Your browser is old and dusty. Try Google Chrome!

Details for slr2101

ORF slr2101
Accession NP_441315.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -155 -169 11.406 0.0519
NP_441061.1_2 Forward -121 -107 6.19444 0.123
NP_441061.1_2 Reverse -346 -360 2.2612 0.178
NP_441061.1_2 Forward -284 -270 1.37622 0.191
NP_441061.1_2 Forward -353 -339 0.88457 0.197
NP_441061.1_2 Reverse -114 -128 0.196253 0.215
NP_441061.1_2 Forward -197 -183 -1.8687 0.274
NP_440795.1_7 Forward -353 -346 14.6904 0.0123
NP_440795.1_7 Reverse -346 -353 14.6904 0.0123
NP_440795.1_7 Forward -121 -114 14.6904 0.0123
NP_440795.1_7 Reverse -114 -121 14.6904 0.0123
NP_440795.1_7 Forward -284 -277 10.2655 0.154
NP_441418.1_6 Reverse -177 -196 -9.93197 0.0301
NP_441418.1_6 Forward -122 -103 -10.817 0.0397
NP_441418.1_6 Forward -354 -335 -11.0136 0.043
NP_441418.1_6 Forward -198 -179 -11.2103 0.0462
NP_441418.1_6 Reverse -239 -258 -29.1065 0.216
NP_441418.1_6 Reverse -345 -364 -29.9915 0.249
NP_442220.1_4 Forward -259 -240 21.1406 0.0674
NP_440815.1_2 Forward -91 -77 10.9137 0.265
NP_442291.1_5 Reverse -344 -360 -0.826444 0.189
NP_442291.1_5 Reverse -112 -128 -1.12144 0.192
NP_442291.1_5 Forward -355 -339 -4.56302 0.28
NP_440897.1_6 Reverse -113 -132 3.73524 0.142
NP_441453.1_4 Reverse -345 -353 16.539 0.00633
NP_441453.1_4 Reverse -113 -121 16.539 0.00633
NP_441453.1_4 Forward -354 -346 16.539 0.00633
NP_441453.1_4 Forward -122 -114 16.539 0.00633
NP_441453.1_4 Forward -198 -190 7.29591 0.0589
NP_441453.1_4 Reverse -189 -197 6.70593 0.121
NP_441453.1_4 Forward -163 -155 4.24765 0.259
NP_441453.1_4 Reverse -385 -393 4.05099 0.268
NP_441453.1_4 Reverse -276 -284 4.05099 0.268
NP_441453.1_4 Reverse -294 -302 3.85433 0.284
NP_441453.1_7 Reverse -393 -400 11.6422 0.298
NP_443041.1_7 Forward -353 -336 12.6252 0.111
NP_442151.1_6 Reverse -345 -359 14.6509 0.0321
NP_442151.1_6 Reverse -113 -127 9.34103 0.152
NP_442151.1_6 Reverse -154 -168 8.35772 0.175
NP_442151.1_6 Forward -163 -149 8.16106 0.182
NP_442151.1_6 Reverse -160 -174 7.66941 0.192
NP_441818.1_1 Reverse -346 -357 18.446 0.0046
NP_441818.1_1 Reverse -114 -125 15.8894 0.0244
NP_441818.1_9 Forward -236 -217 -4.32711 0.235
NP_440226.1_1 Reverse -345 -364 12.8808 0.0399
NP_440226.1_1 Reverse -189 -208 12.4875 0.0444
NP_440226.1_1 Forward -122 -103 7.86593 0.0975
NP_440226.1_1 Forward -354 -335 6.39097 0.129
NP_440226.1_1 Reverse -113 -132 2.45773 0.263
NP_442655.1_1 Reverse -380 -399 0.884433 0.24
NP_442173.1_1 Forward -353 -345 15.4574 0.00633
NP_442173.1_1 Forward -121 -113 15.4574 0.00633
NP_442173.1_1 Reverse -346 -354 15.4574 0.00633
NP_442173.1_1 Reverse -114 -122 15.4574 0.00633
NP_442173.1_1 Reverse -190 -198 7.59091 0.163
NP_442173.1_1 Forward -197 -189 5.82095 0.2
NP_442752.1_4 Forward -354 -347 13.8055 0.0199
NP_442752.1_4 Reverse -345 -352 13.8055 0.0199
NP_442752.1_4 Reverse -189 -196 13.8055 0.0199
NP_442752.1_4 Forward -122 -115 13.8055 0.0199
NP_442752.1_4 Reverse -113 -120 13.8055 0.0199
NP_442752.1_4 Reverse -294 -301 5.25066 0.256
NP_443027.1_4 Reverse -111 -121 14.828 0.0437
NP_443027.1_4 Forward -356 -346 14.0414 0.0452
NP_443027.1_4 Forward -124 -114 14.0414 0.0452
NP_443027.1_4 Reverse -187 -197 10.1081 0.144
NP_443027.1_4 Forward -200 -190 7.94484 0.223
NP_443027.1_4 Forward -165 -155 6.56821 0.275
NP_443027.1_4 Reverse -343 -353 5.87989 0.294
NP_441812.1_3 Forward -123 -109 15.0442 0.106
NP_441812.1_3 Reverse -238 -252 13.7659 0.151
NP_441812.1_3 Reverse -344 -358 6.88276 0.287
NP_442975.1_10 Reverse -341 -355 20.3534 0.00216
NP_442975.1_10 Reverse -109 -123 12.782 0.0459
