Your browser is old and dusty. Try Google Chrome!

Details for slr2103

ORF slr2103
Accession NP_441317.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -271 -257 6.78443 0.114
NP_441061.1_2 Reverse -114 -128 5.30946 0.138
NP_441061.1_2 Forward -127 -113 -0.0987402 0.221
NP_440795.1_7 Forward -121 -114 10.2655 0.154
NP_440795.1_7 Forward -133 -126 6.92228 0.26
NP_441418.1_6 Forward -134 -115 -20.8467 0.129
NP_441418.1_6 Forward -131 -112 -30.0898 0.256
NP_442272.1_2 Forward -330 -311 12.3658 0.219
NP_440295.1_2 Forward -110 -91 6.4893 0.283
NP_441453.1_4 Reverse -113 -121 4.05099 0.268
NP_441623.1_1 Forward -114 -96 -5.09406 0.283
NP_441960.1_4 Forward -280 -264 13.5292 0.241
NP_440150.1_6 Forward -125 -106 2.45773 0.27
NP_440996.1_3 Reverse -268 -286 9.0656 0.287
NP_441225.1_1 Reverse -265 -284 -9.34199 0.295
NP_440110.1_8 Forward -133 -114 -1.18052 0.237
NP_441476.1_5 Reverse -186 -205 -1.08219 0.2
NP_441476.1_5 Reverse -114 -133 -2.26216 0.224
NP_439979.1_2 Forward -134 -115 8.25926 0.258
NP_439979.1_9 Forward -133 -115 12.9988 0.227
NP_442062.1_8 Reverse -113 -123 4.50326 0.212
NP_441900.1_2 Reverse -346 -364 -5.38976 0.288
NP_441035.1_3 Forward -245 -226 -0.4922 0.292
NP_441619.1_8 Reverse -296 -310 14.2569 0.114
NP_440307.1_2 Reverse -118 -137 1.17943 0.285
NP_441594.1_6 Reverse -341 -360 0.58944 0.282
NP_440132.1_1 Forward -136 -118 11.2289 0.207
NP_440132.1_1 Forward -124 -106 9.95058 0.224
NP_442110.1_7 Reverse -113 -127 -0.197071 0.276
NP_441925.1_4 Reverse -120 -139 -15.1442 0.263
NP_441083.1_3 Forward -123 -113 15.2208 0.138
NP_441083.1_5 Reverse -113 -123 0.963343 0.218
NP_441083.1_5 Forward -122 -112 0.176696 0.241
NP_441434.1_1 Reverse -318 -332 8.60589 0.254
NP_441558.1_5 Forward -124 -105 5.89931 0.236
NP_440056.1_1 Forward -205 -186 11.7992 0.174
NP_441770.1_5 Forward -319 -300 -2.45882 0.296
NP_440053.1_2 Reverse -262 -281 11.5042 0.291
NP_440538.1_10 Reverse -117 -136 12.6841 0.235
NP_441624.1_7 Forward -128 -114 7.86607 0.241
NP_441624.1_7 Reverse -134 -148 6.29277 0.286
NP_441163.1_1 Forward -288 -271 5.15133 0.28
NP_440747.1_10 Forward -125 -113 7.4138 0.00422
NP_440747.1_10 Reverse -110 -122 -4.09092 0.078
NP_442634.1_4 Forward -78 -64 5.70279 0.0525
NP_440403.1_10 Reverse -254 -273 3.14605 0.278
NP_441014.1_8 Reverse -120 -139 -1.86883 0.224
NP_441014.1_9 Forward -137 -118 11.6025 0.174
NP_442848.1_5 Reverse -118 -136 10.4422 0.232
NP_441012.1_4 Reverse -121 -134 16.7355 0.15
NP_441012.1_4 Reverse -115 -128 13.0973 0.224
NP_443018.1_3 Forward -121 -114 4.36568 0.254
NP_443018.1_3 Reverse -114 -121 4.07068 0.299
NP_441634.1_8 Forward -196 -182 2.75286 0.163
NP_441634.1_8 Reverse -261 -275 -3.147 0.295
NP_441634.1_8 Forward -124 -110 -3.83532 0.295
NP_440376.1_1 Reverse -113 -122 7.37455 0.0786
NP_440376.1_1 Forward -122 -113 7.07956 0.0869
NP_440376.1_1 Reverse -263 -272 0.884706 0.259
NP_442687.1_7 Reverse -112 -122 14.7297 0.0256
NP_442687.1_7 Reverse -124 -134 3.91327 0.278
NP_442191.1_7 Forward -137 -118 17.2074 0.206
NP_442485.1_3 Forward -133 -114 5.50599 0.169
NP_442485.1_3 Reverse -123 -142 2.65439 0.209
NP_441846.1_10 Forward -148 -129 -20.4534 0.256
NP_441846.1_10 Forward -354 -335 -22.9117 0.271
NP_441422.1_7 Forward -113 -96 -2.51776 0.215
NP_440533.1_9 Reverse -113 -132 2.3594 0.28
