Your browser is old and dusty. Try Google Chrome!

Details for slr2121

ORF slr2121
Accession NP_441378.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -253 -239 -0.590395 0.234
NP_440557.1_1 Reverse -39 -58 -0.787193 0.27
NP_440795.1_7 Forward -347 -340 14.6904 0.0123
NP_440795.1_7 Reverse -340 -347 14.6904 0.0123
NP_440795.1_7 Forward -169 -162 11.7405 0.0778
NP_440795.1_7 Reverse -39 -46 8.8889 0.188
NP_441418.1_6 Reverse -161 -180 -23.1083 0.191
NP_441418.1_6 Reverse -38 -57 -28.0249 0.203
NP_441418.1_6 Reverse -84 -103 -29.0082 0.215
NP_440815.1_5 Reverse -339 -358 4.42435 0.286
NP_441480.1_5 Reverse -64 -83 10.4225 0.248
NP_440897.1_6 Forward -348 -329 2.16195 0.17
NP_441453.1_1 Reverse -332 -350 10.8348 0.125
NP_441453.1_1 Forward -177 -159 3.55831 0.264
NP_441453.1_4 Reverse -339 -347 16.539 0.00633
NP_441453.1_4 Forward -348 -340 16.539 0.00633
NP_441453.1_4 Forward -47 -39 4.73931 0.252
NP_441453.1_4 Reverse -161 -169 4.64098 0.257
NP_442151.1_6 Forward -348 -334 14.0609 0.0406
NP_442151.1_6 Reverse -339 -353 10.1277 0.13
NP_441818.1_1 Forward -265 -254 10.2846 0.232
NP_441818.1_9 Reverse -93 -112 10.0292 0.106
NP_441818.1_9 Reverse -75 -94 6.98095 0.13
NP_441818.1_9 Reverse -96 -115 -6.09707 0.259
NP_441818.1_9 Reverse -90 -109 -6.29373 0.263
NP_441818.1_9 Reverse -374 -393 -6.78538 0.265
NP_440226.1_1 Reverse -339 -358 19.469 0.0114
NP_441465.1_8 Reverse -129 -147 8.7706 0.235
NP_442169.1_1 Reverse -81 -100 7.86593 0.26
NP_442169.1_1 Reverse -4 -23 -1.47551 0.265
NP_441630.1_3 Reverse -76 -95 0.786102 0.265
NP_440931.1_8 Reverse -34 -53 13.6675 0.258
NP_440996.1_3 Reverse -148 -166 14.2771 0.196
NP_442173.1_1 Forward -347 -339 15.4574 0.00633
NP_442173.1_1 Reverse -340 -348 15.4574 0.00633
NP_442173.1_1 Forward -265 -257 5.0343 0.24
NP_442752.1_4 Forward -348 -341 13.8055 0.0199
NP_442752.1_4 Reverse -339 -346 13.8055 0.0199
NP_442752.1_4 Reverse -93 -100 10.5605 0.1
NP_442752.1_4 Reverse -38 -45 5.25066 0.256
NP_443027.1_4 Reverse -337 -347 16.2046 0.0437
NP_443027.1_4 Forward -350 -340 15.3197 0.0437
NP_441812.1_3 Forward -349 -335 8.65272 0.251
NP_442975.1_10 Forward -352 -338 11.897 0.0482
NP_442975.1_10 Reverse -335 -349 11.7987 0.0482
NP_440784.1_7 Forward -347 -340 15.9687 0.0123
NP_440784.1_7 Reverse -340 -347 15.9687 0.0123
NP_440110.1_8 Reverse -363 -382 7.66927 0.103
NP_441054.1_4 Reverse -329 -347 -2.43913 0.234
NP_442062.1_8 Reverse -339 -349 10.3048 0.0493
NP_442062.1_8 Forward -348 -338 10.3048 0.0493
NP_442062.1_8 Forward -266 -256 3.22496 0.279
NP_442062.1_8 Forward -216 -206 2.83163 0.293
NP_440761.1_4 Forward -353 -334 -4.03212 0.132
NP_440761.1_4 Reverse -334 -353 -13.0786 0.257
NP_440304.1_4 Reverse -337 -347 19.9412 0.00364
NP_440304.1_4 Forward -350 -340 18.9579 0.00406
NP_442242.1_4 Forward -347 -340 14.3954 0.0124
NP_442242.1_4 Reverse -340 -347 14.3954 0.0124
NP_442242.1_4 Forward -265 -258 9.47889 0.251
NP_441581.1_6 Forward -98 -79 9.09856 0.297
NP_442602.1_3 Reverse -198 -217 -1.7705 0.246
NP_439918.1_2 Reverse -39 -58 -5.21209 0.298
NP_439918.1_3 Reverse -90 -109 5.01433 0.264
NP_441208.1_9 Forward -351 -337 13.7659 0.103
NP_441594.1_6 Reverse -107 -126 1.27776 0.269
NP_440132.1_1 Reverse -91 -109 7.98396 0.284
NP_442110.1_7 Reverse -339 -353 9.43936 0.0738
NP_441925.1_4 Forward -115 -96 -5.01617 0.177
NP_441925.1_4 Forward -118 -99 -13.4726 0.257
NP_441925.1_4 Forward -109 -90 -14.9476 0.263
NP_441925.1_4 Forward -100 -81 -15.6359 0.269
NP_441925.1_4 Forward -24 -5 -16.2258 0.281
NP_440856.1_4 Forward -355 -336 -1.96717 0.205
NP_441083.1_5 Forward -348 -338 11.2881 0.0159
NP_441083.1_5 Reverse -339 -349 11.2881 0.0159
NP_441083.1_5 Forward -170 -160 7.94484 0.048
NP_441083.1_5 Reverse -161 -171 -0.0199663 0.251
NP_441083.1_5 Forward -47 -37 -0.904945 0.283
NP_442827.1_8 Reverse -331 -350 4.62021 0.133
NP_442827.1_8 Forward -356 -337 -1.67294 0.253
NP_441434.1_7 Reverse -341 -355 3.8345 0.225
NP_441738.1_2 Forward -346 -339 15.28 0.0102
NP_441738.1_2 Reverse -341 -348 15.28 0.0102
NP_441738.1_2 Reverse -295 -302 8.29857 0.176
NP_441738.1_2 Forward -213 -206 6.72528 0.236
NP_441558.1_5 Reverse -337 -356 10.9142 0.0895
NP_440209.1_1 Reverse -339 -347 18.1123 0.00295
NP_440209.1_1 Forward -348 -340 18.1123 0.00295
NP_442136.1_4 Reverse -142 -161 5.2102 0.295
NP_442889.1_1 Reverse -232 -251 -14.0619 0.271
NP_442889.1_8 Forward -351 -337 7.57046 0.146
NP_442889.1_8 Forward -173 -159 6.48882 0.188
NP_441713.1_1 Reverse -333 -352 -3.24547 0.113
NP_441713.1_1 Forward -354 -335 -5.60541 0.113
NP_441770.1_1 Forward -93 -74 12.585 0.277
NP_440178.1_7 Reverse -338 -357 -4.91709 0.0594
NP_440053.1_2 Reverse -74 -93 11.0125 0.291
NP_442570.1_3 Reverse -36 -55 2.3594 0.189
NP_442570.1_3 Reverse -35 -54 -2.16383 0.212
NP_441716.1_1 Forward -47 -33 6.29277 0.202
NP_441716.1_1 Reverse -161 -175 4.52282 0.255
NP_442111.1_4 Reverse -338 -352 8.75105 0.0694
NP_442111.1_4 Forward -349 -335 7.27608 0.101
NP_440343.1_9 Reverse -190 -209 9.63589 0.248
NP_440343.1_9 Reverse -130 -149 9.63589 0.248
NP_440906.1_5 Forward -347 -340 15.8704 0.0124
NP_440906.1_5 Reverse -340 -347 15.8704 0.0124
NP_440906.1_5 Reverse -162 -169 9.47889 0.116
NP_440012.1_6 Reverse -150 -169 10.6192 0.247
NP_440747.1_10 Forward -351 -339 -1.92764 0.0192
NP_440747.1_10 Reverse -336 -348 -2.02597 0.0196
NP_440747.1_10 Reverse -158 -170 -4.68091 0.115
NP_440747.1_10 Forward -173 -161 -11.7607 0.142
NP_440747.1_10 Reverse -35 -47 -12.5474 0.297
NP_441130.1_10 Reverse -337 -351 9.14437 0.128
NP_441486.1_1 Reverse -254 -268 4.12949 0.0492