NP_442975.1_10 Forward -289 -275 8.16044 0.105
NP_442975.1_10 Reverse -185 -199 2.16228 0.283
NP_440784.1_7 Forward -353 -346 15.9687 0.0123
NP_440784.1_7 Reverse -346 -353 15.9687 0.0123
NP_440784.1_7 Forward -121 -114 15.9687 0.0123
NP_440784.1_7 Reverse -114 -121 15.9687 0.0123
NP_440784.1_7 Forward -197 -190 6.23397 0.241
NP_440784.1_7 Reverse -190 -197 6.13563 0.241
NP_442909.1_7 Reverse -346 -360 5.99717 0.258
NP_442861.1_1 Forward -47 -28 10.0292 0.295
NP_442000.2_6 Forward -284 -265 14.5524 0.277
NP_440061.1_9 Reverse -343 -357 12.0937 0.102
NP_440061.1_9 Reverse -111 -125 8.16044 0.18
NP_440110.1_4 Forward -133 -114 3.24438 0.23
NP_441054.1_2 Forward -89 -70 9.83255 0.284
NP_441054.1_4 Forward -364 -346 18.112 0.0254
NP_441054.1_4 Forward -208 -190 -4.20908 0.3
NP_441476.1_5 Reverse -265 -284 -0.983855 0.2
NP_440878.1_9 Reverse -335 -354 -1.96717 0.258
NP_442062.1_8 Forward -354 -344 19.4496 0.000558
NP_442062.1_8 Forward -122 -112 19.4496 0.000558
NP_442062.1_8 Reverse -345 -355 17.3846 0.00193
NP_442062.1_8 Reverse -113 -123 17.3846 0.00193
NP_442062.1_8 Forward -198 -188 7.25653 0.104
NP_442062.1_8 Reverse -294 -304 3.32329 0.275
NP_442062.1_8 Reverse -160 -170 2.92996 0.292
NP_440761.1_4 Forward -174 -155 -12.9802 0.257
NP_440761.1_4 Reverse -184 -203 -15.2418 0.278
NP_441859.1_3 Reverse -176 -195 4.03023 0.228
NP_441859.1_5 Forward -380 -361 4.22769 0.295
NP_440304.1_4 Forward -356 -346 10.8948 0.051
NP_440304.1_4 Forward -124 -114 10.8948 0.051
NP_440304.1_4 Reverse -111 -121 10.8948 0.051
NP_440304.1_4 Forward -287 -277 7.94484 0.094
NP_440304.1_4 Forward -171 -161 4.20827 0.272
NP_440304.1_4 Reverse -343 -353 1.84832 0.299
NP_442242.1_4 Forward -353 -346 14.3954 0.0124
NP_442242.1_4 Reverse -346 -353 14.3954 0.0124
NP_442242.1_4 Forward -121 -114 14.3954 0.0124
NP_442242.1_4 Reverse -114 -121 14.3954 0.0124
NP_442242.1_4 Reverse -190 -197 12.4288 0.0393
NP_440044.1_8 Reverse -295 -314 -3.3438 0.282
NP_441781.1_7 Reverse -345 -364 -1.67217 0.278
NP_441781.1_7 Forward -303 -284 -1.96717 0.285
NP_441200.1_4 Forward -89 -70 8.06259 0.258
NP_441594.1_6 Forward -288 -269 2.3594 0.252
NP_441594.1_6 Forward -195 -176 0.196116 0.291
NP_440370.1_10 Forward -363 -344 8.75091 0.24
NP_442742.1_9 Reverse -34 -53 -14.3569 0.3
NP_442110.1_7 Reverse -345 -359 0.0979218 0.267
NP_442726.1_1 Reverse -249 -268 12.0942 0.179
NP_441083.1_3 Reverse -253 -263 16.5975 0.102
NP_441083.1_5 Reverse -345 -355 20.3345 0.00053
NP_441083.1_5 Reverse -113 -123 20.3345 0.00053
NP_441083.1_5 Forward -354 -344 11.3864 0.0159
NP_441083.1_5 Forward -122 -112 11.3864 0.0159
NP_441083.1_5 Reverse -385 -395 7.05986 0.067
NP_441083.1_5 Forward -285 -275 1.16001 0.215
NP_441083.1_5 Reverse -154 -164 -0.511621 0.269
NP_442827.1_8 Forward -265 -246 1.57197 0.176
NP_442827.1_8 Reverse -181 -200 -1.37794 0.245
NP_442115.2_7 Reverse -277 -294 6.82368 0.23
NP_441738.1_2 Forward -352 -345 15.28 0.0102
NP_441738.1_2 Reverse -347 -354 15.28 0.0102
NP_441738.1_2 Forward -196 -189 15.28 0.0102
NP_441738.1_2 Forward -120 -113 15.28 0.0102
NP_441738.1_2 Reverse -115 -122 15.28 0.0102
NP_441738.1_2 Forward -184 -177 9.77352 0.143
NP_441558.1_5 Forward -200 -181 12.4875 0.0677
NP_441558.1_5 Forward -356 -337 5.11266 0.26
NP_441558.1_5 Forward -124 -105 3.73603 0.299
NP_440209.1_1 Reverse -345 -353 18.1123 0.00295
NP_440209.1_1 Reverse -113 -121 18.1123 0.00295
NP_440209.1_1 Forward -354 -346 18.1123 0.00295
NP_440209.1_1 Forward -122 -114 18.1123 0.00295
NP_440209.1_1 Reverse -189 -197 14.8674 0.012
NP_442136.1_4 Forward -120 -101 12.3883 0.236