NP_440667.1_2 Reverse -263 -282 -8.45701 0.289
NP_441950.1_7 Forward -362 -343 -8.65367 0.287
NP_441950.1_7 Forward -134 -115 -9.14533 0.293
NP_442296.1_5 Reverse -104 -123 12.4875 0.146
NP_440141.1_4 Forward -131 -112 -3.44213 0.296
NP_442782.1_2 Reverse -211 -225 2.65453 0.275
NP_442300.1_3 Forward -123 -104 13.7658 0.0529
NP_441256.1_1 Reverse -116 -135 -5.60541 0.233
NP_442937.1_5 Reverse -153 -172 12.8808 0.0991
NP_442937.1_5 Forward -367 -348 8.16093 0.231
NP_442937.1_5 Forward -127 -108 7.66927 0.244
NP_442937.1_5 Reverse -258 -277 6.29264 0.282
NP_441958.1_5 Reverse -112 -122 1.16001 0.114
NP_441958.1_5 Forward -123 -113 -6.90313 0.293
NP_441127.1_1 Reverse -182 -196 10.226 0.255
NP_442486.1_6 Reverse -107 -126 -3.73712 0.266
NP_440203.1_5 Forward -269 -259 14.2375 0.0886
NP_440203.1_5 Reverse -64 -74 9.12434 0.271
NP_439905.1_1 Forward -193 -180 7.00078 0.269
NP_442911.1_2 Forward -201 -182 -7.27704 0.205
NP_442911.1_2 Reverse -103 -122 -10.817 0.289
NP_440153.1_8 Reverse -119 -132 6.90245 0.17
NP_440153.1_8 Reverse -113 -126 -3.02898 0.276
NP_442064.1_4 Reverse -253 -272 4.91521 0.283
NP_442536.1_1 Forward -45 -26 6.58763 0.156
NP_443055.1_6 Forward -280 -262 5.03327 0.181
NP_440993.1_3 Reverse -337 -356 -0.0996487 0.26
NP_440934.1_4 Forward -322 -303 15.9291 0.169
NP_442002.1_1 Forward -183 -165 -8.63398 0.27
NP_441294.1_7 Forward -276 -262 9.92255 0.219
NP_441294.1_7 Reverse -109 -123 8.48272 0.298
NP_440411.1_10 Forward -136 -117 15.5316 0.194
NP_442438.1_10 Forward -127 -113 4.42448 0.147
NP_442438.1_10 Reverse -50 -64 -0.295402 0.256
NP_441000.1_5 Reverse -144 -163 5.70185 0.251
NP_440147.1_4 Reverse -111 -124 9.06573 0.0437
NP_441550.1_8 Reverse -111 -121 4.99446 0.274
NP_441916.1_7 Forward -122 -112 4.69992 0.163
NP_440383.1_1 Forward -82 -63 15.8307 0.0273
NP_440465.1_10 Forward -137 -118 -0.000545616 0.29
NP_441041.1_4 Forward -122 -103 7.47261 0.0387
NP_441041.1_4 Forward -134 -115 6.58763 0.042
NP_441041.1_4 Forward -82 -63 -9.83364 0.223
NP_442004.1_6 Forward -134 -120 9.2427 0.14
NP_439966.1_7 Forward -274 -264 4.20782 0.285
NP_440736.1_3 Forward -73 -54 -1.08219 0.282
NP_442941.1_3 Reverse -114 -124 -0.118297 0.249
NP_440674.1_3 Forward -391 -372 1.67108 0.277
NP_440983.1_5 Reverse -113 -132 6.78429 0.169
NP_440983.1_5 Forward -278 -259 -8.26035 0.294
NP_440260.1_8 Forward -131 -113 -2.83245 0.246
NP_440260.1_8 Forward -176 -158 -3.6191 0.253
NP_441514.1_6 Forward -77 -70 14.2971 0.248
NP_441678.1_4 Forward -187 -168 13.9625 0.16
NP_442281.1_1 Forward -127 -113 2.94893 0.249
NP_441079.1_7 Forward -335 -316 1.17865 0.18
NP_442012.1_1 Reverse -119 -138 9.0459 0.0986
NP_442012.1_2 Forward -124 -105 2.94938 0.239
NP_442049.1_4 Forward -225 -206 -5.99873 0.279
NP_442982.1_5 Forward -164 -145 -1.37718 0.266
NP_440375.1_8 Forward -319 -300 -1.47551 0.288
NP_441644.1_6 Forward -122 -112 11.3859 0.0502
NP_441644.1_6 Reverse -113 -123 6.0761 0.167
NP_441644.1_6 Forward -272 -262 3.22451 0.293
NP_443049.1_6 Reverse -262 -272 11.7385 0.24
NP_442215.1_2 Forward -241 -225 0.156866 0.156
NP_442215.1_2 Reverse -111 -127 -4.46469 0.233
NP_442177.1_5 Forward -131 -117 10.226 0.229
NP_442933.1_10 Forward -122 -113 5.11294 0.204
NP_441751.2_8 Reverse -114 -128 -4.4253 0.173
NP_442926.1_1 Forward -134 -115 4.52268 0.151
NP_442554.1_8 Reverse -120 -130 6.46988 0.117