NP_441486.1_1 Forward -351 -337 -4.62196 0.204
NP_442634.1_4 Forward -350 -336 15.0442 0.0144
NP_442634.1_4 Reverse -337 -351 5.89945 0.051
NP_442634.1_4 Reverse -91 -105 2.45787 0.137
NP_442634.1_4 Reverse -36 -50 -1.27871 0.149
NP_442634.1_4 Reverse -231 -245 -5.21195 0.241
NP_441265.1_3 Forward -354 -340 3.34284 0.181
NP_442848.1_5 Forward -114 -96 3.46073 0.276
NP_442848.1_5 Forward -394 -376 -0.0791831 0.276
NP_443018.1_3 Forward -347 -340 14.8871 0.0123
NP_443018.1_3 Reverse -340 -347 14.8871 0.0123
NP_441316.1_7 Reverse -337 -352 4.79811 0.121
NP_441316.1_7 Forward -350 -335 2.5365 0.154
NP_441634.1_8 Reverse -337 -351 2.45787 0.167
NP_440376.1_1 Forward -348 -339 19.4693 0.000692
NP_440376.1_1 Reverse -339 -348 19.4693 0.000692
NP_440376.1_1 Reverse -161 -170 7.96454 0.0492
NP_440376.1_1 Reverse -21 -30 7.17789 0.0829
NP_440376.1_1 Reverse -207 -216 3.93297 0.188
NP_440376.1_1 Reverse -206 -215 0.491382 0.273
NP_440376.1_1 Forward -170 -161 -0.0986038 0.285
NP_441588.1_4 Reverse -341 -351 6.66654 0.185
NP_442687.1_7 Forward -349 -339 9.02648 0.0994
NP_442687.1_7 Reverse -338 -348 9.02648 0.0994
NP_442687.1_7 Reverse -160 -170 4.89658 0.23
NP_441846.1_10 Reverse -6 -25 -10.0303 0.19
NP_441846.1_10 Reverse -4 -23 -20.1584 0.256
NP_441846.1_10 Reverse -92 -111 -20.2567 0.256
NP_441846.1_10 Reverse -98 -117 -21.535 0.256
NP_441846.1_10 Reverse -83 -102 -21.7317 0.256
NP_441846.1_10 Reverse -82 -101 -22.42 0.259
NP_441846.1_10 Reverse -7 -26 -22.42 0.259
NP_441950.1_7 Reverse -374 -393 2.65439 0.175
NP_441950.1_7 Reverse -78 -97 -2.75381 0.202
NP_441950.1_7 Reverse -233 -252 -8.752 0.287
NP_441451.2_9 Reverse -61 -80 24.5822 0.021
NP_441763.1_9 Reverse -190 -209 13.5691 0.102
NP_442658.1_1 Forward -350 -340 15.9091 0.00966
NP_442658.1_1 Reverse -337 -347 13.0576 0.04
NP_440141.1_8 Reverse -75 -94 4.03102 0.294
NP_440662.1_2 Forward -376 -357 0.0977854 0.276
NP_442782.1_2 Reverse -38 -52 12.3893 0.173
NP_442782.1_2 Reverse -214 -228 5.99778 0.234
NP_442496.1_5 Reverse -200 -218 6.41066 0.283
NP_442205.1_9 Forward -354 -338 -1.61309 0.264
NP_442205.1_9 Reverse -333 -349 -2.79306 0.272
NP_441414.1_9 Forward -348 -329 -1.7705 0.105
NP_441414.1_9 Reverse -339 -358 -4.42544 0.153
NP_440720.1_1 Reverse -328 -347 2.0644 0.263
NP_441487.1_6 Forward -356 -337 -0.000545616 0.259
NP_441256.1_2 Reverse -302 -321 4.22769 0.299
NP_441256.1_8 Reverse -21 -40 2.65439 0.285
NP_442937.1_5 Reverse -156 -175 9.24257 0.198
NP_442937.1_5 Reverse -240 -259 6.39097 0.28
NP_441958.1_5 Forward -349 -339 21.2195 0.000805
NP_441958.1_5 Reverse -338 -348 21.2195 0.000805
NP_441958.1_5 Forward -171 -161 0.963343 0.12
NP_442836.1_3 Reverse -126 -145 20.1162 0.128
NP_442836.1_5 Reverse -353 -372 4.81767 0.202
NP_442685.1_2 Reverse -324 -334 17.0896 0.11
NP_440203.1_5 Reverse -296 -306 10.4026 0.225
NP_439905.1_1 Forward -92 -79 13.7856 0.155
NP_439905.1_1 Forward -347 -334 6.60746 0.283
NP_439905.1_2 Forward -30 -16 10.9143 0.208
NP_440984.1_7 Forward -353 -339 10.816 0.122
NP_440984.1_7 Forward -221 -207 4.52282 0.299
NP_439990.1_5 Reverse -334 -347 13.9823 0.0889
NP_442911.1_2 Reverse -151 -170 -5.50708 0.16
NP_442911.1_2 Forward -358 -339 -11.0136 0.296
NP_441580.1_6 Forward -359 -340 -5.9004 0.235
NP_440153.1_5 Reverse -340 -354 5.21113 0.191
NP_440153.1_8 Forward -368 -355 -3.4223 0.295
NP_442064.1_1 Reverse -334 -353 -2.55715 0.146
NP_442064.1_4 Forward -264 -245 7.27514 0.242
NP_442536.1_8 Reverse -87 -106 11.2092 0.275
NP_443055.1_3 Reverse -29 -48 13.8918 0.153
NP_443055.1_6 Forward -223 -205 0.805058 0.239
NP_440993.1_2 Forward -353 -337 12.9399 0.0665
NP_440993.1_2 Reverse -334 -350 2.41848 0.265
NP_440827.1_1 Reverse -87 -106 15.3391 0.221
NP_440138.1_6 Forward -246 -227 6.98015 0.217
NP_441099.1_5 Forward -225 -206 -12.2919 0.299
NP_442002.1_1 Reverse -198 -216 -10.4039 0.292
NP_442002.1_9 Forward -267 -260 10.5605 0.214
NP_441654.1_7 Forward -161 -142 11.081 0.295
NP_440809.1_8 Reverse -141 -160 4.916 0.295
NP_440809.1_9 Reverse -330 -348 -8.24065 0.23
NP_442013.1_7 Reverse -183 -202 6.4893 0.299
NP_441294.1_7 Forward -352 -338 14.146 0.0466
NP_442438.1_10 Forward -353 -339 11.406 0.0463
NP_442431.1_10 Reverse -96 -114 16.1454 0.0577
NP_442431.1_10 Reverse -78 -96 12.4089 0.0897
NP_442431.1_10 Reverse -87 -105 6.01734 0.195
NP_442431.1_10 Reverse -99 -117 3.46073 0.217
NP_442431.1_10 Reverse -90 -108 2.0841 0.243
NP_442885.1_5 Forward -100 -81 16.9115 0.156
NP_441752.1_6 Forward -109 -90 3.24438 0.235
NP_441000.1_6 Reverse -338 -352 -4.4253 0.243
NP_440484.1_3 Forward -350 -336 10.816 0.242
NP_440147.1_4 Reverse -337 -350 12.5073 0.0326
NP_440147.1_4 Forward -350 -337 3.06754 0.196
NP_440147.1_4 Forward -172 -159 -0.570702 0.291
NP_441550.1_8 Forward -350 -340 17.4824 0.00754
NP_441550.1_8 Reverse -337 -347 13.0576 0.0273
NP_441916.1_7 Forward -348 -338 18.9579 0.00144
NP_441916.1_7 Reverse -339 -349 18.9579 0.00144
NP_441916.1_7 Reverse -161 -171 4.0116 0.193
NP_441041.1_7 Forward -351 -339 18.3015 0.00558
NP_441041.1_7 Forward -219 -207 8.48655 0.135
NP_442396.1_5 Reverse -335 -348 9.36073 0.13
NP_440703.1_9 Forward -247 -234 4.64028 0.295
NP_441725.1_5 Forward -347 -337 11.1898 0.0247
NP_441725.1_5 Reverse -340 -350 8.92815 0.0553
NP_441725.1_5 Reverse -162 -172 1.94665 0.115
NP_441725.1_8 Forward -105 -86 16.2241 0.132
NP_439966.1_7 Reverse -337 -347 14.8275 0.0177
NP_439966.1_7 Forward -350 -340 13.8442 0.0234
NP_439966.1_9 Reverse -197 -206 4.52295 0.253
NP_439966.1_9 Forward -350 -341 0.983037 0.253