NP_442889.1_8 Reverse -342 -356 20.3534 0.00446
NP_442889.1_8 Reverse -110 -124 19.7634 0.00619
NP_440056.1_1 Forward -284 -265 13.1758 0.147
NP_440056.1_1 Forward -302 -283 9.73422 0.236
NP_441713.1_1 Reverse -107 -126 -12.7836 0.248
NP_441713.1_1 Forward -360 -341 -14.5535 0.259
NP_441713.1_1 Reverse -183 -202 -16.6185 0.285
NP_442675.1_4 Reverse -268 -286 -4.20908 0.257
NP_441770.1_5 Forward -293 -274 -1.08219 0.261
NP_441783.1_2 Reverse -278 -287 17.2076 0.108
NP_440178.1_7 Reverse -275 -294 -4.32711 0.0548
NP_440178.1_7 Reverse -344 -363 -14.0619 0.148
NP_440178.1_7 Reverse -112 -131 -22.5183 0.267
NP_442570.1_3 Reverse -84 -103 -3.54046 0.222
NP_441716.1_1 Reverse -345 -359 16.6175 0.0348
NP_441716.1_1 Reverse -113 -127 15.8309 0.0467
NP_442111.1_4 Forward -355 -341 10.7177 0.0518
NP_442111.1_4 Forward -123 -109 9.34103 0.0609
NP_442111.1_4 Reverse -350 -364 7.07942 0.105
NP_440906.1_5 Forward -353 -346 15.8704 0.0124
NP_440906.1_5 Reverse -346 -353 15.8704 0.0124
NP_440906.1_5 Forward -121 -114 15.8704 0.0124
NP_440906.1_5 Reverse -114 -121 15.8704 0.0124
NP_440906.1_5 Forward -197 -190 12.0355 0.0724
NP_440906.1_5 Reverse -190 -197 12.0355 0.0724
NP_440747.1_10 Forward -357 -345 7.51213 0.00286
NP_440747.1_10 Forward -125 -113 7.4138 0.00422
NP_440747.1_10 Reverse -342 -354 5.44718 0.0137
NP_440747.1_10 Reverse -110 -122 -2.1243 0.0225
NP_440747.1_10 Reverse -273 -285 -11.8591 0.161
NP_440747.1_10 Reverse -157 -169 -12.1541 0.227
NP_441130.1_10 Forward -356 -342 8.75105 0.133
NP_442973.1_5 Reverse -336 -355 16.3224 0.0995
NP_441486.1_1 Forward -357 -343 22.1241 0.00203
NP_441486.1_1 Reverse -342 -356 20.3541 0.003
NP_441486.1_1 Reverse -110 -124 11.2093 0.0168
NP_441486.1_1 Forward -125 -111 10.9143 0.018
NP_441486.1_1 Forward -166 -152 -5.11362 0.222
NP_441486.1_1 Reverse -186 -200 -5.50694 0.242
NP_441486.1_1 Reverse -273 -287 -6.29359 0.288
NP_440944.1_2 Forward -366 -347 5.70265 0.194
NP_442634.1_4 Forward -171 -157 0.88457 0.149
NP_442634.1_4 Reverse -187 -201 -3.24533 0.161
NP_442634.1_4 Forward -287 -273 -5.50694 0.258
NP_440403.1_10 Reverse -276 -295 11.6025 0.177
NP_441014.1_10 Forward -123 -104 11.405 0.118
NP_441014.1_10 Reverse -112 -131 -2.06626 0.27
NP_441014.1_10 Forward -355 -336 -2.8529 0.289
NP_442848.1_1 Reverse -339 -353 6.98109 0.0791
NP_442848.1_1 Forward -360 -346 -1.18038 0.263
NP_442848.1_1 Forward -128 -114 -2.75368 0.263
NP_442848.1_4 Reverse -78 -92 5.70279 0.288
NP_443018.1_3 Forward -353 -346 14.8871 0.0123
NP_443018.1_3 Reverse -346 -353 14.8871 0.0123
NP_443018.1_3 Forward -121 -114 14.8871 0.0123
NP_443018.1_3 Reverse -114 -121 14.8871 0.0123
NP_443018.1_3 Forward -162 -155 12.5271 0.0523
NP_443018.1_3 Reverse -155 -162 12.5271 0.0523
NP_443018.1_3 Forward -374 -367 7.6106 0.156
NP_443018.1_3 Forward -197 -190 5.34899 0.212
NP_443018.1_3 Reverse -190 -197 5.34899 0.212
NP_443018.1_3 Forward -284 -277 4.36568 0.254
NP_443018.1_3 Reverse -277 -284 4.07068 0.299
NP_441634.1_8 Forward -356 -342 11.996 0.0529
NP_441634.1_8 Forward -124 -110 3.63784 0.145
NP_441634.1_8 Forward -165 -151 1.27789 0.202
NP_441634.1_8 Forward -377 -363 1.08123 0.209
NP_441634.1_8 Reverse -274 -288 1.08123 0.209
NP_440376.1_1 Forward -354 -345 19.4693 0.000692
NP_440376.1_1 Reverse -345 -354 19.4693 0.000692
NP_440376.1_1 Forward -122 -113 19.4693 0.000692
NP_440376.1_1 Reverse -113 -122 19.4693 0.000692
NP_440376.1_1 Reverse -276 -285 7.37455 0.0786
NP_440376.1_1 Forward -285 -276 7.07956 0.0869
NP_440376.1_1 Forward -263 -254 4.12963 0.173
NP_440376.1_1 Forward -198 -189 -0.000272808 0.285