NP_442554.1_8 Reverse -114 -124 5.5849 0.145
NP_442554.1_8 Forward -121 -111 3.71661 0.215
NP_442142.1_4 Reverse -116 -129 17.1282 0.0264
NP_442142.1_4 Reverse -110 -123 2.57534 0.286
NP_442292.1_1 Reverse -114 -123 5.99792 0.125
NP_442381.1_7 Forward -121 -108 17.3255 0.26
NP_443009.1_5 Reverse -124 -135 4.08976 0.263
NP_442301.1_2 Reverse -118 -137 14.5516 0.117
NP_442301.1_2 Reverse -112 -131 6.29183 0.263
NP_440379.1_5 Forward -137 -118 -5.21209 0.221
NP_441468.1_1 Forward -121 -114 4.46401 0.224
NP_441618.1_7 Reverse -146 -165 15.0576 0.295
NP_441020.2_6 Forward -136 -119 17.1484 0.0211
NP_441015.1_9 Forward -281 -268 18.7015 0.178
NP_441015.1_10 Forward -133 -114 3.73603 0.133
NP_441015.1_10 Forward -127 -108 -4.22878 0.201
NP_441015.1_10 Forward -154 -135 -5.9004 0.235
NP_441015.1_10 Forward -358 -339 -7.17871 0.264
NP_441673.1_1 Forward -122 -113 1.67135 0.0404
NP_441673.1_1 Reverse -113 -122 1.47469 0.0936
NP_441956.1_9 Forward -129 -110 8.94757 0.25
NP_442490.1_9 Reverse -113 -132 1.17943 0.167
NP_442490.1_9 Reverse -296 -315 -6.98204 0.275
NP_442868.1_6 Forward -124 -114 0.0783647 0.248
NP_442868.1_6 Reverse -111 -121 0.0783647 0.248
NP_441056.1_1 Reverse -113 -132 -7.4737 0.272
NP_442227.1_2 Reverse -127 -146 -2.0655 0.27
NP_442808.1_1 Forward -273 -263 15.6142 0.0219
NP_442113.1_10 Forward -276 -257 1.67108 0.192
NP_442050.1_1 Forward -150 -131 7.86593 0.259
NP_442050.1_1 Forward -141 -122 6.19431 0.293
NP_440558.1_2 Reverse -116 -135 1.27776 0.182
NP_440558.1_2 Forward -131 -112 -6.58872 0.277
NP_442576.1_4 Reverse -8 -26 11.0322 0.214
NP_442789.1_4 Forward -133 -114 -2.85214 0.242
NP_442789.1_4 Forward -190 -171 -6.88371 0.289
NP_441878.1_6 Reverse -112 -122 9.7148 0.0237
NP_441878.1_6 Forward -123 -113 2.53664 0.0363
NP_441878.1_6 Forward -129 -119 -0.0199663 0.163
NP_441878.1_6 Forward -135 -125 -7.0998 0.204
NP_442721.1_3 Forward -129 -110 13.0775 0.264
NP_441557.1_5 Forward -122 -113 0.786375 0.106
NP_441557.1_5 Reverse -113 -122 0.589713 0.134
NP_441520.1_7 Forward -243 -224 6.4893 0.271
NP_441445.1_1 Reverse -104 -123 3.93269 0.204
NP_441445.1_1 Forward -362 -343 3.14605 0.218
NP_441590.1_4 Reverse -114 -133 9.53674 0.249
NP_442267.1_6 Forward -133 -114 20.7473 0.11
NP_442066.2_9 Forward -195 -182 12.114 0.154
NP_442419.1_2 Forward -133 -114 -1.37718 0.246
NP_442183.1_3 Reverse -166 -185 20.0581 0.108
NP_442183.1_9 Forward -125 -115 9.02648 0.296
NP_441459.1_3 Reverse -110 -129 14.6251 0.223
NP_440414.1_4 Reverse -143 -162 9.14423 0.134
NP_441638.1_10 Forward -251 -237 16.1259 0.245
NP_442645.1_2 Forward -130 -111 -15.1435 0.19
NP_442645.1_2 Forward -136 -117 -20.8467 0.289
NP_442645.1_2 Forward -202 -183 -22.715 0.293
NP_441633.1_3 Forward -124 -111 -6.2739 0.242
NP_442590.1_10 Reverse -106 -125 20.059 0.0978
NP_442998.1_5 Forward -227 -217 15.3197 0.149
NP_442998.1_5 Reverse -94 -104 13.8447 0.157
NP_440299.1_1 Reverse -109 -122 10.6384 0.0557
NP_440299.1_1 Reverse -121 -134 4.83694 0.197
NP_441799.1_1 Reverse -109 -123 8.3571 0.117
NP_441007.1_10 Forward -127 -114 -0.37404 0.277
NP_442333.2_5 Reverse -78 -97 -11.3086 0.246
NP_440256.1_1 Forward -141 -122 -6.98204 0.225
NP_441229.1_1 Reverse -151 -166 20.2361 0.179
NP_442526.1_1 Reverse -70 -89 19.0757 0.158
NP_441559.1_8 Forward -127 -113 -6.39192 0.277