NP_442941.1_3 Forward -347 -337 19.9412 0.00262
NP_442941.1_3 Reverse -340 -350 10.9931 0.0116
NP_442941.1_3 Reverse -39 -49 5.28991 0.122
NP_442941.1_3 Forward -265 -255 4.99491 0.132
NP_442941.1_3 Forward -46 -36 -0.0199663 0.244
NP_442941.1_3 Forward -169 -159 -1.29827 0.297
NP_440289.1_2 Forward -351 -338 4.93583 0.0636
NP_440289.1_2 Reverse -336 -349 -2.93064 0.262
NP_442281.1_1 Forward -353 -339 6.88214 0.113
NP_442281.1_1 Forward -30 -16 5.01387 0.172
NP_442281.1_1 Forward -221 -207 4.62054 0.187
NP_442281.1_1 Forward -52 -38 4.52221 0.192
NP_442281.1_1 Forward -175 -161 1.86729 0.285
NP_441334.1_7 Reverse -337 -356 -3.24547 0.0904
NP_442901.1_4 Reverse -380 -399 0.982764 0.278
NP_440437.1_1 Forward -53 -34 -1.7705 0.205
NP_440647.1_9 Forward -350 -332 4.6407 0.236
NP_442012.1_1 Forward -222 -203 3.73603 0.179
NP_441087.1_6 Reverse -166 -184 -0.374908 0.258
NP_441087.1_6 Forward -24 -6 -2.34152 0.292
NP_441556.1_10 Reverse -360 -374 9.54046 0.298
NP_440498.1_1 Forward -357 -339 2.77242 0.172
NP_442982.1_5 Forward -358 -339 -1.18052 0.263
NP_442068.1_4 Forward -92 -73 12.1917 0.143
NP_441644.1_6 Forward -348 -338 19.0557 0.000803
NP_441644.1_6 Reverse -339 -349 19.0557 0.000803
NP_441644.1_6 Forward -170 -160 4.69947 0.228
NP_442215.1_2 Reverse -159 -175 2.41848 0.116
NP_442215.1_2 Reverse -236 -252 -3.57971 0.218
NP_442029.1_1 Reverse -81 -100 -11.5053 0.229
NP_440929.1_8 Forward -348 -339 19.2726 0.000701
NP_440929.1_8 Reverse -339 -348 19.2726 0.000701
NP_442933.1_10 Forward -348 -339 17.601 0.00325
NP_442933.1_10 Reverse -339 -348 17.601 0.00325
NP_442933.1_10 Reverse -161 -170 4.32629 0.257
NP_442933.1_10 Reverse -257 -266 4.22796 0.267
NP_441751.2_8 Reverse -340 -354 5.01447 0.0448
NP_441751.2_8 Forward -347 -333 4.12949 0.0534
NP_441751.2_8 Reverse -162 -176 -5.21195 0.199
NP_442926.1_5 Forward -271 -252 10.3673 0.263
NP_442554.1_8 Reverse -340 -350 19.1546 0.00369
NP_442554.1_8 Forward -347 -337 16.9913 0.0065
NP_441762.1_7 Reverse -338 -350 2.69391 0.0676
NP_441762.1_7 Forward -349 -337 -6.84419 0.284
NP_442142.1_4 Forward -351 -338 12.2117 0.0464
NP_442142.1_4 Forward -105 -92 6.90188 0.153
NP_442142.1_4 Reverse -336 -349 6.21356 0.17
NP_442142.1_4 Forward -173 -160 2.18201 0.299
NP_442292.1_1 Forward -347 -338 17.5026 0.00435
NP_442292.1_1 Reverse -340 -349 17.5026 0.00435
NP_442476.1_6 Reverse -340 -354 5.21113 0.139
NP_440895.1_10 Reverse -352 -369 3.28376 0.149
NP_442381.1_8 Reverse -122 -141 -14.7502 0.284
NP_443009.1_5 Reverse -338 -349 15.7911 0.0107
NP_443009.1_5 Forward -349 -338 15.7911 0.0107
NP_443009.1_5 Forward -217 -206 10.6779 0.0767
NP_443009.1_5 Reverse -256 -267 6.05637 0.177
NP_443009.1_5 Reverse -206 -217 5.56471 0.197
NP_441715.1_4 Forward -347 -337 14.238 0.0295
NP_441715.1_4 Forward -265 -255 10.9931 0.0955
NP_441715.1_4 Reverse -340 -350 7.25653 0.108
NP_440015.1_9 Reverse -339 -357 6.41066 0.117
NP_441198.1_4 Reverse -90 -109 11.1109 0.241
NP_441198.1_8 Forward -350 -340 15.4199 0.0427
NP_441198.1_8 Reverse -337 -347 13.2713 0.108
NP_441198.1_8 Reverse -205 -215 10.9275 0.232
NP_441468.1_1 Forward -347 -340 15.8704 0.0124
NP_441468.1_1 Reverse -340 -347 15.8704 0.0124
NP_441020.2_6 Reverse -5 -22 10.6586 0.139
NP_441015.1_10 Reverse -97 -116 0.687771 0.165
NP_441015.1_10 Reverse -11 -30 -5.01543 0.215
NP_441015.1_10 Reverse -94 -113 -8.26035 0.272
NP_441015.1_10 Reverse -91 -110 -10.1286 0.283
NP_441673.1_1 Forward -348 -339 20.8459 0.000698
NP_441673.1_1 Reverse -339 -348 20.8459 0.000698
NP_441673.1_1 Forward -170 -161 1.27803 0.155
NP_441673.1_1 Reverse -161 -170 1.27803 0.155
NP_441016.2_6 Forward -99 -80 7.07848 0.25
NP_441956.1_9 Reverse -286 -305 6.98095 0.274
NP_441876.1_9 Forward -12 -2 15.8108 0.267
NP_441826.1_2 Forward -354 -340 5.60446 0.0975
NP_442868.1_6 Forward -350 -340 8.63316 0.0555
NP_442868.1_6 Reverse -337 -347 1.06167 0.205
NP_442868.1_6 Reverse -36 -46 -0.118297 0.264
NP_441251.1_7 Reverse -318 -331 13.884 0.266
NP_441612.1_2 Forward -248 -238 7.19391 0.26
NP_442227.1_2 Forward -23 -4 4.916 0.202
NP_442227.1_2 Forward -100 -81 0.884433 0.252
NP_442227.1_2 Forward -109 -90 -0.39387 0.253
NP_442227.1_2 Forward -24 -5 -3.63879 0.294
NP_442427.1_8 Reverse -152 -171 6.78429 0.23
NP_442808.1_1 Reverse -338 -348 8.73102 0.0481
NP_442808.1_1 Forward -349 -339 8.73102 0.0481
NP_442808.1_1 Forward -94 -84 5.78111 0.141
NP_442808.1_1 Forward -54 -44 3.91283 0.218
NP_442808.1_1 Forward -17 -7 2.92952 0.252
NP_442808.1_1 Forward -390 -380 2.63453 0.26
NP_440871.1_3 Reverse -173 -187 15.6137 0.184
NP_440918.1_2 Reverse -36 -55 10.1275 0.282
NP_442775.1_6 Forward -265 -246 12.5858 0.277
NP_440145.1_3 Forward -358 -339 5.80098 0.0599
NP_440145.1_4 Forward -101 -91 15.9091 0.178
NP_442542.1_2 Forward -350 -337 4.54251 0.3
NP_442050.1_5 Reverse -337 -347 18.0724 0.00365
NP_442050.1_5 Forward -350 -340 17.1874 0.00812
NP_442342.1_9 Forward -350 -334 3.40179 0.26
NP_441114.1_3 Forward -214 -205 7.27622 0.247
NP_440558.1_2 Reverse -235 -254 -2.85214 0.231
NP_441878.1_6 Forward -349 -339 10.5014 0.0176
NP_441878.1_6 Reverse -338 -348 10.5014 0.0176
NP_441878.1_6 Reverse -206 -216 2.33998 0.0405
NP_441878.1_6 Forward -171 -161 1.25834 0.108
NP_441878.1_6 Forward -217 -207 1.16001 0.11
NP_441878.1_6 Reverse -160 -170 -7.59145 0.245
NP_441036.1_8 Forward -349 -339 15.713 0.00724
NP_441036.1_8 Reverse -338 -348 15.713 0.00724
NP_441557.1_5 Forward -348 -339 19.9609 0.000699
NP_441557.1_5 Reverse -339 -348 19.9609 0.000699
NP_441557.1_5 Forward -170 -161 0.393051 0.166
NP_441557.1_5 Reverse -161 -170 0.393051 0.166
