Your browser is old and dusty. Try Google Chrome!

Details for slr2120

ORF slr2120
Accession NP_441377.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440897.1_6 Forward -146 -127 -4.72118 0.288
NP_441453.1_7 Reverse -198 -205 12.9205 0.23
NP_441623.1_6 Forward -107 -88 10.1275 0.298
NP_441818.1_9 Reverse -363 -382 -8.55534 0.277
NP_441816.1_5 Forward -116 -97 17.0107 0.175
NP_442752.1_4 Forward -201 -194 5.84064 0.166
NP_443027.1_4 Forward -325 -315 7.74818 0.235
NP_441812.1_1 Forward -378 -364 13.6669 0.231
NP_442975.1_10 Forward -258 -244 4.91554 0.234
NP_442975.1_10 Forward -179 -165 3.24392 0.26
NP_442909.1_7 Forward -283 -269 10.2254 0.14
NP_441054.1_2 Reverse -173 -192 11.6025 0.263
NP_440273.1_1 Forward -130 -111 15.708 0.243
NP_440856.1_4 Forward -184 -165 -0.983855 0.189
NP_440856.1_4 Forward -208 -189 -2.45882 0.211
NP_441738.1_2 Reverse -194 -201 8.20023 0.181
NP_440447.1_6 Reverse -160 -178 3.46073 0.195
NP_442111.1_3 Forward -182 -169 12.4757 0.287
NP_440747.1_1 Forward -148 -130 12.2122 0.198
NP_440057.1_6 Forward -119 -100 10.6956 0.289
NP_442848.1_1 Reverse -269 -283 -2.06536 0.263
NP_442687.1_7 Reverse -167 -177 4.99491 0.225
NP_442687.1_7 Forward -182 -172 4.0116 0.271
NP_441077.1_2 Forward -126 -107 6.63627 0.196
NP_441077.1_6 Reverse -9 -25 9.74316 0.167
NP_441077.1_6 Forward -82 -66 7.14018 0.233
NP_440642.1_10 Reverse -195 -209 5.40719 0.241
NP_440571.1_7 Reverse -115 -133 16.982 0.267
NP_442782.1_2 Reverse -168 -182 7.76774 0.202
NP_441414.1_6 Forward -241 -222 2.75272 0.227
NP_439919.1_5 Reverse -1 -15 15.9292 0.293
NP_442937.1_5 Forward -262 -243 8.16093 0.231
NP_441137.1_3 Reverse -43 -62 14.5621 0.273
NP_441441.1_4 Forward -106 -92 17.6985 0.279
NP_439905.1_1 Reverse -257 -270 7.29578 0.263
NP_441377.1_1 Forward -383 -365 25.8802 0.0103
NP_441377.1_2 Forward -236 -217 28.8104 0.00129
NP_441377.1_3 Forward -360 -344 27.0996 0.00287
NP_441377.1_4 Forward -145 -128 22.36 0.0219
NP_441377.1_5 Forward -197 -178 24.0905 0.0325
NP_441377.1_6 Forward -326 -307 26.2538 0.00615
NP_441377.1_7 Forward -112 -93 24.1889 0.0336
NP_441377.1_8 Forward -268 -249 25.2705 0.0205
NP_442690.1_1 Reverse -169 -188 -3.83545 0.142
NP_442690.1_1 Reverse -109 -128 -3.93378 0.144
NP_442690.1_1 Reverse -377 -396 -16.1268 0.283
NP_442571.1_9 Reverse -128 -147 15.5357 0.115
NP_441099.1_5 Reverse -282 -301 -8.06369 0.187
NP_441099.1_8 Forward -49 -31 19.2912 0.141
NP_442002.1_9 Forward -182 -175 9.77388 0.258
NP_442996.1_1 Forward -130 -111 7.30471 0.211
NP_442004.1_6 Forward -284 -270 1.67122 0.283
NP_440780.1_1 Forward -122 -103 8.83258 0.274
NP_440919.1_1 Forward -229 -210 -8.16202 0.286
NP_440397.1_3 Reverse -177 -196 12.2908 0.231
NP_442719.1_2 Reverse -124 -142 -10.3063 0.272
NP_440051.1_5 Reverse -152 -166 15.7108 0.206
NP_441445.1_10 Forward -339 -320 15.0441 0.261
NP_442183.1_1 Reverse -160 -174 4.81781 0.245
NP_441037.1_4 Reverse -166 -176 11.0211 0.17
NP_442764.1_8 Reverse -222 -241 4.71934 0.242
NP_442998.1_5 Forward -134 -124 12.8614 0.158
NP_442802.1_2 Reverse -253 -272 15.2399 0.212
NP_441090.1_6 Reverse -233 -247 7.37441 0.298
NP_440537.1_7 Reverse -311 -330 11.7928 0.237
NP_442327.1_3 Reverse -98 -117 6.54077 0.26
NP_440327.1_6 Forward -339 -320 12.2908 0.168
NP_440586.1_8 Reverse -266 -273 9.18354 0.171
NP_440439.1_6 Forward -25 -6 1.17943 0.286
NP_441789.1_7 Forward -247 -228 -3.24622 0.27
NP_440819.1_5 Forward -134 -126 7.59091 0.272
NP_441803.1_2 Reverse -240 -259 -1.18052 0.294
NP_440210.1_3 Reverse -131 -150 21.1406 0.0996
NP_440699.1_8 Reverse -211 -230 12.2908 0.156
NP_442917.1_1 Forward -128 -109 10.52 0.181
NP_440575.1_1 Forward -221 -202 9.83173 0.191
NP_441834.1_1 Reverse -90 -109 12.9791 0.291
NP_440936.1_10 Reverse -109 -128 -2.0535 0.241