NP_441270.1_5 Reverse -253 -272 11.3352 0.294
NP_440915.1_6 Forward -126 -112 8.25939 0.0579
NP_440915.1_6 Reverse -259 -273 1.57289 0.134
NP_442158.1_4 Forward -365 -355 10.6981 0.283
NP_441261.1_2 Forward -115 -96 6.98095 0.13
NP_442452.1_3 Forward -190 -171 1.67108 0.282
NP_440748.1_5 Reverse -64 -83 -2.26216 0.273
NP_441464.1_1 Reverse -109 -128 7.57094 0.261
NP_441464.1_8 Reverse -125 -139 10.226 0.182
NP_441464.1_10 Reverse -261 -275 11.406 0.22
NP_441199.1_3 Forward -237 -219 0.117479 0.231
NP_441199.1_6 Reverse -118 -137 14.9458 0.0389
NP_441494.1_6 Forward -205 -192 8.27909 0.23
NP_442386.1_9 Forward -273 -264 10.324 0.132
NP_442386.1_9 Reverse -118 -127 5.0142 0.27
NP_441340.1_5 Reverse -114 -121 3.97235 0.274
NP_441340.1_9 Forward -329 -319 14.6181 0.194
NP_441340.1_9 Forward -328 -318 7.966 0.256
NP_442791.1_9 Reverse -183 -202 11.8967 0.284
NP_440327.1_6 Reverse -251 -270 3.14605 0.285
NP_439976.1_4 Reverse -116 -135 5.11187 0.278
NP_441160.1_1 Reverse -117 -136 -11.8003 0.295
NP_441160.1_5 Forward -133 -114 -4.22878 0.288
NP_441160.1_6 Reverse -126 -145 -2.75381 0.286
NP_440586.1_1 Reverse -265 -284 3.73603 0.202
NP_440586.1_1 Forward -363 -344 0.884433 0.237
NP_440586.1_1 Forward -138 -119 -3.63879 0.272
NP_440027.1_3 Reverse -119 -137 21.3561 0.0356
NP_440027.1_3 Reverse -113 -131 5.32826 0.245
NP_440027.1_8 Reverse -110 -129 5.80018 0.279
NP_439937.1_9 Forward -294 -277 -12.8431 0.276
NP_440836.1_6 Reverse -292 -306 13.1759 0.214
NP_440408.1_7 Reverse -113 -132 12.8808 0.2
NP_440408.1_7 Forward -76 -57 9.63589 0.255
NP_440770.1_3 Reverse -270 -284 18.1908 0.139
NP_441789.1_7 Reverse -115 -134 -5.60616 0.299
NP_440316.1_10 Forward -129 -119 9.02648 0.236
NP_441803.1_2 Reverse -114 -133 -0.0988766 0.267
NP_439977.1_5 Reverse -139 -158 2.16274 0.179
NP_441572.1_7 Forward -128 -109 -1.7705 0.19
NP_440267.1_2 Forward -280 -266 6.78381 0.221
NP_441903.1_1 Forward -148 -129 16.9124 0.203
NP_442384.1_10 Forward -122 -109 6.80412 0.0939
NP_442384.1_10 Reverse -113 -126 1.59258 0.253
NP_442114.1_8 Forward -335 -321 10.2254 0.234
NP_441877.1_5 Reverse -292 -311 -0.0988766 0.276
NP_441018.1_7 Forward -132 -113 9.43923 0.223
NP_440282.1_10 Reverse -115 -134 -7.76869 0.253
NP_440189.1_10 Reverse -102 -121 8.35759 0.241
NP_442693.1_2 Forward -227 -208 12.5858 0.169
NP_440297.1_9 Forward -121 -111 -0.118297 0.282
NP_440297.1_9 Forward -133 -123 -0.41329 0.283
NP_441896.1_3 Forward -363 -344 -3.04881 0.294
NP_441103.1_9 Reverse -69 -79 14.1497 0.23
NP_440999.1_9 Reverse -343 -357 3.63784 0.126
NP_440888.1_2 Reverse -113 -127 12.782 0.0389
NP_442512.1_4 Forward -80 -62 6.41066 0.286
NP_441543.1_2 Reverse -114 -123 5.11294 0.209
NP_442845.1_2 Reverse -134 -148 7.76774 0.195
NP_442845.1_2 Forward -144 -130 6.09611 0.217
NP_442845.1_2 Forward -134 -120 4.42448 0.259
NP_442845.1_2 Forward -217 -203 3.63784 0.282
NP_441319.1_5 Forward -199 -180 7.66927 0.3
NP_441469.1_8 Reverse -144 -153 5.3096 0.277
NP_441462.1_2 Forward -122 -112 0.963343 0.109
NP_441462.1_2 Reverse -113 -123 0.275027 0.159
NP_441621.1_7 Reverse -252 -266 -3.93365 0.198
NP_441621.1_7 Forward -274 -260 -4.13031 0.208
NP_443062.1_1 Forward -154 -136 6.49827 0.198
NP_440519.1_8 Forward -134 -118 7.53169 0.199
NP_440519.1_8 Forward -76 -60 5.27008 0.21