NP_441557.1_5 Reverse -38 -47 -0.885252 0.26
NP_441445.1_1 Reverse -84 -103 1.27776 0.259
NP_441590.1_4 Forward -106 -87 6.88182 0.254
NP_441590.1_4 Forward -100 -81 2.9486 0.29
NP_442066.2_4 Reverse -38 -57 -3.04881 0.215
NP_442066.2_4 Reverse -339 -358 -7.4737 0.28
NP_442066.2_9 Reverse -335 -348 12.999 0.154
NP_442066.2_9 Forward -352 -339 9.95071 0.158
NP_442777.1_3 Forward -109 -91 17.6196 0.0532
NP_442777.1_3 Forward -100 -82 6.21323 0.228
NP_441308.1_8 Reverse -337 -347 13.353 0.218
NP_441308.1_8 Forward -350 -340 12.4681 0.218
NP_442183.1_1 Forward -348 -334 13.0776 0.0486
NP_442183.1_9 Reverse -87 -97 10.1081 0.296
NP_440676.1_3 Reverse -369 -388 6.09597 0.292
NP_442166.1_3 Reverse -89 -108 -5.70374 0.264
NP_441459.1_3 Forward -96 -77 17.0491 0.168
NP_442135.1_3 Forward -360 -341 5.50599 0.26
NP_441549.1_9 Reverse -335 -353 1.49411 0.101
NP_441549.1_9 Reverse -34 -52 -6.96235 0.206
NP_442347.1_2 Forward -46 -37 5.99792 0.201
NP_442347.1_2 Forward -347 -338 3.34298 0.284
NP_442347.1_2 Reverse -340 -349 3.34298 0.284
NP_441037.1_4 Forward -350 -340 16.5761 0.0168
NP_441037.1_4 Reverse -337 -347 7.31769 0.237
NP_441037.1_4 Reverse -91 -101 6.83041 0.239
NP_442594.1_8 Reverse -90 -109 16.2241 0.146
NP_442594.1_8 Reverse -81 -100 10.7175 0.175
NP_442594.1_8 Reverse -84 -103 4.32602 0.266
NP_442594.1_8 Reverse -5 -24 2.55606 0.295
NP_442594.1_8 Reverse -4 -23 2.0644 0.295
NP_442594.1_9 Forward -338 -319 7.07848 0.242
NP_441633.1_3 Reverse -159 -172 -1.45568 0.158
NP_441633.1_3 Reverse -337 -350 -3.52063 0.177
NP_440136.1_2 Forward -347 -340 15.9687 0.0123
NP_440136.1_2 Reverse -340 -347 15.9687 0.0123
NP_442590.1_9 Forward -309 -290 4.52268 0.273
NP_442998.1_5 Reverse -321 -331 11.7798 0.176
NP_442998.1_10 Forward -346 -339 15.5754 0.0102
NP_442998.1_10 Reverse -341 -348 15.5754 0.0102
NP_440899.1_2 Forward -58 -39 9.43841 0.178
NP_440899.1_5 Forward -225 -206 14.2574 0.128
NP_440299.1_1 Reverse -335 -348 3.85363 0.228
NP_441799.1_1 Reverse -335 -349 14.4536 0.0236
NP_441799.1_1 Forward -352 -338 13.7653 0.03
NP_441007.1_10 Forward -353 -340 12.5073 0.0499
NP_441007.1_10 Reverse -334 -347 3.36254 0.182
NP_440256.1_1 Reverse -336 -355 -1.47551 0.104
NP_440256.1_1 Forward -351 -332 -9.14533 0.275
NP_441559.1_8 Reverse -334 -348 -7.67023 0.297
NP_441270.1_5 Reverse -71 -90 11.0424 0.294
NP_440915.1_6 Forward -352 -338 20.3541 0.00676
NP_440915.1_6 Reverse -335 -349 2.94952 0.11
NP_440717.1_1 Reverse -340 -359 9.24257 0.245
NP_442866.1_1 Reverse -144 -163 -8.55534 0.282
NP_442031.1_5 Reverse -88 -107 4.22769 0.298
NP_441464.1_8 Forward -216 -202 5.30946 0.259
NP_441464.1_10 Reverse -230 -244 9.34103 0.262
NP_441464.1_10 Reverse -73 -87 8.06273 0.287
NP_440702.1_2 Reverse -97 -116 -3.44213 0.257
NP_440306.1_8 Forward -338 -319 8.25844 0.202
NP_440306.1_8 Forward -337 -318 3.9319 0.204
NP_441939.1_3 Reverse -39 -58 5.01433 0.292
NP_442993.1_1 Forward -348 -332 7.72835 0.0302
NP_442993.1_1 Reverse -339 -355 -8.98791 0.178
NP_442386.1_5 Forward -239 -220 12.0933 0.148
NP_442386.1_9 Forward -349 -340 6.39082 0.219
NP_442386.1_9 Reverse -338 -347 6.39082 0.219
NP_442054.1_3 Forward -142 -123 -3.54046 0.297
NP_441340.1_5 Forward -347 -340 15.6737 0.0124
NP_441340.1_5 Reverse -340 -347 15.6737 0.0124
NP_441271.1_1 Reverse -333 -351 10.3431 0.282
NP_440168.1_9 Reverse -91 -110 -5.50708 0.296
NP_440161.1_3 Forward -350 -331 13.1758 0.151
NP_440586.1_1 Reverse -86 -105 -4.81876 0.278
NP_440586.1_8 Forward -347 -340 13.2151 0.026
NP_440586.1_8 Reverse -340 -347 13.2151 0.026
NP_440586.1_8 Forward -241 -234 7.1186 0.272
NP_440586.1_8 Forward -110 -103 7.02027 0.279
NP_442251.1_6 Forward -347 -340 15.2804 0.0124
NP_442251.1_6 Reverse -340 -347 15.2804 0.0124
NP_442251.1_6 Forward -265 -258 10.3639 0.134
NP_440192.1_4 Reverse -81 -100 10.9499 0.227
NP_441262.1_3 Reverse -339 -346 14.7888 0.0223
NP_441262.1_3 Forward -348 -341 14.7888 0.0223
NP_443051.1_1 Reverse -338 -347 19.5676 0.00335
NP_443051.1_1 Forward -349 -340 19.5676 0.00335
NP_439996.1_6 Reverse -92 -111 6.35846 0.296
NP_441232.1_10 Forward -359 -340 0.687771 0.296
NP_439937.1_9 Reverse -338 -355 -14.6131 0.287
NP_440408.1_7 Reverse -38 -57 10.3242 0.247
NP_440439.1_1 Forward -351 -338 10.049 0.0387
NP_440439.1_1 Reverse -336 -349 8.67241 0.0513
NP_440439.1_1 Reverse -35 -48 2.96921 0.122
NP_440439.1_1 Reverse -13 -26 1.59258 0.148
NP_442239.1_8 Reverse -86 -105 13.6675 0.231
NP_440372.1_2 Forward -347 -340 16.3621 0.0124
NP_440372.1_2 Reverse -340 -347 16.3621 0.0124
NP_441789.1_7 Forward -109 -90 6.29183 0.193
NP_441789.1_7 Forward -150 -131 1.47364 0.245
NP_441789.1_7 Forward -100 -81 -2.06626 0.257
NP_441789.1_7 Forward -243 -224 -2.55791 0.257
NP_440819.1_5 Reverse -320 -328 7.98423 0.228
NP_440316.1_10 Reverse -83 -93 5.5849 0.291
NP_441803.1_2 Forward -379 -360 -0.39387 0.275
NP_439977.1_5 Forward -354 -335 1.86774 0.184
NP_439977.1_5 Reverse -333 -352 -0.983855 0.239
NP_441572.1_7 Forward -354 -335 2.3594 0.133
NP_441572.1_7 Forward -53 -34 -5.40875 0.26
NP_440267.1_2 Forward -353 -339 10.1271 0.15
NP_442384.1_10 Forward -348 -335 13.884 0.018
NP_442384.1_10 Reverse -161 -174 6.01747 0.113
NP_442384.1_10 Forward -170 -157 2.77255 0.213
NP_442384.1_10 Forward -47 -34 1.9859 0.24
NP_442384.1_10 Reverse -339 -352 1.00259 0.271
NP_441018.1_3 Reverse -49 -68 8.94676 0.294
NP_441018.1_7 Reverse -145 -164 6.98095 0.278
NP_441018.1_7 Reverse -34 -53 6.98095 0.278
NP_442790.1_4 Reverse -330 -349 -14.3569 0.274
NP_442262.1_10 Forward -347 -340 14.1988 0.0123