NP_440376.1_1 Reverse -189 -198 -0.0986038 0.285
NP_441588.1_4 Forward -352 -342 16.4996 0.0369
NP_441588.1_4 Forward -196 -186 6.96153 0.178
NP_441588.1_4 Reverse -115 -125 6.37155 0.2
NP_442687.1_7 Reverse -344 -354 15.8113 0.0125
NP_442687.1_7 Reverse -112 -122 15.8113 0.0125
NP_442687.1_7 Reverse -188 -198 13.2547 0.0562
NP_442687.1_7 Forward -355 -345 8.92815 0.0994
NP_442687.1_7 Forward -123 -113 8.92815 0.0994
NP_442687.1_7 Forward -170 -160 8.1415 0.113
NP_442687.1_7 Reverse -293 -303 6.96153 0.147
NP_442687.1_7 Reverse -275 -285 5.09324 0.221
NP_442191.1_4 Forward -197 -183 13.7079 0.132
NP_442485.1_3 Reverse -252 -271 -1.57384 0.26
NP_442485.1_3 Forward -174 -155 -5.01543 0.287
NP_442958.1_3 Forward -365 -346 -0.197208 0.267
NP_440642.1_10 Reverse -79 -93 4.42388 0.255
NP_440533.1_9 Reverse -345 -364 7.27595 0.189
NP_441746.1_2 Forward -192 -173 15.5357 0.248
NP_441763.1_10 Reverse -178 -197 15.0432 0.118
NP_441763.1_10 Forward -365 -346 7.27514 0.245
NP_442658.1_1 Reverse -343 -353 15.9091 0.00966
NP_442658.1_1 Reverse -111 -121 15.9091 0.00966
NP_442658.1_1 Forward -305 -295 9.91099 0.141
NP_442658.1_1 Reverse -187 -197 8.92768 0.172
NP_442658.1_1 Forward -200 -190 8.82935 0.177
NP_442658.1_1 Forward -356 -346 6.76441 0.214
NP_442658.1_1 Forward -124 -114 6.76441 0.214
NP_442658.1_1 Forward -287 -277 5.78111 0.25
NP_442658.1_1 Forward -171 -161 5.38779 0.269
NP_440141.1_8 Forward -178 -159 6.68596 0.254
NP_440141.1_8 Reverse -261 -280 5.89931 0.271
NP_442782.1_2 Forward -84 -70 11.406 0.173
NP_442205.1_2 Reverse -343 -362 11.6469 0.281
NP_442544.1_6 Reverse -106 -125 -5.11376 0.287
NP_441414.1_9 Reverse -113 -132 13.5691 0.0139
NP_441414.1_9 Forward -122 -103 11.8975 0.0171
NP_441414.1_9 Reverse -345 -364 -1.96717 0.108
NP_441414.1_9 Forward -394 -375 -8.45701 0.236
NP_441414.1_9 Forward -354 -335 -10.3253 0.28
NP_442937.1_5 Forward -284 -265 14.4541 0.0758
NP_442937.1_5 Reverse -340 -359 12.3892 0.111
NP_442937.1_5 Forward -290 -271 7.86593 0.241
NP_441958.1_5 Forward -355 -345 12.2714 0.00183
NP_441958.1_5 Reverse -344 -354 12.2714 0.00183
NP_441958.1_5 Forward -123 -113 12.2714 0.00183
NP_441958.1_5 Reverse -112 -122 12.2714 0.00183
NP_441958.1_5 Forward -286 -276 2.04498 0.0554
NP_441958.1_5 Forward -199 -189 1.74999 0.0765
NP_441958.1_5 Reverse -188 -198 1.455 0.0956
NP_441958.1_5 Reverse -293 -303 -0.314959 0.198
NP_441958.1_5 Forward -395 -385 -0.708283 0.221
NP_442486.1_6 Reverse -326 -345 0.884433 0.266
NP_442836.1_5 Forward -360 -341 2.65439 0.252
NP_440203.1_5 Reverse -348 -358 12.4676 0.147
NP_440203.1_5 Reverse -230 -240 10.206 0.235
NP_442025.1_4 Forward -244 -225 11.6025 0.291
NP_439905.1_1 Reverse -346 -359 9.95071 0.216
NP_439905.1_1 Forward -374 -361 7.39411 0.262
NP_439990.1_5 Forward -127 -114 10.934 0.128
NP_439990.1_5 Reverse -184 -197 9.75405 0.133
NP_439990.1_5 Forward -359 -346 8.9674 0.155
NP_442911.1_2 Forward -132 -113 17.994 0.00677
NP_442911.1_2 Reverse -103 -122 13.5691 0.0118
NP_442911.1_2 Forward -196 -177 -1.08219 0.0811
NP_442911.1_2 Reverse -335 -354 -2.75381 0.102
NP_442911.1_2 Forward -364 -345 -5.11376 0.15
NP_442911.1_2 Reverse -150 -169 -7.76869 0.219
NP_441580.1_6 Forward -209 -190 -0.885524 0.178
NP_441580.1_6 Reverse -178 -197 -5.50708 0.235
NP_440153.1_5 Forward -353 -339 0.786239 0.289
NP_442119.1_6 Forward -259 -240 6.09597 0.25
NP_440993.1_4 Forward -169 -152 2.39878 0.3
NP_440934.1_1 Forward -368 -349 6.98095 0.233
NP_441099.1_5 Forward -132 -113 -3.04881 0.13
NP_441099.1_5 Forward -364 -345 -9.53865 0.226
NP_441099.1_5 Reverse -179 -198 -12.1936 0.296