NP_442204.1_1 Forward -126 -115 3.10693 0.266
NP_442204.1_1 Forward -183 -172 2.91027 0.266
NP_440516.1_8 Reverse -263 -272 -0.295266 0.232
NP_442428.1_5 Forward -121 -114 4.759 0.223
NP_440603.1_1 Forward -160 -141 17.994 0.0892
NP_440603.1_2 Forward -97 -78 29.2038 0.000465
NP_440603.1_3 Forward -223 -204 21.2389 0.03
NP_440603.1_4 Forward -52 -33 26.8438 0.00399
NP_440603.1_5 Forward -136 -117 15.8307 0.158
NP_440603.1_9 Forward -199 -180 9.83255 0.217
NP_440673.1_2 Forward -204 -185 10.8773 0.194
NP_441052.1_2 Reverse -113 -123 7.35486 0.0742
NP_441052.1_2 Reverse -119 -129 4.89658 0.14
NP_441052.1_2 Reverse -158 -168 2.14332 0.216
NP_441052.1_2 Forward -290 -280 1.94665 0.221
NP_441052.1_2 Forward -167 -157 1.94665 0.221
NP_440436.1_4 Reverse -114 -123 4.7192 0.244
NP_441884.1_9 Forward -275 -256 -14.7502 0.138
NP_442864.1_2 Reverse -114 -133 10.3242 0.272
NP_442864.1_7 Reverse -107 -125 8.47561 0.274
NP_442864.1_10 Forward -116 -97 17.6007 0.155
NP_440314.1_9 Forward -310 -291 -5.80207 0.225
NP_442907.1_9 Reverse -114 -133 -5.99873 0.287
NP_441004.1_1 Forward -148 -129 -17.3068 0.29
NP_441004.1_1 Forward -137 -118 -17.6018 0.292
NP_441004.1_1 Forward -134 -115 -18.0934 0.297
NP_442813.1_4 Reverse -255 -274 -8.16202 0.299
NP_442366.1_5 Reverse -110 -120 10.3043 0.276
NP_441437.1_1 Reverse -68 -87 10.9142 0.264
NP_442873.1_5 Reverse -115 -134 7.76679 0.276
NP_442694.1_3 Reverse -109 -127 -3.6191 0.265
NP_442694.1_4 Reverse -271 -280 14.8477 0.164
NP_442694.1_4 Reverse -294 -303 11.0128 0.286
NP_441228.1_7 Reverse -300 -318 15.8198 0.296
NP_443054.1_2 Forward -124 -110 4.81781 0.24
NP_441851.1_10 Forward -123 -113 4.89658 0.24
NP_442208.1_5 Forward -240 -221 -10.0303 0.295
NP_442622.1_1 Reverse -124 -143 4.71934 0.172
NP_442856.1_7 Forward -131 -112 -1.18052 0.219
NP_442856.1_7 Reverse -110 -129 -2.65548 0.236
NP_441668.1_4 Forward -132 -113 1.17943 0.22
NP_441668.1_4 Forward -203 -184 -2.36049 0.288
NP_440593.1_3 Forward -133 -114 -2.26216 0.224
NP_440593.1_9 Forward -125 -111 8.75105 0.255
NP_441046.1_2 Forward -205 -186 7.66927 0.221
NP_441349.1_10 Forward -132 -113 -0.885524 0.0967
NP_442843.1_1 Forward -362 -343 -10.522 0.278
NP_439960.1_4 Forward -129 -110 13.2733 0.261
NP_439960.1_10 Reverse -256 -274 -1.25915 0.242
NP_439960.1_10 Forward -234 -216 -1.25915 0.242
NP_439960.1_10 Forward -129 -111 -3.02911 0.264
NP_441124.1_5 Forward -329 -319 10.5254 0.286
NP_442450.1_5 Reverse -123 -133 5.28991 0.251
NP_442450.1_5 Reverse -111 -121 5.28991 0.251
NP_442168.1_5 Reverse -109 -128 7.86593 0.159
NP_442168.1_5 Forward -133 -114 -3.73712 0.291
NP_440588.1_2 Reverse -110 -129 -4.91709 0.233
NP_442006.1_2 Forward -272 -255 -7.33598 0.171
NP_442006.1_2 Forward -143 -126 -7.33598 0.171
NP_442006.1_2 Forward -128 -111 -13.8258 0.197
NP_441003.1_9 Reverse -254 -273 5.211 0.266
NP_441003.1_9 Reverse -110 -129 4.81767 0.277
NP_440483.1_1 Reverse -258 -277 0.786102 0.193
NP_442243.1_1 Forward -128 -110 -1.45654 0.279
NP_441078.1_4 Forward -122 -113 7.96454 0.0404
NP_441078.1_4 Reverse -113 -122 0.786375 0.157
NP_442348.1_2 Reverse -270 -279 14.5527 0.147
NP_442348.1_2 Reverse -271 -280 6.68623 0.299
NP_442443.1_1 Forward -130 -111 7.86593 0.13
NP_442906.1_3 Reverse -216 -235 4.12936 0.229
NP_441432.1_8 Reverse -262 -271 8.55452 0.0755