NP_442204.1_1 Forward -205 -194 2.71361 0.266
NP_441052.1_2 Forward -254 -244 3.61828 0.177
NP_441004.1_1 Reverse -125 -144 -16.8151 0.287
NP_440328.1_4 Reverse -357 -376 0.687771 0.243
NP_442208.1_5 Forward -239 -220 4.52268 0.245
NP_442939.1_5 Reverse -104 -118 21.2602 0.0288
NP_440593.1_3 Forward -247 -228 -7.4737 0.295
NP_441982.1_6 Forward -135 -126 11.6259 0.288
NP_440338.1_4 Forward -129 -110 6.29183 0.29
NP_442689.1_8 Reverse -113 -130 -0.0594896 0.193
NP_442689.1_8 Reverse -173 -190 -7.92597 0.292
NP_442689.1_8 Reverse -381 -398 -8.12263 0.292
NP_442843.1_7 Forward -124 -106 13.9499 0.3
NP_440040.1_8 Reverse -25 -44 11.0289 0.203
NP_442006.1_2 Reverse -239 -256 -18.8407 0.296
NP_441570.1_1 Forward -284 -266 -9.51896 0.139
NP_441432.1_9 Reverse -96 -109 8.30749 0.29
NP_440497.1_2 Forward -283 -264 3.53937 0.295
NP_440713.1_4 Reverse -265 -284 1.47442 0.286
NP_442749.1_5 Reverse -92 -109 8.22369 0.245
NP_440250.1_4 Reverse -110 -129 2.45694 0.288
NP_440010.1_4 Reverse -265 -284 1.76863 0.227
NP_441943.1_8 Forward -209 -190 -12.5869 0.261
NP_440449.1_6 Forward -103 -85 6.01878 0.263
NP_441329.1_6 Reverse -18 -37 -0.621121 0.278
NP_442943.1_1 Forward -118 -103 4.06266 0.24
NP_442943.1_1 Reverse -102 -117 3.58414 0.264
NP_442943.1_1 Reverse -103 -118 3.29703 0.278
NP_440875.1_9 Reverse -194 -204 8.95605 0.233
NP_442772.1_6 Forward -121 -102 14.4398 0.286
NP_440462.1_6 Forward -203 -193 4.3066 0.205
NP_442479.1_9 Forward -120 -101 -6.88371 0.266
NP_442402.1_4 Reverse -116 -135 -8.55607 0.283
NP_442402.1_10 Reverse -125 -135 13.4509 0.202
NP_442402.1_10 Reverse -218 -228 10.1076 0.3
NP_441848.1_4 Forward -128 -112 10.0335 0.265
NP_441848.1_4 Forward -188 -172 7.64616 0.288
NP_442039.1_7 Forward -137 -127 12.4681 0.231
NP_442039.1_7 Forward -272 -262 7.05986 0.283
NP_442679.1_1 Reverse -13 -32 -4.6221 0.283
NP_442532.1_4 Forward -37 -19 8.06189 0.289
NP_442532.1_4 Forward -190 -172 7.48014 0.297
NP_441408.2_7 Reverse -263 -282 -3.54046 0.274
NP_441011.1_8 Forward -253 -244 7.57121 0.17
NP_441697.1_5 Reverse -10 -29 -4.72727 0.222
NP_441527.1_4 Reverse -10 -29 -12.9396 0.296
NP_440007.1_9 Forward -143 -129 7.17775 0.213
NP_441972.1_5 Forward -385 -366 -8.85033 0.272
NP_441886.1_2 Forward -234 -215 10.4225 0.163
NP_441930.1_3 Forward -111 -92 5.07931 0.266
NP_440886.1_7 Forward -255 -245 4.69947 0.22
NP_442717.1_4 Reverse -152 -171 5.70265 0.186
NP_441463.1_2 Reverse -103 -121 8.92443 0.14
NP_442893.1_4 Forward -69 -50 0.785326 0.22
NP_440114.1_10 Forward -328 -314 8.94771 0.19
NP_441853.1_5 Forward -327 -308 0.392778 0.283
NP_440287.1_5 Forward -254 -235 8.4551 0.286
NP_440766.1_5 Forward -135 -123 7.36932 0.29
NP_442930.1_1 Forward -26 -16 13.0576 0.239
NP_442297.1_4 Forward -205 -186 14.7667 0.183
NP_441489.1_3 Reverse -23 -37 6.98253 0.287
NP_441173.1_9 Reverse -127 -135 14.3753 0.161
NP_442395.2_9 Forward -72 -56 14.6115 0.226
NP_441207.1_7 Forward -131 -117 9.44903 0.28
NP_441207.1_7 Forward -80 -66 8.57771 0.282
NP_442495.1_4 Forward -105 -95 13.8447 0.184
NP_441875.1_4 Forward -247 -228 15.9282 0.182
NP_440172.1_1 Reverse -100 -110 1.84832 0.294
NP_441226.1_7 Reverse -131 -138 6.52862 0.253
NP_442116.1_6 Forward -189 -172 6.92756 0.271
NP_442116.1_6 Forward -119 -102 6.4501 0.278
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGCCAAACTTTAGCTACACTCACCACGATATGGTCAACTACATGACAGAGCGTGGTTACATCACCTACATTTCGGAATGGGATGTTATCAAAGAGTATGGACGCTCCGGACAGACTAGCGAGCCTCATCGTTGGCTACAATGTGTCCGTTATCCCCTTAACCATGAACCAGCCTGGGGGAATCTGATCTTTATTACCCAGGGGAACGAATCAAAATTCGAGCAAACGTTAGCCCAATATCTAGAAAAATCGAAACATCAAGACCGTTGGGAAAAACTAAAGCAAATCTTTAAAAAATTGCCTGGAGTTCATGCTCTCTATCAGAAATTAAAATCAGGGTTTAAATCAATCTAGTCAATTATTGAATTATTCTCTAAATTATTCACTCTTTTCACACCAGA