NP_442262.1_10 Reverse -340 -347 14.1988 0.0123
NP_441689.1_5 Reverse -337 -347 17.8758 0.0158
NP_441689.1_5 Forward -350 -340 8.43603 0.132
NP_441689.1_5 Forward -49 -39 7.84605 0.185
NP_441689.1_5 Reverse -255 -265 5.38779 0.265
NP_440344.1_10 Forward -177 -160 -12.2525 0.246
NP_440282.1_10 Forward -57 -38 -8.06369 0.259
NP_440282.1_10 Forward -112 -93 -9.73531 0.288
NP_440282.1_10 Forward -393 -374 -9.83364 0.289
NP_440531.1_6 Forward -178 -159 8.25926 0.0875
NP_440531.1_6 Forward -224 -205 -1.27885 0.231
NP_440189.1_10 Reverse -196 -215 7.7676 0.242
NP_441965.1_10 Forward -351 -335 7.72835 0.142
NP_440297.1_9 Forward -347 -337 9.22315 0.0917
NP_440297.1_9 Reverse -162 -172 0.471689 0.282
NP_440297.1_9 Reverse -340 -350 -0.314959 0.282
NP_441896.1_3 Reverse -330 -349 -2.55715 0.284
NP_440894.1_2 Forward -26 -7 3.04771 0.172
NP_440937.1_5 Forward -260 -241 8.25926 0.287
NP_440999.1_1 Forward -113 -94 8.84842 0.145
NP_440999.1_1 Forward -119 -100 2.26028 0.249
NP_440999.1_9 Forward -352 -338 1.86788 0.157
NP_440888.1_2 Reverse -339 -353 19.1735 0.00165
NP_440888.1_2 Forward -348 -334 13.9619 0.022
NP_440052.1_8 Reverse -91 -110 9.43923 0.256
NP_441543.1_2 Forward -347 -338 15.9293 0.00518
NP_441543.1_2 Reverse -340 -349 15.9293 0.00518
NP_441543.1_2 Forward -169 -160 12.2911 0.0401
NP_441543.1_2 Forward -46 -37 4.22796 0.267
NP_442845.1_2 Reverse -333 -347 13.3726 0.0955
NP_442845.1_2 Forward -354 -340 12.1926 0.114
NP_442845.1_2 Forward -53 -39 4.62115 0.256
NP_442845.1_2 Reverse -102 -116 3.8345 0.275
NP_440982.1_1 Forward -23 -4 5.11187 0.294
NP_441469.1_8 Forward -349 -340 6.5879 0.227
NP_441469.1_8 Reverse -338 -347 6.5879 0.227
NP_442315.1_1 Reverse -82 -100 13.9821 0.125
NP_442315.1_1 Reverse -88 -106 4.83737 0.256
NP_443064.1_6 Forward -348 -338 10.8217 0.13
NP_443064.1_6 Reverse -339 -349 10.8217 0.13
NP_442337.1_8 Reverse -179 -198 -1.96717 0.293
NP_442578.1_7 Forward -347 -340 14.5921 0.026
NP_442578.1_7 Reverse -340 -347 14.5921 0.026
NP_440710.1_1 Forward -356 -338 -7.15901 0.234
NP_441462.1_2 Forward -348 -338 20.2362 0.000805
NP_441462.1_2 Reverse -339 -349 20.2362 0.000805
NP_441462.1_2 Reverse -161 -171 0.57002 0.144
NP_441462.1_2 Reverse -38 -48 -0.314959 0.206
NP_441462.1_5 Reverse -80 -99 6.98095 0.213
NP_441621.1_7 Forward -350 -336 -5.11362 0.248
NP_441621.1_7 Reverse -337 -351 -5.11362 0.248
NP_443062.1_1 Reverse -339 -357 10.106 0.121
NP_440519.1_8 Reverse -149 -165 8.71166 0.199
NP_442204.1_1 Reverse -335 -346 -0.0396598 0.285
NP_441560.1_8 Reverse -334 -353 12.6814 0.248
NP_442872.1_1 Forward -116 -97 -10.3253 0.241
NP_440516.1_8 Forward -348 -339 16.9127 0.00442
NP_440516.1_8 Reverse -339 -348 16.9127 0.00442
NP_442428.1_5 Forward -347 -340 15.8704 0.0124
NP_442428.1_5 Reverse -340 -347 15.8704 0.0124
NP_442428.1_5 Reverse -162 -169 3.77569 0.277
NP_441443.1_1 Reverse -107 -126 0.0977854 0.225
NP_440673.1_3 Forward -346 -339 12.4288 0.0426
NP_440673.1_3 Reverse -341 -348 12.4288 0.0426
NP_440673.1_7 Forward -97 -78 2.65439 0.222
NP_440673.1_7 Forward -359 -340 0.491109 0.267
NP_441052.1_2 Forward -170 -160 13.648 0.0281
NP_441052.1_2 Forward -348 -338 10.4031 0.0285
NP_441052.1_2 Reverse -339 -349 10.4031 0.0285
NP_441052.1_2 Forward -111 -101 1.25834 0.249
NP_441052.1_2 Forward -47 -37 0.0783647 0.263
NP_442219.1_9 Forward -347 -338 8.25953 0.0681
NP_442219.1_9 Reverse -340 -349 8.25953 0.0681
NP_442219.1_9 Forward -46 -37 5.11294 0.186
NP_440436.1_4 Forward -347 -338 9.24241 0.0871
NP_440436.1_4 Reverse -340 -349 9.24241 0.0871
NP_440436.1_4 Forward -215 -206 6.78414 0.147
NP_440436.1_4 Forward -46 -37 4.7192 0.244
NP_441336.1_3 Reverse -77 -91 16.3225 0.264
NP_440314.1_9 Forward -347 -328 -5.99873 0.225
NP_441719.1_4 Forward -347 -340 16.3621 0.0124
NP_441719.1_4 Reverse -340 -347 16.3621 0.0124
NP_441733.1_10 Forward -351 -338 8.67241 0.138
NP_441004.1_1 Reverse -87 -106 -9.83364 0.212
NP_441004.1_1 Reverse -1 -20 -10.1286 0.218
NP_441004.1_1 Reverse -78 -97 -17.2085 0.29
NP_441004.1_2 Reverse -215 -234 -2.36049 0.264
NP_441004.1_2 Reverse -82 -101 -2.55715 0.264
NP_442813.1_4 Reverse -75 -94 -8.35868 0.299
NP_440296.1_10 Reverse -90 -109 -4.72043 0.209
NP_440296.1_10 Reverse -4 -23 -11.8986 0.269
NP_441115.1_4 Reverse -338 -356 21.2578 0.00309
NP_441115.1_4 Forward -349 -331 11.7197 0.129
NP_442694.1_4 Forward -301 -292 11.7011 0.277
NP_443054.1_2 Reverse -337 -351 12.1926 0.0722
NP_443054.1_2 Reverse -205 -219 9.2427 0.102
NP_441851.1_10 Forward -349 -339 8.53483 0.114
NP_441851.1_10 Reverse -338 -348 8.53483 0.114
NP_441851.1_10 Reverse -37 -47 5.87989 0.196
NP_441851.1_10 Reverse -206 -216 4.99491 0.233
NP_441851.1_10 Forward -217 -207 4.10993 0.287
NP_441668.1_4 Reverse -197 -216 -2.36049 0.288
NP_442515.1_1 Forward -349 -335 4.62115 0.107
NP_442515.1_1 Reverse -160 -174 3.14618 0.124
NP_442515.1_1 Forward -171 -157 2.94952 0.128
NP_441396.1_5 Reverse -103 -112 8.35786 0.224
NP_441982.1_6 Reverse -318 -327 10.7665 0.292
NP_440463.1_6 Reverse -336 -355 6.4893 0.295
NP_440165.1_5 Reverse -338 -357 -0.000545616 0.156
NP_441349.1_10 Forward -358 -339 7.27595 0.0323
NP_441349.1_10 Reverse -329 -348 -3.24547 0.136
NP_441409.1_6 Reverse -333 -352 10.9142 0.024
NP_440432.1_9 Reverse -340 -355 5.28977 0.0565
NP_442843.1_1 Reverse -191 -210 -10.4236 0.278
NP_440474.1_8 Reverse -340 -354 15.0436 0.0586
NP_440474.1_8 Forward -347 -333 10.422 0.138
NP_441150.1_6 Reverse -235 -254 13.47 0.268
NP_440431.1_3 Forward -171 -152 -5.11376 0.181
NP_442450.1_5 Reverse -337 -347 9.41981 0.115
NP_440588.1_2 Reverse -330 -349 5.70265 0.0625