NP_442002.1_9 Reverse -344 -351 10.7572 0.185
NP_442002.1_9 Reverse -188 -195 10.7572 0.185
NP_442002.1_9 Reverse -112 -119 10.7572 0.185
NP_442002.1_9 Reverse -176 -183 10.5605 0.214
NP_440809.1_9 Forward -207 -189 -7.84733 0.225
NP_440809.1_9 Reverse -104 -122 -7.84733 0.225
NP_440809.1_9 Forward -363 -345 -7.94566 0.225
NP_441938.1_3 Reverse -349 -368 7.47261 0.228
NP_441294.1_7 Reverse -341 -355 19.6174 0.00271
NP_441646.1_1 Reverse -338 -357 11.6025 0.098
NP_441646.1_1 Reverse -263 -282 -0.39387 0.264
NP_442438.1_10 Forward -191 -177 11.5043 0.0463
NP_442438.1_10 Forward -127 -113 2.75286 0.168
NP_442438.1_10 Forward -359 -345 1.37622 0.197
NP_442438.1_10 Reverse -340 -354 0.392915 0.229
NP_442438.1_10 Reverse -184 -198 -0.197071 0.253
NP_441000.1_6 Forward -355 -341 -3.34366 0.221
NP_441000.1_6 Reverse -112 -126 -5.01529 0.257
NP_441000.1_6 Reverse -344 -358 -5.60527 0.285
NP_442771.1_1 Forward -171 -153 -6.76569 0.169
NP_442771.1_1 Reverse -111 -129 -7.55234 0.171
NP_442771.1_1 Forward -385 -367 -11.0923 0.297
NP_440147.1_4 Reverse -343 -356 12.6056 0.0326
NP_440147.1_4 Reverse -292 -305 7.98409 0.0579
NP_440147.1_4 Reverse -111 -124 3.36254 0.188
NP_440147.1_4 Forward -356 -343 0.904263 0.244
NP_440147.1_4 Forward -124 -111 0.805932 0.244
NP_440147.1_4 Forward -200 -187 0.0192843 0.268
NP_441550.1_8 Forward -356 -346 12.3692 0.0336
NP_441550.1_8 Forward -124 -114 12.3692 0.0336
NP_441550.1_8 Reverse -343 -353 8.3377 0.124
NP_441550.1_8 Reverse -111 -121 6.0761 0.214
NP_441550.1_8 Reverse -292 -302 5.09279 0.267
NP_441916.1_7 Forward -354 -344 18.4663 0.00144
NP_441916.1_7 Forward -122 -112 18.4663 0.00144
NP_441916.1_7 Reverse -345 -355 10.3048 0.0261
NP_441916.1_7 Reverse -113 -123 10.3048 0.0261
NP_441916.1_7 Forward -198 -188 9.61647 0.0333
NP_441916.1_7 Reverse -276 -286 7.64985 0.0626
NP_441916.1_7 Reverse -189 -199 7.05986 0.0779
NP_441916.1_7 Forward -303 -293 4.99491 0.15
NP_441041.1_4 Forward -198 -179 3.34271 0.0656
NP_441041.1_4 Forward -354 -335 -3.3438 0.121
NP_441041.1_4 Reverse -345 -364 -5.60541 0.155
NP_441041.1_4 Forward -122 -103 -8.65367 0.205
NP_441041.1_4 Reverse -177 -196 -11.3086 0.244
NP_441041.1_4 Forward -263 -244 -11.6036 0.25
NP_441041.1_4 Reverse -113 -132 -11.8003 0.252
NP_441041.1_4 Reverse -276 -295 -13.3736 0.285
NP_441041.1_7 Reverse -342 -354 18.9817 0.00435
NP_441041.1_7 Forward -306 -294 6.93171 0.185
NP_441041.1_7 Forward -288 -276 6.73736 0.195
NP_441041.1_7 Reverse -186 -198 6.543 0.206
NP_442396.1_5 Forward -126 -113 17.6205 0.0296
NP_442396.1_5 Reverse -109 -122 16.3422 0.0475
NP_442396.1_5 Forward -358 -345 9.16406 0.13
NP_442396.1_5 Forward -223 -210 6.60746 0.229
NP_441547.1_2 Forward -133 -115 7.19731 0.215
NP_442004.1_6 Reverse -345 -359 10.226 0.14
NP_442004.1_6 Forward -303 -289 7.86607 0.153
NP_442004.1_6 Reverse -113 -127 1.57289 0.285
NP_440703.1_9 Forward -263 -250 8.57349 0.226
NP_441725.1_5 Forward -121 -111 11.2881 0.0247
NP_441725.1_5 Reverse -346 -356 11.2881 0.0247
NP_441725.1_5 Reverse -114 -124 11.2881 0.0247
NP_441725.1_5 Reverse -161 -171 4.89658 0.115
NP_441725.1_5 Forward -353 -343 2.04498 0.115
NP_441725.1_5 Reverse -386 -396 1.94665 0.115
NP_441725.1_5 Reverse -155 -165 -0.511621 0.26
NP_441725.1_5 Forward -197 -187 -0.708283 0.267
NP_439966.1_7 Reverse -111 -121 18.4657 0.00473
NP_439966.1_7 Forward -356 -346 15.8108 0.0124
NP_439966.1_7 Forward -124 -114 15.8108 0.0124
NP_439966.1_7 Reverse -343 -353 9.91099 0.0968
NP_439966.1_7 Reverse -383 -393 7.94438 0.145
NP_439966.1_7 Reverse -187 -197 7.64939 0.15
NP_439966.1_9 Reverse -187 -196 10.7178 0.0863