NP_441432.1_8 Forward -71 -62 6.48957 0.114
NP_441432.1_8 Forward -123 -114 4.81794 0.196
NP_441732.1_2 Reverse -115 -131 -16.3627 0.165
NP_440760.1_1 Reverse -113 -132 -23.2067 0.288
NP_442797.1_7 Reverse -118 -136 11.0322 0.167
NP_441057.1_4 Forward -132 -114 -3.42244 0.29
NP_441072.1_2 Forward -149 -130 6.19431 0.288
NP_440713.1_4 Forward -143 -124 2.75272 0.257
NP_442489.1_7 Forward -122 -113 8.45619 0.0206
NP_442489.1_7 Reverse -113 -122 0.786375 0.152
NP_440757.1_7 Forward -127 -109 2.28076 0.269
NP_441659.2_8 Reverse -113 -123 13.1564 0.0129
NP_441659.2_8 Forward -122 -112 0.176696 0.271
NP_440363.1_9 Forward -131 -113 15.5554 0.187
NP_441040.1_2 Forward -130 -111 -5.40875 0.178
NP_441040.1_5 Reverse -108 -127 19.9606 0.111
NP_442008.1_2 Reverse -110 -129 15.3391 0.0806
NP_441800.1_3 Forward -127 -109 6.80398 0.286
NP_441800.1_3 Forward -133 -115 4.9357 0.286
NP_442346.1_5 Reverse -112 -122 12.9597 0.0318
NP_442346.1_5 Forward -123 -113 6.46988 0.201
NP_440545.1_3 Reverse -109 -126 10.6586 0.031
NP_440545.1_3 Forward -132 -115 0.235503 0.143
NP_440545.1_3 Forward -138 -121 -6.25434 0.273
NP_440545.1_3 Forward -126 -109 -6.25434 0.273
NP_440831.1_3 Forward -131 -112 10.6585 0.173
NP_441629.1_1 Reverse -105 -124 14.5524 0.147
NP_441786.1_3 Forward -75 -56 7.47261 0.287
NP_440486.1_2 Reverse -117 -136 9.93088 0.23
NP_440486.1_6 Reverse -112 -131 8.75091 0.235
NP_441126.1_8 Forward -131 -118 7.49244 0.291
NP_440010.1_4 Forward -132 -113 -0.0996487 0.25
NP_440847.1_3 Reverse -127 -141 13.372 0.217
NP_441233.1_9 Reverse -115 -134 13.9625 0.236
NP_441895.1_10 Forward -180 -161 -27.6315 0.282
NP_440671.1_4 Forward -128 -114 9.5377 0.18
NP_443026.1_5 Reverse -264 -283 -4.91709 0.283
NP_441044.1_4 Forward -283 -265 5.23069 0.227
NP_442821.1_3 Reverse -78 -97 13.6675 0.111
NP_440951.1_5 Forward -174 -156 17.5221 0.158
NP_440875.1_9 Forward -152 -142 6.91198 0.294
NP_441813.1_7 Reverse -347 -361 7.96378 0.298
NP_442028.1_1 Reverse -319 -332 8.65605 0.281
NP_442497.1_10 Forward -121 -112 0.688044 0.141
NP_440927.1_9 Forward -344 -325 12.2908 0.271
NP_441239.1_9 Forward -274 -262 5.64384 0.213
NP_441239.1_9 Reverse -117 -129 3.67722 0.279
NP_441239.1_9 Forward -136 -124 3.18557 0.292
NP_440665.1_2 Forward -234 -215 -5.40875 0.247
NP_442138.1_1 Forward -130 -111 1.76863 0.26
NP_442052.1_8 Reverse -111 -121 14.238 0.253
NP_442809.1_1 Reverse -55 -74 11.5033 0.295
NP_440546.1_4 Forward -128 -118 6.74945 0.282
NP_442041.1_10 Forward -129 -110 10.8159 0.252
NP_442340.1_3 Forward -270 -251 -8.55534 0.249
NP_441249.1_8 Forward -76 -57 3.73603 0.265
NP_442479.1_8 Forward -88 -69 5.01433 0.259
NP_440270.1_5 Reverse -99 -118 18.879 0.253
NP_442402.1_4 Reverse -59 -78 -3.63955 0.219
NP_440696.1_3 Forward -138 -120 8.67227 0.15
NP_440696.1_3 Forward -132 -114 0.412472 0.232
NP_441843.2_2 Reverse -111 -130 13.8633 0.238
NP_442039.1_4 Forward -310 -303 6.13563 0.297
NP_441811.1_1 Reverse -175 -194 5.60432 0.28
NP_440160.1_2 Reverse -107 -126 -8.35868 0.286
NP_440505.1_3 Forward -124 -114 6.27322 0.187
NP_442360.1_5 Forward -232 -222 13.5497 0.278
NP_441701.1_3 Forward -152 -135 11.3469 0.213
NP_441252.1_6 Forward -228 -221 11.9372 0.25
NP_440308.1_6 Reverse -111 -130 2.26107 0.296
NP_442532.1_1 Forward -333 -319 19.2483 0.192
NP_441408.2_7 Forward -202 -183 2.85105 0.199
