1_6 Forward -208 -198 17.4824 0.132
NP_441527.1_4 Forward -318 -299 -2.91293 0.162
NP_441527.1_4 Reverse -162 -181 -9.88384 0.262
NP_441527.1_4 Forward -309 -290 -11.8892 0.284
NP_441527.1_7 Reverse -292 -311 11.8967 0.282
NP_440007.1_9 Forward -197 -183 0.982901 0.29
NP_442673.1_7 Reverse -74 -93 11.7928 0.278
NP_439903.1_6 Reverse -212 -231 0.588665 0.259
NP_441286.1_1 Forward -98 -86 -6.2542 0.254
NP_441286.1_1 Reverse -87 -99 -6.74586 0.278
NP_440670.1_8 Forward -97 -88 8.55452 0.066
NP_440670.1_8 Reverse -88 -97 5.99792 0.13
NP_440886.1_4 Reverse -57 -76 18.289 0.112
NP_441463.1_2 Reverse -274 -292 2.00452 0.246
NP_442794.1_1 Reverse -84 -96 5.15219 0.231
NP_442615.1_1 Forward -106 -88 -4.79907 0.194
NP_440387.1_1 Forward -97 -81 -2.98973 0.153
NP_441488.1_8 Forward -102 -88 8.65209 0.179
NP_440492.1_9 Reverse -168 -182 9.50399 0.295
NP_442743.1_4 Reverse -191 -210 -6.68705 0.279
NP_442930.1_1 Forward -258 -248 14.0409 0.239
NP_442930.1_1 Reverse -338 -348 11.3859 0.259
NP_442582.1_3 Forward -355 -341 13.667 0.258
NP_441384.1_1 Forward -99 -81 23.6186 0.0379
NP_441384.1_2 Forward -323 -306 20.1702 0.28
NP_441384.1_3 Forward -133 -114 23.3039 0.0163
NP_441885.1_5 Forward -97 -87 9.22315 0.0223
NP_441885.1_5 Reverse -88 -98 1.25834 0.11
NP_442703.1_1 Forward -306 -287 4.72643 0.297
NP_442341.1_7 Reverse -87 -101 8.65272 0.0858
NP_442341.1_7 Forward -98 -84 3.34284 0.227
NP_442341.1_7 Reverse -381 -395 1.96621 0.274
NP_441173.1_9 Forward -207 -199 10.1471 0.261
NP_441307.1_4 Forward -202 -183 -0.39387 0.26
NP_441105.1_3 Forward -108 -89 -6.68705 0.239
NP_440172.1_1 Forward -97 -87 2.43831 0.279
NP_440172.1_1 Reverse -88 -98 2.24165 0.279
NP_442015.1_10 Forward -101 -88 -1.06236 0.293
NP_441766.1_2 Reverse -88 -97 4.12963 0.194
NP_442046.1_8 Reverse -185 -204 12.9791 0.293
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACGTCAGTGGTGCTGAACACCTAGAGCTATTAAATATTCGGGATCAAATTGGAGAAATTGTTAACATATTTAGCCTACGAGAAAAAAGAAAATTACGAGAAGCAGATAAAAAATGTTAATTAACATGGCAACTACTTATCAAAAAATTTCTCGCTTTATTGATTTATCTAACTATCGAAATGAGCATGAGATTTCCCCCCATCAATGGTGGTGGTATTTAGATGTTTTATCCTTTCTTCCTGATGACATTAGCTCCAATGTAGCCTGATCAAAAAAACTTAAAACCTAGACCTTTTAGCATTGGCGATCAGCAAACTCAGTAAAACCTGGCTACCCTAGCTCCAATTAACTCTCCCTGTCCCAAGATTAAGATAGAACTGCTCTCTCGTTTCCCGTCTC

CDS

ATGGCCACCACCCCCCAAGAAGTCTGGCAACTCCTCGGCGAACTTGCCCAGGCCCAAAAAGAAACCGAACGCCTCCTCAAAGAACAGTCCCAAGAAGCGGATCGTCGTTTCCAAGAAACTGAACGACTCTTAAAAGAACAAAGCCAACGCCTACTTGGCCAACTTGGTAACCGCTTGGGAGAGTTTGTCGAATACCAAGTGCGACCTGCCGCCGTTAGACTGTTCCGGGAACGGGGCATTGACGTTCATGAAATTTCCACCGACCTATCCGTTCAAAAAAATGGTCAAGGGCTAGAAATTGATCTGTTAGTAGTTAATGGCAATGAGGCGATCGCCATCGAAGTGAAAAGTAAACTAGACAAGGAAGATGTAGATGAACACCTAGAACGAATGAGTAAATTTAAACGACTCCTACCCCGCTATCAACCTCTCAAAATACTAGGAGCCGTCGCCGCCATGGTAGTGCCCAACCAGATTGCCAGTTACGCCTACCGTAAAGGACTCTTTGTTATTGCCCAATCTGGCGACGATCTGATGATTTTAAATGATGCTAAATTCCGCCCTAAAGCTTGGTAG

Protein

MATTPQEVWQLLGELAQAQKETERLLKEQSQEADRRFQETERLLKEQSQRLLGQLGNRLGEFVEYQVRPAAVRLFRERGIDVHEISTDLSVQKNGQGLEIDLLVVNGNEAIAIEVKSKLDKEDVDEHLERMSKFKRLLPRYQPLKILGAVAAMVVPNQIASYAYRKGLFVIAQSGDDLMILNDAKFRPKAW