NP_439966.1_9 Reverse -111 -120 0.983037 0.253
NP_439966.1_9 Reverse -343 -352 0.884706 0.253
NP_442941.1_3 Reverse -346 -356 19.9412 0.00262
NP_442941.1_3 Reverse -114 -124 19.9412 0.00262
NP_442941.1_3 Forward -121 -111 11.4848 0.0116
NP_442941.1_3 Reverse -190 -200 7.55152 0.0711
NP_442941.1_3 Forward -353 -343 2.63497 0.14
NP_442941.1_3 Forward -284 -274 0.766681 0.171
NP_442941.1_3 Reverse -155 -165 0.373358 0.212
NP_440289.1_2 Reverse -342 -355 12.6056 0.0139
NP_440289.1_2 Reverse -110 -123 11.819 0.0171
NP_440289.1_2 Reverse -382 -395 0.904263 0.144
NP_440289.1_2 Forward -357 -344 -2.83231 0.262
NP_440289.1_2 Forward -125 -112 -2.93064 0.262
NP_440289.1_2 Forward -397 -384 -4.89726 0.294
NP_440260.1_8 Forward -131 -113 -5.68405 0.276
NP_440260.1_8 Reverse -261 -279 -7.749 0.3
NP_442281.1_1 Reverse -340 -354 21.0417 0.00192
NP_442281.1_1 Reverse -108 -122 11.1104 0.0507
NP_442281.1_1 Forward -308 -294 10.2254 0.0608
NP_442281.1_1 Reverse -271 -285 4.71887 0.184
NP_442281.1_1 Forward -290 -276 1.67063 0.293
NP_440177.1_9 Forward -293 -274 11.5042 0.267
NP_440437.1_1 Reverse -339 -358 6.58763 0.0726
NP_440437.1_1 Forward -128 -109 -4.91709 0.271
NP_442288.1_3 Reverse -74 -91 15.8701 0.0925
NP_441556.1_4 Reverse -354 -373 10.7764 0.264
NP_441556.1_10 Reverse -249 -263 16.354 0.115
NP_440498.1_1 Forward -363 -345 4.14905 0.131
NP_440498.1_1 Reverse -104 -122 0.314141 0.218
NP_441644.1_6 Reverse -345 -355 17.3841 0.00127
NP_441644.1_6 Reverse -113 -123 17.3841 0.00127
NP_441644.1_6 Forward -285 -275 13.0576 0.0244
NP_441644.1_6 Forward -163 -153 11.8776 0.0417
NP_441644.1_6 Reverse -154 -164 11.2876 0.0524
NP_441644.1_6 Forward -354 -344 10.1076 0.0628
NP_441644.1_6 Forward -122 -112 10.1076 0.0628
NP_441644.1_6 Reverse -276 -286 7.74772 0.117
NP_441644.1_6 Reverse -160 -170 6.76441 0.147
NP_441644.1_6 Reverse -189 -199 5.28945 0.199
NP_441644.1_6 Reverse -385 -395 3.51951 0.277
NP_443049.1_6 Forward -395 -385 11.8361 0.24
NP_443049.1_6 Reverse -238 -248 11.0554 0.282
NP_442215.1_2 Reverse -343 -359 2.8118 0.108
NP_442215.1_2 Forward -356 -340 0.156866 0.156
NP_442215.1_2 Reverse -111 -127 -6.23465 0.266
NP_442029.1_1 Forward -281 -262 -14.5535 0.272
NP_440253.1_2 Reverse -113 -131 12.2122 0.0292
NP_440253.1_2 Forward -354 -336 4.44404 0.104
NP_440253.1_2 Forward -122 -104 1.78911 0.152
NP_440929.1_8 Forward -354 -345 19.2726 0.000701
NP_440929.1_8 Reverse -345 -354 19.2726 0.000701
NP_440929.1_8 Forward -122 -113 19.2726 0.000701
NP_440929.1_8 Reverse -113 -122 19.2726 0.000701
NP_440929.1_8 Reverse -177 -186 4.81794 0.176
NP_440566.1_9 Reverse -172 -191 19.372 0.262
NP_440780.1_1 Reverse -324 -343 6.63627 0.295
NP_442933.1_10 Forward -354 -345 17.601 0.00325
NP_442933.1_10 Reverse -345 -354 17.601 0.00325
NP_442933.1_10 Forward -122 -113 17.601 0.00325
NP_442933.1_10 Reverse -113 -122 17.601 0.00325
NP_442933.1_10 Reverse -189 -198 13.9627 0.0192
NP_442933.1_10 Forward -198 -189 8.1612 0.0885
NP_442933.1_10 Forward -285 -276 5.11294 0.204
NP_442933.1_10 Forward -303 -294 4.42462 0.246
NP_440891.1_8 Forward -114 -95 22.9965 0.00856
NP_441751.2_8 Reverse -114 -128 6.3911 0.0354
NP_441751.2_8 Reverse -346 -360 4.03116 0.0563
NP_441751.2_8 Forward -284 -270 3.44117 0.0661
NP_441751.2_8 Reverse -155 -169 1.67122 0.101
NP_441751.2_8 Forward -121 -107 -2.45868 0.132
NP_442554.1_8 Reverse -346 -356 15.9097 0.00747
NP_442554.1_8 Reverse -114 -124 15.9097 0.00747
NP_442554.1_8 Forward -121 -111 13.8447 0.0145
NP_442554.1_8 Reverse -155 -165 13.7464 0.0153
NP_442554.1_8 Forward -353 -343 13.2547 0.0187