NP_440943.1_5 Reverse -230 -244 13.4709 0.24
NP_442006.1_2 Reverse -7 -24 -17.1691 0.27
NP_441570.1_1 Reverse -339 -357 1.49411 0.0304
NP_441570.1_1 Reverse -93 -111 0.412472 0.0394
NP_441570.1_1 Forward -199 -181 -9.61729 0.142
NP_441570.1_1 Reverse -161 -179 -16.5005 0.247
NP_441078.1_4 Forward -348 -339 19.6659 0.0007
NP_441078.1_4 Reverse -339 -348 19.6659 0.0007
NP_441078.1_4 Forward -170 -161 8.55452 0.0274
NP_441078.1_4 Reverse -161 -170 7.27622 0.0764
NP_441078.1_4 Forward -47 -38 4.81794 0.126
NP_441078.1_4 Reverse -38 -47 -1.47524 0.266
NP_441078.1_4 Reverse -207 -216 -1.57357 0.266
NP_441078.1_4 Forward -216 -207 -1.57357 0.266
NP_442729.1_5 Reverse -92 -102 8.73149 0.248
NP_442729.1_8 Reverse -335 -348 11.1307 0.125
NP_442348.1_2 Reverse -149 -158 13.4711 0.191
NP_442348.1_2 Forward -302 -293 7.76787 0.28
NP_441094.1_6 Forward -355 -338 9.5762 0.258
NP_440526.1_3 Reverse -340 -351 11.6612 0.0646
NP_441432.1_8 Reverse -338 -347 16.8143 0.00595
NP_441432.1_8 Forward -349 -340 16.8143 0.00595
NP_441432.1_8 Reverse -37 -46 5.80125 0.137
NP_441432.1_8 Forward -171 -162 4.0313 0.24
NP_442320.1_8 Forward -354 -340 6.3911 0.029
NP_442320.1_8 Reverse -333 -347 -2.26202 0.0871
NP_442320.1_9 Reverse -127 -141 13.6676 0.246
NP_441732.1_2 Forward -51 -35 1.43517 0.0402
NP_441732.1_2 Reverse -335 -351 -7.0213 0.0614
NP_441030.1_6 Reverse -337 -356 11.0224 0.297
NP_441072.1_2 Forward -359 -340 13.4708 0.163
NP_442489.1_7 Forward -348 -339 20.1576 0.000695
NP_442489.1_7 Reverse -339 -348 20.1576 0.000695
NP_442489.1_7 Reverse -161 -170 1.08137 0.109
NP_442489.1_7 Forward -170 -161 0.589713 0.17
NP_442489.1_7 Reverse -207 -216 -1.57357 0.213
NP_442489.1_7 Forward -216 -207 -2.06522 0.288
NP_440565.1_7 Reverse -1 -20 1.0811 0.246
NP_440559.1_1 Reverse -340 -349 8.65285 0.0586
NP_440559.1_1 Forward -347 -338 8.65285 0.0586
NP_440559.1_1 Reverse -258 -267 4.32629 0.288
NP_441659.2_8 Forward -348 -338 20.9245 0.000805
NP_441659.2_8 Reverse -339 -349 20.9245 0.000805
NP_441659.2_8 Reverse -161 -171 -0.216628 0.292
NP_442913.1_10 Forward -357 -338 8.25926 0.0487
NP_442849.1_1 Reverse -4 -18 7.9644 0.282
NP_441800.1_7 Forward -98 -80 -2.53746 0.264
NP_442776.1_6 Forward -350 -331 8.65258 0.248
NP_442346.1_5 Forward -349 -339 16.303 0.00248
NP_442346.1_5 Reverse -338 -348 16.303 0.00248
NP_442346.1_5 Forward -171 -161 10.8948 0.0813
NP_442346.1_5 Reverse -256 -266 6.8632 0.188
NP_442346.1_5 Reverse -206 -216 4.79825 0.272
NP_440352.1_5 Reverse -104 -123 12.5584 0.229
NP_440545.1_3 Forward -352 -335 7.61033 0.0489
NP_441856.1_3 Forward -351 -332 0.294447 0.216
NP_441856.1_3 Reverse -336 -355 -1.96717 0.25
NP_441856.1_8 Forward -32 -13 10.3242 0.29
NP_440555.1_1 Reverse -328 -347 5.211 0.294
NP_441923.1_6 Reverse -85 -99 8.55439 0.278
NP_440010.1_10 Reverse -81 -100 2.16274 0.287
NP_442551.1_4 Reverse -205 -220 -2.57671 0.271
NP_440847.1_3 Forward -15 -1 11.012 0.275
NP_442603.1_7 Forward -348 -334 8.65209 0.168
NP_441050.1_5 Reverse -4 -22 -3.32411 0.29
NP_440449.1_6 Forward -356 -338 13.508 0.105
NP_440449.1_6 Forward -224 -206 5.04615 0.284
NP_440449.1_6 Reverse -331 -349 4.75436 0.291
NP_441047.1_5 Reverse -16 -35 20.2548 0.102
NP_441833.1_4 Forward -347 -340 15.9687 0.0124
NP_441833.1_4 Reverse -340 -347 15.9687 0.0124
NP_442162.1_9 Forward -347 -340 16.2637 0.0124
NP_442162.1_9 Reverse -340 -347 16.2637 0.0124
NP_442404.1_9 Forward -99 -85 9.6354 0.265
NP_440224.1_1 Forward -359 -340 0.392778 0.135
NP_441044.1_4 Forward -161 -143 6.41066 0.223
NP_442140.1_3 Reverse -340 -350 7.94484 0.124
NP_442021.1_3 Reverse -32 -51 -6.49039 0.257
NP_440875.1_9 Reverse -341 -351 16.8403 0.0145
NP_441813.1_5 Reverse -337 -347 15.9097 0.01
NP_441813.1_5 Forward -350 -340 8.73149 0.0367
NP_441813.1_7 Forward -152 -138 10.717 0.23
NP_440594.1_8 Forward -347 -334 11.1301 0.153
NP_440590.1_4 Reverse -340 -353 2.87088 0.0788
NP_440590.1_4 Forward -253 -240 -4.9956 0.272
NP_440590.1_4 Forward -347 -334 -5.29059 0.277
NP_440590.1_4 Forward -46 -33 -6.07724 0.299
NP_440567.1_1 Reverse -340 -354 20.6491 0.012
NP_440567.1_1 Forward -347 -333 5.21113 0.105
NP_442497.1_10 Forward -347 -338 17.601 0.00813
NP_442497.1_10 Reverse -340 -349 17.601 0.00813
NP_442497.1_10 Reverse -162 -171 0.29472 0.199
NP_440821.1_4 Reverse -337 -347 11.0914 0.0146
NP_440821.1_4 Forward -350 -340 10.7964 0.0146
NP_440821.1_4 Forward -172 -162 0.275027 0.19
NP_440927.1_4 Forward -305 -286 14.4541 0.247
NP_441239.1_9 Forward -350 -338 14.887 0.0247
NP_441239.1_9 Reverse -337 -349 12.1337 0.0494
NP_441239.1_9 Reverse -205 -217 8.10212 0.142
NP_440400.1_1 Forward -111 -92 -0.591301 0.285
NP_441892.1_1 Forward -357 -340 -5.86102 0.29
NP_440604.1_6 Reverse -93 -112 2.55606 0.137
NP_442044.1_1 Reverse -339 -358 -9.83364 0.271
NP_442105.1_9 Forward -143 -129 14.5459 0.294
NP_442270.1_9 Forward -271 -252 -0.39387 0.142
NP_441508.1_4 Forward -322 -308 14.3354 0.283
NP_442643.1_3 Reverse -208 -227 -8.94866 0.297
NP_440833.1_6 Reverse -290 -304 7.17714 0.285
NP_440949.1_7 Forward -101 -82 7.96345 0.298
NP_442052.1_7 Reverse -100 -114 21.1407 0.0313
NP_442809.1_3 Forward -110 -91 16.9115 0.239
NP_440546.1_4 Reverse -339 -349 13.5365 0.0459
NP_440546.1_4 Forward -348 -338 13.5365 0.0459
NP_440546.1_4 Reverse -38 -48 8.6886 0.176
NP_440675.1_1 Reverse -158 -177 6.29264 0.195
NP_440675.1_9 Reverse -129 -143 19.7641 0.164
NP_440462.1_6 Forward -350 -340 19.4496 0.00371
NP_440462.1_6 Reverse -337 -347 16.893 0.00853
NP_442340.1_3 Forward -399 -380 -1.57384 0.188
