Your browser is old and dusty. Try Google Chrome!

Details for slr2117

ORF slr2117
Accession NP_441374.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442657.1_1 Forward -146 -129 14.1849 0.196
NP_442272.1_2 Forward -66 -47 16.8539 0.15
NP_440897.1_6 Reverse -369 -388 0.588665 0.179
NP_441623.1_3 Reverse -192 -211 16.5993 0.199
NP_441630.1_3 Reverse -182 -201 0.392778 0.277
NP_440259.1_4 Reverse -60 -74 11.046 0.262
NP_440304.1_9 Forward -127 -108 17.7974 0.235
NP_441925.1_2 Reverse -162 -181 3.73603 0.262
NP_441434.1_1 Forward -172 -158 7.93745 0.26
NP_441434.1_6 Forward -172 -162 15.5163 0.277
NP_441716.1_2 Reverse -130 -149 2.97284 0.234
NP_440842.1_4 Reverse -158 -177 8.75086 0.115
NP_441077.1_6 Reverse -230 -246 12.3461 0.136
NP_441077.1_6 Forward -72 -56 11.9605 0.136
NP_442816.1_7 Reverse -57 -76 4.24897 0.279
NP_442690.1_1 Reverse -126 -145 -6.29373 0.166
NP_442690.1_1 Reverse -54 -73 -11.2103 0.225
NP_442690.1_1 Reverse -32 -51 -13.7669 0.265
NP_441913.1_3 Forward -143 -130 15.436 0.218
NP_441654.1_6 Reverse -53 -71 16.4266 0.186
NP_441654.1_6 Reverse -52 -70 15.0897 0.229
NP_442598.1_2 Reverse -37 -46 14.2577 0.252
NP_442431.1_10 Reverse -363 -381 1.39578 0.254
NP_441079.1_7 Reverse -52 -71 3.9319 0.167
NP_441079.1_7 Forward -250 -231 2.35861 0.177
NP_441079.1_7 Forward -73 -54 -0.0996487 0.195
NP_441079.1_7 Forward -72 -53 -1.47628 0.204
NP_442500.1_8 Forward -81 -67 16.6376 0.137
NP_442500.1_8 Forward -355 -341 13.7454 0.191
NP_440780.1_1 Reverse -229 -248 8.92807 0.274
NP_442933.1_1 Reverse -61 -80 8.35512 0.253
NP_442933.1_2 Forward -78 -60 12.9889 0.227
NP_442970.1_1 Forward -362 -348 11.6616 0.269
NP_442970.1_3 Reverse -127 -145 15.1251 0.168
NP_441726.1_7 Forward -31 -12 5.30933 0.259
NP_440464.1_10 Forward -234 -224 13.5811 0.169
NP_441731.1_1 Reverse -44 -62 12.225 0.292
NP_441517.1_3 Forward -360 -341 20.5604 0.0875
NP_441612.1_2 Reverse -202 -212 11.5505 0.21
NP_442427.1_8 Forward -179 -160 4.71934 0.298
NP_441911.1_10 Forward -77 -58 10.7764 0.226
NP_442903.1_2 Forward -78 -59 5.20389 0.196
NP_442903.1_2 Forward -79 -60 3.38954 0.245
NP_442356.1_2 Forward -361 -342 13.9877 0.288
NP_440084.1_8 Reverse -47 -61 11.6616 0.241
NP_441458.1_8 Reverse -44 -63 4.31043 0.267
NP_440248.1_1 Reverse -149 -168 19.6656 0.23
NP_441819.1_5 Reverse -160 -179 10.8379 0.261
NP_442998.1_5 Reverse -187 -197 9.51814 0.238
NP_440299.1_1 Forward -187 -174 2.96866 0.265
NP_441799.1_1 Reverse -170 -184 4.52221 0.247
NP_441449.1_8 Reverse -378 -397 13.5013 0.286
NP_442961.1_4 Reverse -71 -90 3.34271 0.288
NP_440329.1_4 Reverse -128 -142 17.7815 0.255
NP_440306.1_8 Forward -151 -132 6.78348 0.204
NP_442327.1_3 Reverse -32 -51 10.7424 0.199
NP_442474.1_6 Reverse -127 -146 9.83255 0.219
NP_443051.1_5 Forward -72 -53 13.3725 0.195
NP_441138.1_5 Reverse -61 -74 15.3405 0.0882
NP_441293.1_3 Forward -357 -339 13.6573 0.291
NP_440139.1_1 Forward -384 -365 2.35861 0.235
NP_442114.1_8 Forward -72 -58 13.4703 0.213
NP_441877.1_9 Reverse -340 -357 2.69378 0.285
NP_440350.1_5 Reverse -65 -84 -4.81876 0.284
NP_440350.1_5 Reverse -62 -81 -7.08038 0.299
NP_441778.1_10 Reverse -107 -125 16.344 0.217
NP_442454.1_2 Forward -176 -157 7.01823 0.291
NP_440575.1_1 Forward -216 -197 3.83357 0.253
NP_442710.1_7 Forward -70 -51 -0.591167 0.213
NP_442710.1_7 Reverse -230 -249 -1.55227 0.221
NP_442710.1_7 Forward -73 -54 -5.10833 0.279
NP_441410.1_3 Reverse -270 -289 5.80098 0.23
NP_440454.1_2 Forward -77 -63 10.5157 0.291
NP_442872.1_1 Forward -298 -279 -9.24366 0.241
NP_440728.1_1 Forward -51 -32 11.2084 0.268
NP_442515.1_1 Reverse -225 -239 -3.34366 0.29
NP_441982.1_10 Forward -228 -209 5.80018 0.291
NP_442689.1_8 Reverse -130 -147 -0.452814 0.202
NP_442689.1_8 Reverse -36 -53 -2.81276 0.235
NP_441124.1_5 Forward -252 -242 11.7668 0.245
NP_440431.1_4 Forward -76 -57 6.06331 0.0717
NP_440431.1_4 Forward -77 -58 0.524783 0.167
NP_440431.1_4 Forward -80 -61 -8.83343 0.275
NP_440431.1_7 Reverse -53 -72 11.9958 0.0785
NP_442038.1_1 Forward -144 -125 1.47442 0.278
NP_440793.1_1 Reverse -59 -73 8.55376 0.295