NP_442554.1_8 Reverse -277 -287 8.53483 0.074
NP_442554.1_8 Forward -197 -187 6.27322 0.123
NP_442554.1_8 Forward -284 -274 5.38824 0.15
NP_442554.1_8 Forward -162 -152 4.69992 0.176
NP_442554.1_8 Forward -302 -292 3.32329 0.23
NP_441762.1_7 Forward -355 -343 10.1671 0.0142
NP_441762.1_7 Forward -199 -187 4.5622 0.0462
NP_441762.1_7 Forward -123 -111 2.89058 0.0676
NP_441762.1_7 Reverse -344 -356 2.30059 0.0676
NP_441762.1_7 Reverse -112 -124 2.30059 0.0676
NP_441762.1_7 Reverse -176 -188 -5.07423 0.187
NP_441762.1_7 Forward -395 -383 -5.95921 0.258
NP_441762.1_7 Forward -187 -175 -7.43418 0.29
NP_442142.1_4 Reverse -342 -355 12.605 0.0434
NP_442142.1_4 Reverse -151 -164 11.5234 0.0552
NP_442142.1_4 Forward -166 -153 10.0485 0.0806
NP_442142.1_4 Forward -357 -344 8.86849 0.106
NP_442142.1_4 Forward -125 -112 8.77016 0.108
NP_442142.1_4 Reverse -110 -123 7.88518 0.127
NP_442142.1_4 Reverse -273 -286 5.42692 0.192
NP_442142.1_4 Reverse -186 -199 3.16532 0.265
NP_442292.1_1 Reverse -346 -355 18.486 0.00229
NP_442292.1_1 Reverse -114 -123 18.486 0.00229
NP_442292.1_1 Forward -353 -344 9.63616 0.0183
NP_442292.1_1 Forward -121 -112 9.63616 0.0183
NP_442292.1_1 Reverse -155 -164 5.80125 0.129
NP_442292.1_1 Reverse -277 -286 5.01461 0.168
NP_442292.1_1 Forward -197 -188 -0.0986038 0.239
NP_442292.1_1 Forward -284 -275 -0.68859 0.268
NP_442476.1_6 Forward -121 -107 12.3893 0.0504
NP_442476.1_6 Reverse -346 -360 5.89945 0.131
NP_441711.1_4 Forward -294 -275 7.86593 0.144
NP_443009.1_5 Forward -355 -344 18.3477 0.00265
NP_443009.1_5 Forward -123 -112 18.3477 0.00265
NP_443009.1_5 Forward -199 -188 12.6445 0.0456
NP_443009.1_5 Reverse -293 -304 11.8579 0.0602
NP_442408.2_1 Reverse -345 -364 -6.49039 0.282
NP_441715.1_4 Forward -121 -111 16.303 0.0117
NP_441715.1_4 Reverse -346 -356 14.828 0.0268
NP_441715.1_4 Reverse -114 -124 14.828 0.0268
NP_441715.1_4 Forward -353 -343 9.41981 0.097
NP_440357.1_3 Reverse -363 -382 -1.18052 0.297
NP_440357.1_9 Forward -365 -346 18.9773 0.204
NP_440015.1_9 Reverse -345 -363 12.9005 0.0739
NP_440183.1_9 Reverse -256 -275 -5.01543 0.197
NP_441198.1_8 Forward -305 -295 12.3924 0.135
NP_441198.1_8 Reverse -292 -302 12.2947 0.144
NP_440379.1_5 Forward -369 -350 -10.227 0.276
NP_441468.1_1 Forward -353 -346 15.8704 0.0124
NP_441468.1_1 Reverse -346 -353 15.8704 0.0124
NP_441468.1_1 Forward -121 -114 15.8704 0.0124
NP_441468.1_1 Reverse -114 -121 15.8704 0.0124
NP_441468.1_1 Forward -197 -190 6.13563 0.209
NP_441468.1_1 Reverse -190 -197 6.0373 0.223
NP_441468.1_1 Forward -284 -277 4.46401 0.224
NP_441468.1_1 Reverse -155 -162 3.97235 0.277
NP_441468.1_1 Forward -302 -295 3.97235 0.277
NP_441468.1_1 Forward -162 -155 3.97235 0.277
NP_441020.2_6 Forward -356 -339 13.6085 0.0708
NP_441020.2_6 Reverse -175 -192 13.1169 0.0791
NP_441020.2_6 Forward -124 -107 9.08529 0.18
NP_441015.1_10 Forward -284 -265 -9.93197 0.282
NP_441015.1_10 Reverse -249 -268 -11.6036 0.298
NP_441673.1_1 Forward -354 -345 20.8459 0.000698
NP_441673.1_1 Reverse -345 -354 20.8459 0.000698
NP_441673.1_1 Forward -122 -113 20.8459 0.000698
NP_441673.1_1 Reverse -113 -122 20.8459 0.000698
NP_441673.1_1 Forward -285 -276 1.67135 0.0404
NP_441673.1_1 Reverse -276 -285 1.47469 0.0936
NP_441673.1_1 Forward -198 -189 1.37636 0.114
NP_441673.1_1 Reverse -189 -198 1.1797 0.163
NP_441826.1_2 Reverse -339 -353 9.63603 0.0572
NP_441826.1_2 Reverse -270 -284 3.04785 0.115
NP_441826.1_2 Forward -169 -155 -3.44199 0.285
NP_441826.1_2 Forward -400 -386 -3.93365 0.29
NP_441826.1_2 Forward -128 -114 -4.13031 0.292
NP_441637.1_9 Forward -226 -208 -2.24246 0.292