NP_442533.1_1 Forward -137 -118 -8.16202 0.202
NP_442533.1_6 Forward -122 -113 13.5694 0.021
NP_442533.1_6 Reverse -113 -122 8.1612 0.0807
NP_442533.1_6 Reverse -125 -134 5.40793 0.14
NP_442533.1_6 Reverse -119 -128 4.0313 0.194
NP_442533.1_6 Reverse -158 -167 2.458 0.255
NP_442533.1_6 Forward -385 -376 1.96635 0.28
NP_442541.1_10 Reverse -119 -133 13.077 0.182
NP_442541.1_10 Forward -53 -39 1.17898 0.29
NP_442322.1_4 Reverse -116 -133 -7.33664 0.28
NP_442322.1_4 Reverse -121 -138 -9.20492 0.29
NP_443016.1_1 Forward -199 -180 -4.72043 0.235
NP_441482.1_7 Reverse -119 -133 -9.73518 0.209
NP_441482.1_7 Forward -128 -114 -10.3252 0.209
NP_441108.1_2 Forward -289 -270 8.25926 0.245
NP_441028.1_6 Reverse -219 -229 7.74772 0.218
NP_441028.1_6 Reverse -339 -349 4.10949 0.278
NP_442202.1_10 Forward -195 -181 4.91614 0.255
NP_441527.1_4 Forward -343 -324 -10.8388 0.275
NP_441961.1_4 Forward -136 -117 6.29264 0.27
NP_443045.1_5 Reverse -258 -271 17.0692 0.119
NP_441972.1_5 Forward -133 -114 -3.44213 0.2
NP_001035870.1_3 Forward -109 -90 -4.03212 0.278
NP_441286.1_1 Forward -123 -111 -3.6976 0.146
NP_442463.1_8 Forward -79 -61 18.702 0.0975
NP_440886.1_7 Forward -273 -263 7.25606 0.0993
NP_440886.1_7 Reverse -112 -122 6.76441 0.114
NP_440828.1_4 Reverse -118 -137 -7.57277 0.288
NP_442614.1_2 Forward -122 -108 12.586 0.155
NP_442614.1_2 Forward -76 -62 7.76774 0.265
NP_442401.1_2 Reverse -118 -137 11.405 0.163
NP_442213.1_5 Forward -87 -68 0.392778 0.272
NP_441069.1_5 Forward -126 -108 3.55906 0.215
NP_440907.2_8 Reverse -347 -357 4.01116 0.283
NP_442264.1_2 Forward -138 -121 8.29864 0.219
NP_440841.1_4 Reverse -87 -106 -10.522 0.283
NP_441463.1_3 Reverse -135 -154 -7.27704 0.256
NP_442842.1_4 Forward -133 -114 7.07928 0.223
NP_441988.1_2 Reverse -344 -363 10.5209 0.239
NP_442794.1_1 Forward -126 -114 8.00379 0.123
NP_441962.1_4 Forward -133 -114 -12.1936 0.253
NP_441962.1_5 Reverse -252 -271 10.9142 0.186
NP_440387.1_1 Forward -122 -106 -5.64466 0.243
NP_440855.1_5 Forward -130 -111 14.1583 0.141
NP_441431.1_2 Forward -275 -261 8.06211 0.226
NP_441836.1_2 Forward -365 -346 1.86774 0.185
NP_441993.1_1 Forward -128 -109 2.43397 0.259
NP_442224.1_1 Reverse -111 -130 -1.86883 0.233
NP_442437.1_10 Reverse -120 -139 23.4022 0.0121
NP_442698.1_10 Forward -318 -299 1.67108 0.297
NP_441510.2_9 Forward -121 -102 5.40766 0.268
NP_440293.1_3 Forward -130 -111 -4.72043 0.264
NP_440293.1_9 Forward -127 -113 18.7851 0.0935
NP_440293.1_9 Forward -133 -119 9.70148 0.285
NP_440766.1_4 Reverse -259 -273 2.2612 0.191
NP_440422.1_10 Reverse -271 -290 4.98276 0.279
NP_441531.1_6 Forward -269 -256 10.4424 0.254
NP_442930.1_1 Reverse -2 -12 13.1559 0.239
NP_440502.1_1 Forward -388 -372 17.7574 0.255
NP_442867.1_8 Forward -240 -221 6.4893 0.26
NP_442278.1_3 Reverse -55 -73 13.741 0.256
NP_440457.1_1 Forward -126 -114 2.79224 0.205
NP_441332.1_6 Forward -273 -263 13.7766 0.184
NP_442582.1_8 Reverse -268 -286 8.47561 0.229
NP_441440.1_8 Reverse -182 -195 14.5723 0.299
NP_441885.1_5 Reverse -113 -123 2.14332 0.0827
NP_441756.1_5 Forward -126 -107 -0.4922 0.245
NP_441756.1_5 Forward -125 -106 -0.983855 0.253
NP_440409.1_10 Forward -129 -110 6.98095 0.29
NP_443000.1_7 Forward -124 -114 0.963343 0.278
NP_440507.2_3 Forward -131 -112 6.88182 0.297
NP_442932.1_9 Forward -317 -298 16.7157 0.14