NP_441432.1_9 Reverse -60 -73 10.4405 0.249
NP_441432.1_9 Forward -41 -28 9.37402 0.28
NP_441432.1_9 Reverse -31 -44 8.40445 0.289
NP_441333.1_1 Reverse -58 -68 14.7357 0.208
NP_442400.1_10 Reverse -314 -327 15.054 0.173
NP_442400.1_10 Forward -134 -121 8.0831 0.279
NP_441022.1_1 Reverse -52 -61 15.9587 0.163
NP_441022.1_1 Forward -63 -54 13.2728 0.216
NP_441022.1_1 Reverse -31 -40 10.587 0.294
NP_440335.1_9 Forward -75 -57 9.55725 0.294
NP_442027.1_4 Reverse -32 -51 20.4826 0.103
NP_441329.1_6 Forward -79 -60 9.02356 0.139
NP_441329.1_6 Forward -80 -61 5.58586 0.191
NP_441329.1_6 Forward -354 -335 1.67069 0.232
NP_441329.1_6 Forward -136 -117 0.429291 0.254
NP_441329.1_6 Forward -148 -129 -3.1994 0.298
NP_442943.1_1 Forward -60 -45 5.0197 0.216
NP_442943.1_1 Reverse -164 -179 4.73258 0.221
NP_442028.1_1 Reverse -57 -70 16.4864 0.251
NP_442028.1_1 Reverse -56 -69 7.70113 0.289
NP_442028.1_1 Reverse -55 -68 6.65072 0.298
NP_442568.1_8 Forward -72 -58 11.2093 0.257
NP_441541.1_1 Reverse -39 -57 0.574937 0.228
NP_440212.1_9 Forward -71 -52 8.34607 0.146
NP_440212.1_9 Reverse -25 -44 3.92505 0.213
NP_440212.1_9 Reverse -49 -68 0.753444 0.289
NP_442402.1_4 Forward -150 -131 -7.08111 0.27
NP_441848.1_4 Forward -52 -36 9.74698 0.275
NP_439942.1_2 Forward -76 -57 12.9875 0.267
NP_442679.1_1 Forward -79 -60 1.17943 0.185
NP_442679.1_1 Forward -82 -63 -2.65548 0.242
NP_442829.1_2 Forward -77 -61 10.0738 0.287
NP_441102.1_2 Reverse -324 -343 7.96426 0.298
NP_440013.1_1 Reverse -118 -137 14.1583 0.126
NP_440263.1_5 Forward -311 -297 8.16106 0.294
NP_440854.1_5 Reverse -27 -41 16.4362 0.274
NP_440854.1_5 Forward -45 -31 15.8633 0.274
NP_440854.1_5 Reverse -158 -172 14.0489 0.295
NP_442597.1_9 Reverse -32 -51 17.3569 0.226
NP_441697.1_5 Reverse -153 -172 -0.143661 0.198
NP_441697.1_5 Forward -70 -51 -3.67686 0.218
NP_441697.1_5 Reverse -52 -71 -11.3162 0.295
NP_441697.1_5 Reverse -44 -63 -11.4117 0.295
NP_441697.1_5 Reverse -43 -62 -11.6982 0.298
NP_441527.1_4 Forward -79 -60 14.3711 0.0458
NP_441527.1_4 Forward -78 -59 11.4109 0.0593
NP_441527.1_4 Reverse -191 -210 6.34979 0.1
NP_441527.1_4 Forward -80 -61 4.53544 0.111
NP_441527.1_4 Forward -81 -62 2.05265 0.131
NP_441527.1_4 Forward -77 -58 -2.33998 0.156
NP_441527.1_4 Forward -88 -69 -8.35597 0.243
NP_441527.1_4 Forward -87 -68 -8.83343 0.251
NP_441527.1_4 Forward -85 -66 -9.78835 0.262
NP_441527.1_4 Forward -136 -117 -11.2207 0.278
NP_441527.1_4 Forward -75 -56 -11.3162 0.281
NP_441527.1_4 Forward -82 -63 -11.5072 0.282
NP_442306.1_10 Forward -309 -290 -10.9153 0.111
NP_440103.1_3 Forward -236 -226 17.2211 0.286
NP_441463.1_3 Forward -376 -357 -6.09707 0.239
NP_442842.1_5 Forward -184 -165 11.6017 0.294
NP_441431.1_2 Forward -186 -172 5.70218 0.291
NP_442090.1_2 Forward -57 -38 22.2969 0.0789
NP_442090.1_2 Reverse -40 -59 12.8432 0.214
NP_442698.1_10 Forward -88 -69 0.491109 0.297
NP_441421.1_9 Forward -144 -125 6.4893 0.226
NP_440987.1_6 Reverse -51 -70 11.2034 0.247
NP_441489.1_3 Forward -143 -129 8.03294 0.244
NP_442936.1_10 Reverse -31 -45 10.7951 0.233
NP_442703.1_1 Reverse -226 -245 5.20389 0.289
NP_442703.1_9 Forward -77 -59 5.23069 0.244
NP_442703.1_9 Reverse -240 -258 5.03403 0.244
NP_442451.1_7 Forward -75 -56 8.45592 0.27
NP_441635.1_1 Forward -70 -51 4.53544 0.273
NP_441635.1_2 Reverse -159 -178 10.074 0.283
NP_441207.1_7 Forward -80 -66 18.259 0.179
NP_439929.1_4 Forward -103 -89 18.9514 0.234
NP_442116.1_6 Forward -51 -34 16.3813 0.11
NP_442116.1_6 Forward -180 -163 12.7526 0.172
NP_442116.1_6 Reverse -164 -181 8.74191 0.241
NP_442116.1_6 Forward -362 -345 8.26445 0.254
NP_442116.1_6 Reverse -241 -258 7.30953 0.259
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGAAGCTCGATTTTTTCGTACCGACATCAGGACTATCATTTCCTAAAAAAATATTAGATAGGATATTTCCAATTCCTATCAAGTTTATAATTGCAGCAGATTCCTACATCATGAGAACCGCTTGTGTATTTAACATGGTATATTCTATTCCAAAATCTTTAGGTTTTTATCGTCAACATGATAATACTGTTTTTCTTAATCCCGATTTTGACCTGCAGCCATTTCTTAAAGAAATTTTAATTCCTGAGTTGAATCAATTTTATCAAAAATACAGGATAAACTATCAAATTGAAATATCAGACTACAATTTCAATGAGCGGAAAAAGAATAAAAAACAAAAAATTTTTGAATATCTAAAAAAAGTCTTTTTTTAAAGGAGGCATCAACTTGTTACTTTCT