NP_442611.1_1 Reverse -339 -358 2.55606 0.216
NP_440868.1_4 Reverse -335 -347 8.10212 0.0602
NP_440868.1_4 Forward -352 -340 7.51213 0.0691
NP_440868.1_8 Reverse -89 -108 10.9142 0.103
NP_442499.1_1 Forward -107 -88 11.0125 0.201
NP_441249.1_8 Reverse -7 -26 5.11266 0.247
NP_441474.1_1 Forward -103 -84 2.6536 0.247
NP_441474.1_1 Forward -214 -195 1.08032 0.25
NP_441474.1_1 Forward -109 -90 1.08032 0.25
NP_441474.1_1 Forward -112 -93 0.686995 0.255
NP_441474.1_1 Forward -100 -81 0.0970122 0.255
NP_442402.1_2 Forward -332 -318 14.4536 0.263
NP_441848.1_4 Reverse -315 -331 9.556 0.277
NP_441084.1_6 Forward -172 -158 10.7985 0.228
NP_440653.1_10 Reverse -258 -277 5.11266 0.234
NP_440696.1_6 Reverse -81 -100 5.70265 0.266
NP_442039.1_4 Forward -347 -340 15.1821 0.0124
NP_442039.1_4 Reverse -340 -347 15.1821 0.0124
NP_442039.1_4 Forward -46 -39 8.59391 0.193
NP_441811.1_8 Reverse -87 -101 10.3243 0.22
NP_441926.1_3 Forward -348 -332 5.46674 0.17
NP_441926.1_3 Reverse -339 -355 5.27008 0.171
NP_441926.1_3 Forward -37 -21 2.8118 0.256
NP_440825.1_6 Reverse -147 -166 7.37428 0.285
NP_442837.1_3 Forward -347 -340 15.7721 0.0124
NP_442837.1_3 Reverse -340 -347 15.7721 0.0124
NP_440160.1_5 Forward -86 -76 15.1225 0.267
NP_439994.1_3 Forward -349 -330 9.21897 0.253
NP_442053.1_1 Forward -348 -339 18.3876 0.0007
NP_442053.1_1 Reverse -339 -348 18.3876 0.0007
NP_440505.1_3 Forward -350 -340 15.418 0.0114
NP_440505.1_3 Reverse -337 -347 15.123 0.014
NP_440505.1_3 Reverse -147 -157 8.63316 0.138
NP_440505.1_3 Reverse -36 -46 8.23984 0.147
NP_440505.1_3 Reverse -26 -36 4.60159 0.277
NP_442659.1_10 Reverse -90 -109 17.2516 0.215
NP_441252.1_6 Reverse -204 -211 11.6422 0.288
NP_441203.1_1 Forward -347 -328 -14.3569 0.185
NP_440914.1_1 Forward -348 -338 16.3248 0.00196
NP_440914.1_1 Reverse -339 -349 16.3248 0.00196
NP_440914.1_1 Forward -247 -237 8.51751 0.186
NP_440914.1_1 Forward -47 -37 6.56569 0.273
NP_440914.1_1 Forward -170 -160 6.27291 0.288
NP_440914.1_2 Reverse -108 -127 18.1907 0.233
NP_441011.1_8 Forward -347 -338 16.6177 0.00602
NP_441011.1_8 Reverse -340 -349 16.6177 0.00602
NP_441011.1_8 Reverse -39 -48 5.60459 0.247
NP_442101.1_10 Forward -356 -337 -3.24547 0.112
NP_442101.1_10 Reverse -225 -244 -8.85033 0.242
NP_442533.1_1 Reverse -96 -115 -4.52377 0.142
NP_442533.1_1 Reverse -90 -109 -12.9802 0.236
NP_442533.1_1 Reverse -75 -94 -13.9635 0.239
NP_442533.1_1 Reverse -4 -23 -13.9635 0.239
NP_442533.1_1 Reverse -2 -21 -15.8318 0.257
NP_442533.1_1 Reverse -99 -118 -16.5201 0.271
NP_442533.1_1 Reverse -74 -93 -16.7168 0.275
NP_442533.1_1 Reverse -87 -106 -16.8151 0.277
NP_442533.1_1 Reverse -5 -24 -16.8151 0.277
NP_442533.1_6 Forward -348 -339 17.2076 0.00137
NP_442533.1_6 Reverse -339 -348 17.2076 0.00137
NP_442533.1_6 Forward -216 -207 7.57121 0.0898
NP_442533.1_6 Forward -170 -161 5.99792 0.121
NP_442541.1_10 Forward -209 -195 0.687325 0.3
NP_442322.1_4 Forward -25 -8 -8.02495 0.286
NP_442322.1_9 Forward -22 -4 21.5528 0.0528
NP_443016.1_1 Reverse -201 -220 -6.29373 0.258
NP_441482.1_7 Reverse -333 -347 -3.54032 0.129
NP_441482.1_7 Forward -176 -162 -11.8001 0.284
NP_439944.1_9 Reverse -340 -350 17.7779 0.00341
NP_439944.1_9 Forward -347 -337 17.6796 0.00347
NP_442269.1_10 Reverse -150 -169 3.93269 0.248
NP_441028.1_6 Forward -13 -3 15.5158 0.137
NP_442664.1_8 Forward -123 -104 8.55343 0.283
NP_440116.1_8 Reverse -340 -359 -1.47551 0.12
NP_440115.1_6 Forward -351 -341 7.84651 0.146
NP_440007.1_9 Reverse -335 -349 0.786239 0.29
NP_440007.1_9 Forward -352 -338 0.687908 0.292
NP_441602.1_3 Forward -189 -170 -4.6221 0.269
NP_441602.1_4 Forward -359 -340 9.83255 0.278
NP_441170.1_6 Forward -79 -64 14.8279 0.251
NP_441972.1_5 Forward -169 -150 -6.09707 0.228
NP_441106.1_1 Reverse -338 -347 18.486 0.0028
NP_441106.1_1 Forward -349 -340 18.486 0.0028
NP_439903.1_6 Forward -351 -332 4.22689 0.2
NP_442306.1_10 Reverse -334 -353 -19.7651 0.2
NP_441286.1_1 Reverse -338 -350 5.25052 0.0259
NP_441286.1_1 Forward -349 -337 4.95553 0.027
NP_441286.1_1 Reverse -160 -172 4.36554 0.0342
NP_442674.1_3 Forward -178 -159 3.44025 0.294
NP_440670.1_8 Forward -348 -339 18.3876 0.000699
NP_440670.1_8 Reverse -339 -348 18.3876 0.000699
NP_440886.1_7 Forward -363 -353 12.2709 0.0805
NP_440886.1_7 Forward -349 -339 8.04271 0.0805
NP_440886.1_7 Reverse -338 -348 8.04271 0.0805
NP_440886.1_7 Forward -171 -161 6.86274 0.113
NP_440886.1_7 Forward -94 -84 3.32285 0.287
NP_440828.1_4 Forward -103 -84 -4.22953 0.246
NP_439995.1_5 Reverse -329 -348 13.3725 0.166
NP_439995.1_5 Forward -358 -339 4.71934 0.283
NP_442072.1_9 Reverse -338 -356 -1.84914 0.0316
NP_442072.1_9 Forward -356 -338 -15.3205 0.177
NP_441753.1_10 Forward -357 -338 3.83436 0.206
NP_442022.1_4 Reverse -90 -109 10.4225 0.23
NP_442022.1_4 Reverse -149 -168 7.37428 0.268
NP_440907.2_8 Reverse -340 -350 19.1541 0.00362
NP_440907.2_8 Forward -347 -337 9.51767 0.103
NP_441021.1_1 Forward -265 -246 -11.0136 0.254
NP_440841.1_4 Forward -172 -153 -6.88371 0.215
NP_441463.1_2 Reverse -316 -334 0.658986 0.269
NP_441463.1_3 Forward -109 -90 -2.65548 0.158
NP_441463.1_3 Forward -358 -339 -6.78538 0.249
NP_441463.1_3 Forward -280 -261 -10.3253 0.293
NP_441626.1_2 Forward -347 -340 15.7721 0.0124
NP_441626.1_2 Reverse -340 -347 15.7721 0.0124
NP_441626.1_5 Forward -211 -192 16.4207 0.183
NP_442365.1_7 Forward -45 -26 -5.11376 0.259
NP_442615.1_1 Reverse -330 -348 10.8356 0.0193
NP_442615.1_1 Forward -357 -339 4.05072 0.0494
NP_442615.1_1 Reverse -152 -170 3.3624 0.0549
NP_442615.1_1 Reverse -19 -37 -5.97904 0.231