CDS

ATGCCCCTTGTCTCCCTAATTATTCGTTGTTACAACGAAGAAAAACACATTGGCCGCTTGCTCAGCGGCGTTATGCAGCAACAGGGCATCGACTACGAAATTATTATCGTGGACTCCGGCTCAACCGACGCCACCGTCAGCATTGCCCAACGCTATCCCATTCAACTCATCAGCATCGACCCCCAAAACTTTTCCTTTGGGCGCTCCCTCAATCTCGGATGCCAACAAGCTAGCGGTGAATATCTAGTTTTTGCCAGTGCCCACGTCTATCCCGTTTACCAAGACTGGCTTAAACAACTGATTGCCCCCCTGCAAACCAATCCCCAGATTGCCCTCAGCTACGGCAAACAACGGGGCAACAACCAAACCCAATTTTCCGAACATCAAATCTTTGCCCAGTGGTTCCCCGACCAAGCTCAGATTCCCCAAACCACTCCCTTTTGTAACAACGCCAATGCCGCCATTCGCCGTGACCTGTGGCAAAAATATCCCTACAACGAAGACCTGACCGGCCTAGAAGACCTGGACTGGGCCAAACGTCTTATGCAAGCCGGTTATCAAATCGCCTACGTCCCCGACGCCGAAATTATCCATGTCCACCAAGAAACCCCTCAACGGGTCAGAAACCGCTACCGTCGAGAGGCGATCGCCTTAAAACAAATTTTTCCAGAACAAACCTTCAGCCTAGGGGATTTTGTGCGCCTTACTGTCAGTAATACCCTGAGCGATTACTATTACGCTTGGCAAAGCCAACAACTAATGACCCAACTATGGGCCATTCCCCAATTCCGGCTCATGCAATTCTGGGGAACCTATCAGGGCTATCACCAAAACAATTCCCTCAATCAGCAACTGCGCCAAACCTTCTATTATCCCCGCCCCATCAACACCATCACCCCCAACGTCCCCAGCAAAGACGCACTCAAAATCAACTACGCCCAAAGCGATACCCAGCTAGTGCCTGACCCCTCTCCTCCTTCCCCCCATCAATGA

Protein

MPLVSLIIRCYNEEKHIGRLLSGVMQQQGIDYEIIIVDSGSTDATVSIAQRYPIQLISIDPQNFSFGRSLNLGCQQASGEYLVFASAHVYPVYQDWLKQLIAPLQTNPQIALSYGKQRGNNQTQFSEHQIFAQWFPDQAQIPQTTPFCNNANAAIRRDLWQKYPYNEDLTGLEDLDWAKRLMQAGYQIAYVPDAEIIHVHQETPQRVRNRYRREAIALKQIFPEQTFSLGDFVRLTVSNTLSDYYYAWQSQQLMTQLWAIPQFRLMQFWGTYQGYHQNNSLNQQLRQTFYYPRPINTITPNVPSKDALKINYAQSDTQLVPDPSPPSPHQ