NP_443046.1_9 Forward -286 -268 6.50823 0.181
NP_442275.1_1 Reverse -125 -144 8.94757 0.245
NP_441207.1_7 Forward -326 -312 10.0299 0.269
NP_439962.1_4 Reverse -111 -130 -7.86702 0.291
NP_439962.1_4 Reverse -125 -144 -8.85033 0.298
NP_439962.1_4 Reverse -255 -274 -9.047 0.298
NP_442234.1_1 Forward -156 -137 8.84924 0.265
NP_442495.1_3 Forward -127 -109 14.2771 0.242
NP_442495.1_5 Reverse -108 -127 5.99764 0.291
NP_440149.1_8 Forward -134 -115 -4.22878 0.203
NP_441105.1_3 Forward -133 -114 0.58944 0.124
NP_442373.1_2 Forward -134 -115 -3.63879 0.205
NP_440216.1_1 Forward -122 -108 -12.0951 0.24
NP_440172.1_1 Forward -122 -112 4.10993 0.205
NP_442015.1_10 Forward -126 -113 9.16406 0.053
NP_441226.1_7 Forward -271 -264 8.29857 0.205
NP_441111.1_7 Forward -121 -113 -0.472234 0.131
NP_441111.1_7 Reverse -114 -122 -0.668896 0.274
NP_440415.1_2 Reverse -143 -162 8.55425 0.165
NP_441766.1_2 Forward -122 -113 4.52295 0.179
NP_440416.1_9 Reverse -60 -79 -5.99873 0.0854
NP_440416.1_9 Forward -129 -110 -7.57203 0.104
NP_440416.1_9 Reverse -118 -137 -8.06369 0.109
NP_440416.1_9 Reverse -106 -125 -17.6018 0.243
NP_443052.1_9 Reverse -343 -362 -0.590531 0.213
NP_443052.1_9 Reverse -69 -88 -4.13045 0.254
NP_443052.1_9 Reverse -346 -365 -6.78538 0.289
NP_441940.1_1 Reverse -109 -128 16.3215 0.207
NP_442154.1_1 Forward -136 -118 5.91901 0.0591
NP_442154.1_1 Reverse -255 -273 -15.1238 0.218
NP_442154.1_1 Forward -133 -115 -15.5171 0.22
NP_442564.1_10 Forward -234 -220 11.701 0.244
NP_440261.1_5 Forward -121 -108 -4.20895 0.142
NP_440261.1_7 Forward -233 -214 -5.21209 0.231
NP_440988.1_10 Reverse -117 -131 4.51157 0.259
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GACGGCATTAGTGCAGCCCAGTCCCGTAACGTTAATTTGCTGTTGGTGGATACGGCGGGAAGGTTACAAAATAAGAAAAATTTGATGGACGAGCTAGCCAAAATCCGGCGCATTATCGACAAAAAAGCCCCCAACGCCACGGTGGAATCTTTACTAGTATTGGATGCCACCCTGGGGCAAAACGGTTTACGCCAAGCGGAAGTATTTGCCGAGGCCGCCAAATTGAGCGGAGTGGTGCTGACCAAATTGGATGGCAGCGCTAAGGGAGGGGTGGCCCTGGCGGTGGCCCAGCAGTTGAATCTGCCCATTCGTTTTATCGGTGCAGGGGAAGGCATTGAGGATTTGCGTCCCTTTTCCAGCTATGAATTTGTTGAAGCCCTACTAAACGGTTAATATTTTT

CDS

GTGCTAAGAGCGACCAGTGATCGATCGCCGTTGTTTGAGTGTAATCCTGCCCTGGACGGTTGGTCTTTGGGGGGGCGGGATCCGGAAACCATCAAACGGTTAATGCCTTTTTGGGAATGGTTTTACAAATACTATTTCCGGGTGCAGACTAGTGGCTGGGAAAATTTACCGCCGGGACAGGTATTGCTGGTGGGTTCCCATAATGGCGGCCTTTCTTCACCGGATATGGTGATGATGATTTACGACTGGTTTCGTTGCCAGGGTTTACATCGCCCTGTGTACGGTTTAATGCATCCCACGGTTTGGAAAATGAGCCGTCCCCTGGCAGAGTTGGCCGTTAAGGTGGGGGCAGTCCAAGCTCATCCCAAAATGGCGATCGCCGCTCTGCAATCCGGGGCCAGTGTGTTGGTTTACCCCGGTGGAGCCCAGGATGTATTTCGTCCCTTTAGCCAACGACATGAAATTTATTTTGCCGGTCGTAAAGGTTTTATTAAATTGGCCCTGCGGCAAGGGGTACCCATCGTCCCGGCGATCGCCGTCGGTTCCCACGAAACTCTGTTGGTTATGGGGGATTGCTACGACCAAGTTAAATATCTCCATGACCTTGGTATGCCTTGGCTATTGGACGTGGACCCGGTGGTTTTTCCCATTTATCTGGGTTTGCCCTGGGGTCTAGCGTTAGGCCCCCTGCCCCATGTGCCTTTACCGTTGACTATGCACACTCGCATCTGTCCACCGATCTACTTTGAGCGTTACGGCAACGACGCCGCCAAAGATAAGGATTATGTCGAGCAGTGTTATCAACTGGTGAAAACGGAGATGCAACGGGAGCTAGATCAACTGGCTGAAACTGCCAATATTTTGCCTCAATTAAATTTTCTCTGA

Protein

MLRATSDRSPLFECNPALDGWSLGGRDPETIKRLMPFWEWFYKYYFRVQTSGWENLPPGQVLLVGSHNGGLSSPDMVMMIYDWFRCQGLHRPVYGLMHPTVWKMSRPLAELAVKVGAVQAHPKMAIAALQSGASVLVYPGGAQDVFRPFSQRHEIYFAGRKGFIKLALRQGVPIVPAIAVGSHETLLVMGDCYDQVKYLHDLGMPWLLDVDPVVFPIYLGLPWGLALGPLPHVPLPLTMHTRICPPIYFERYGNDAAKDKDYVEQCYQLVKTEMQRELDQLAETANILPQLNFL