NP_440387.1_1 Forward -348 -332 7.13836 0.0282
NP_440387.1_1 Reverse -339 -355 1.14018 0.111
NP_440634.1_10 Forward -111 -92 16.7149 0.124
NP_441993.1_1 Reverse -65 -84 9.64582 0.135
NP_441993.1_1 Reverse -77 -96 5.45515 0.201
NP_440114.1_10 Reverse -339 -353 17.4042 0.0104
NP_440114.1_10 Forward -348 -334 13.1759 0.0632
NP_440114.1_10 Forward -223 -209 11.6026 0.107
NP_440114.1_10 Reverse -207 -221 10.9143 0.13
NP_442323.1_7 Forward -164 -145 0.785326 0.299
NP_441510.2_2 Forward -106 -87 1.86696 0.29
NP_440293.1_10 Reverse -90 -109 -0.295539 0.251
NP_439988.1_3 Reverse -39 -53 6.29277 0.278
NP_442743.1_8 Forward -338 -319 12.2875 0.185
NP_442930.1_1 Forward -333 -323 9.51767 0.286
NP_441133.1_1 Reverse -96 -115 13.3725 0.243
NP_439910.1_2 Reverse -331 -348 -22.184 0.215
NP_440457.1_1 Forward -352 -340 8.00379 0.101
NP_440457.1_1 Reverse -335 -347 0.0389777 0.25
NP_440457.1_1 Reverse -16 -28 -0.551008 0.268
NP_440798.1_6 Reverse -340 -353 10.7374 0.074
NP_441984.1_1 Reverse -87 -105 5.13236 0.3
NP_441332.1_6 Forward -17 -7 11.6467 0.254
NP_441332.1_6 Forward -94 -84 10.7754 0.287
NP_440473.1_9 Forward -359 -340 -8.94866 0.26
NP_442509.1_9 Reverse -339 -349 8.04271 0.192
NP_442509.1_9 Forward -348 -338 8.04271 0.192
NP_442509.1_9 Reverse -161 -171 7.55106 0.214
NP_442936.1_10 Reverse -323 -337 13.5705 0.216
NP_442936.1_10 Reverse -322 -336 9.16816 0.269
NP_440448.1_4 Forward -359 -340 6.58763 0.297
NP_441159.1_8 Reverse -153 -172 -3.44288 0.255
NP_440554.1_4 Forward -347 -337 16.1063 0.0189
NP_440554.1_4 Reverse -340 -350 15.418 0.0199
NP_441845.1_6 Forward -84 -66 -1.75081 0.296
NP_441761.1_1 Reverse -150 -169 5.99764 0.252
NP_441885.1_5 Forward -348 -338 11.3864 0.00668
NP_441885.1_5 Reverse -339 -349 11.3864 0.00668
NP_441885.1_5 Forward -170 -160 10.2065 0.012
NP_441885.1_5 Forward -47 -37 -0.806614 0.228
NP_441885.1_5 Reverse -38 -48 -0.904945 0.241
NP_441275.1_5 Forward -212 -193 21.7297 0.0443
NP_442341.1_7 Forward -171 -157 7.9644 0.0956
NP_442341.1_9 Reverse -337 -351 5.70218 0.258
NP_441173.1_9 Forward -12 -4 10.1471 0.261
NP_442395.2_4 Reverse -338 -357 6.58682 0.146
NP_442395.2_4 Forward -93 -74 3.73524 0.197
NP_440191.1_8 Forward -21 -3 19.7828 0.112
NP_443000.1_7 Reverse -337 -347 17.4829 0.00719
NP_443000.1_7 Forward -350 -340 10.7964 0.0345
NP_443000.1_7 Reverse -255 -265 3.81494 0.226
NP_443000.1_7 Reverse -36 -46 0.57002 0.294
NP_443059.1_10 Forward -110 -91 5.11187 0.198
NP_441842.1_1 Reverse -341 -354 10.4418 0.3
NP_441842.1_10 Forward -355 -341 14.2576 0.0632
NP_440275.1_3 Forward -350 -340 18.6629 0.0082
NP_440275.1_3 Reverse -337 -347 9.12481 0.055
NP_440091.1_1 Forward -352 -340 12.7237 0.0353
NP_440679.1_10 Reverse -86 -105 -9.34199 0.18
NP_440679.1_10 Reverse -95 -114 -11.8986 0.184
NP_443010.1_10 Forward -351 -334 4.02703 0.242
NP_439962.1_4 Forward -216 -197 -8.752 0.298
NP_440216.1_1 Reverse -339 -353 17.1092 0.00188
NP_440216.1_1 Forward -348 -334 -2.75368 0.0574
NP_440172.1_1 Forward -348 -338 17.5813 0.00421
NP_440172.1_1 Reverse -339 -349 17.5813 0.00421
NP_440172.1_1 Forward -170 -160 2.53664 0.277
NP_442371.1_1 Reverse -320 -330 15.7125 0.142
NP_442290.1_9 Reverse -35 -54 11.8975 0.287
NP_442015.1_10 Forward -252 -239 -0.37404 0.264
NP_441226.1_7 Forward -347 -340 14.4934 0.0123
NP_441226.1_7 Reverse -340 -347 14.4934 0.0123
NP_441111.1_7 Forward -347 -339 18.7023 0.00294
NP_441111.1_7 Reverse -340 -348 18.7023 0.00294
NP_442379.1_10 Forward -355 -338 7.61033 0.102
NP_441766.1_2 Forward -348 -339 17.5026 0.00297
NP_441766.1_2 Reverse -339 -348 17.5026 0.00297
NP_440416.1_1 Reverse -339 -358 2.85105 0.0785
NP_443052.1_8 Forward -358 -339 -12.5869 0.259
NP_443052.1_9 Forward -94 -75 3.6377 0.162
NP_443052.1_9 Forward -109 -90 -6.39206 0.282
NP_440072.1_5 Reverse -84 -102 1.29745 0.236
NP_442154.1_1 Reverse -82 -100 7.68896 0.0591
NP_442154.1_1 Reverse -91 -109 -5.09406 0.127
NP_442154.1_7 Reverse -312 -330 19.912 0.168
NP_440261.1_5 Reverse -340 -353 -1.25902 0.0687
NP_440261.1_5 Forward -347 -334 -2.93064 0.0983
NP_440261.1_5 Forward -101 -88 -5.19226 0.188
NP_440261.1_5 Reverse -162 -175 -10.5021 0.201
NP_440261.1_5 Reverse -208 -221 -12.2721 0.277
NP_440988.1_4 Reverse -74 -93 7.57094 0.295
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCATGTCCACCAAGAAACCCCTCAACGGGTCAGAAACCGCTACCGTCGAGAGGCGATCGCCTTAAAACAAATTTTTCCAGAACAAACCTTCAGCCTAGGGGATTTTGTGCGCCTTACTGTCAGTAATACCCTGAGCGATTACTATTACGCTTGGCAAAGCCAACAACTAATGACCCAACTATGGGCCATTCCCCAATTCCGGCTCATGCAATTCTGGGGAACCTATCAGGGCTATCACCAAAACAATTCCCTCAATCAGCAACTGCGCCAAACCTTCTATTATCCCCGCCCCATCAACACCATCACCCCCAACGTCCCCAGCAAAGACGCACTCAAAATCAACTACGCCCAAAGCGATACCCAGCTAGTGCCTGACCCCTCTCCTCCTTCCCCCCATCA

CDS

ATGACTGCTTACCACCTAATTGATATTTCCGTCGCCGTTCATCCGCAGCTTCCCCGCTGGCCAGGCAGTCCCGCCATCGAATTTCAGCCAGAACTAGACCTTGCCAACGGCGATATTGCCACCGACACTACTATTCACATGAGCGTTCACACCGGAACCCATGTGGATGCCCCCAGTCATTTTCTCCAGGGCGGTAAAACCGTTGAAACCCTGCCCCTCGAAACCCTCCTTGGCCCCGTCACCGTCATTGACCTCAGCCACGTCGATGCCATTGAACCCCACCATCTCGCCCAAGCCCCCATTCCAGATAGAACCCAGCGCCTGCTCATCCGCACCCGCAACTCCCTGCACTGGCAGCAGAATCAATCCGAATTTGACCCCAACTTTGTCGCCCTCACCGCTCAGGCCGCTCAATGGGTCGTTGAGCAGGGAATAAAATTAATTGGCATCGACTACCTATCCGTCCAACGCTTCCGCGATGACGCCACCACTCACCAAATCCTACTGGGGGCAGAAGTGATTATTATTGAGGAATTAAACCTCTACGCTGTCCAGCCTGGAGAGTATGAACTCATTTGTTTACCAATTAAGCTCCAAGGCTTAGAAGGCGCTCCTGCTAGGGTAATTTTAAAGACAGTCTCTAACTAA

Protein

MTAYHLIDISVAVHPQLPRWPGSPAIEFQPELDLANGDIATDTTIHMSVHTGTHVDAPSHFLQGGKTVETLPLETLLGPVTVIDLSHVDAIEPHHLAQAPIPDRTQRLLIRTRNSLHWQQNQSEFDPNFVALTAQAAQWVVEQGIKLIGIDYLSVQRFRDDATTHQILLGAEVIIIEELNLYAVQPGEYELICLPIKLQGLEGAPARVILKTVSN