CDS

ATGCTAATCACAAAACAATTATTCTTGTCTATAAAAAGCAAAGTTAAATTTTATTTATGGTATCTAAAATATGCCCTTAAACTGGCTTCTTTTAAAAACATTCATCAGGGAGAGGATTGTTTTATTATTGGGAATGGTCCCTCTCTCAATAAAATGGATTTGGCAAAACTAAATCAATATTATACCTTCGGACTCAATAAGATTTACTTGATTTTTGAGCGAGTTGATTTAAGTTTAAGTTATTATGTAACAGTTAATCGTTTGGTCATCGAACAATGTCAAAATGAAATTCAGAATTTTCGTTGTCCTTGCTTTCTTGAATTTACAAAATCAAAAGATATTATACCCTTCAAAGAGAATATTTATCGTTTAGCTACAACGGGAAGACCTTATATGTTTCAAACAGATATTACCCAAAAAATATGTGAAGGAAATACTGTAACTTATGTTGCCATGCAGCTTGCCTACTATATGGGGTTCAAAAGAGTCTTTTTGATCGGAGTAGATCACAACTTTAAATATTCAGGAAATCCTAATGAATCCTAA

Protein

MLITKQLFLSIKSKVKFYLWYLKYALKLASFKNIHQGEDCFIIGNGPSLNKMDLAKLNQYYTFGLNKIYLIFERVDLSLSYYVTVNRLVIEQCQNEIQNFRCPCFLEFTKSKDIIPFKENIYRLATTGRPYMFQTDITQKICEGNTVTYVAMQLAYYMGFKRVFLIGVDHNFKYSGNPNES