NP_442490.1_9 Reverse -177 -196 -6.78538 0.275
NP_441764.1_8 Forward -85 -75 13.5119 0.284
NP_442868.1_6 Forward -356 -346 9.91146 0.038
NP_442868.1_6 Forward -124 -114 9.91146 0.038
NP_442868.1_6 Reverse -111 -121 0.963343 0.205
NP_442868.1_6 Reverse -343 -353 0.865012 0.205
NP_442868.1_6 Reverse -274 -284 0.865012 0.205
NP_441612.1_2 Reverse -345 -355 8.54929 0.21
NP_441612.1_2 Reverse -113 -123 8.54929 0.21
NP_441612.1_2 Reverse -206 -216 8.16203 0.233
NP_443058.1_7 Forward -243 -224 3.6377 0.26
NP_442361.1_3 Reverse -339 -352 12.6056 0.183
NP_442361.1_3 Forward -400 -387 7.98409 0.285
NP_442808.1_1 Reverse -344 -354 18.4657 0.00201
NP_442808.1_1 Reverse -112 -122 18.4657 0.00201
NP_442808.1_1 Reverse -384 -394 17.8758 0.00311
NP_442808.1_1 Forward -355 -345 8.63269 0.0481
NP_442808.1_1 Forward -123 -113 8.63269 0.0481
NP_441101.1_1 Forward -287 -269 9.75391 0.286
NP_442775.1_6 Forward -284 -265 12.0942 0.277
NP_440031.1_10 Forward -296 -277 -0.4922 0.285
NP_441315.1_1 Forward -190 -172 18.8987 0.257
NP_441315.1_2 Forward -273 -255 25.0378 0.00109
NP_441315.1_2 Reverse -266 -284 18.9498 0.137
NP_440145.1_3 Forward -313 -294 2.0644 0.121
NP_442820.1_3 Forward -372 -362 13.2542 0.277
NP_442542.1_2 Forward -287 -274 12.3107 0.114
NP_442542.1_2 Reverse -111 -124 11.4257 0.114
NP_442542.1_2 Reverse -343 -356 11.3273 0.114
NP_442542.1_2 Reverse -383 -396 9.75405 0.131
NP_442542.1_2 Forward -171 -158 9.2624 0.137
NP_442050.1_5 Forward -356 -346 16.4991 0.00812
NP_442050.1_5 Forward -124 -114 16.4991 0.00812
NP_442050.1_5 Reverse -111 -121 9.12434 0.193
NP_442050.1_5 Forward -200 -190 7.84605 0.243
NP_440558.1_2 Forward -131 -112 -4.72043 0.248
NP_440111.2_2 Reverse -355 -374 -4.81876 0.292
NP_442593.1_1 Reverse -160 -179 18.0924 0.193
NP_441518.1_3 Reverse -167 -186 -14.9469 0.284
NP_441878.1_6 Forward -355 -345 10.4031 0.0176
NP_441878.1_6 Reverse -344 -354 10.4031 0.0176
NP_441878.1_6 Forward -123 -113 10.4031 0.0176
NP_441878.1_6 Reverse -112 -122 10.4031 0.0176
NP_441878.1_6 Forward -286 -276 2.63497 0.0333
NP_441878.1_6 Forward -170 -160 2.24165 0.0462
NP_441878.1_6 Forward -164 -154 0.668351 0.139
NP_441878.1_6 Reverse -153 -163 0.668351 0.139
NP_441878.1_6 Reverse -275 -285 -0.118297 0.167
NP_441878.1_6 Reverse -293 -303 -0.314959 0.174
NP_441878.1_6 Forward -264 -254 -7.39479 0.222
NP_441878.1_6 Reverse -253 -263 -7.59145 0.245
NP_441036.1_8 Reverse -344 -354 17.7779 0.000554
NP_441036.1_8 Reverse -112 -122 17.7779 0.000554
NP_441036.1_8 Forward -199 -189 13.8447 0.0353
NP_441036.1_8 Forward -187 -177 12.0747 0.0944
NP_441036.1_8 Forward -355 -345 8.33817 0.174
NP_441036.1_8 Forward -123 -113 8.33817 0.174
NP_441557.1_5 Forward -354 -345 19.9609 0.000699
NP_441557.1_5 Reverse -345 -354 19.9609 0.000699
NP_441557.1_5 Forward -122 -113 19.9609 0.000699
NP_441557.1_5 Reverse -113 -122 19.9609 0.000699
NP_441557.1_5 Reverse -189 -198 8.84951 0.0343
NP_441557.1_5 Forward -285 -276 0.786375 0.106
NP_441557.1_5 Forward -198 -189 0.786375 0.106
NP_441557.1_5 Reverse -276 -285 0.589713 0.134
NP_441557.1_5 Reverse -294 -303 -0.885252 0.26
NP_441445.1_1 Forward -363 -344 6.29264 0.152
NP_441445.1_1 Forward -131 -112 4.22769 0.197
NP_441445.1_1 Reverse -104 -123 0.982764 0.264
NP_442066.2_9 Reverse -109 -122 11.524 0.154
NP_441308.1_8 Reverse -111 -121 10.1081 0.22
NP_441458.1_10 Reverse -336 -355 4.52268 0.23
NP_442183.1_1 Forward -122 -108 23.2057 0.00203
NP_442183.1_1 Forward -354 -340 12.3893 0.0597
NP_442183.1_1 Reverse -345 -359 8.55439 0.113
NP_441407.1_5 Forward -313 -294 6.68596 0.187
NP_442397.1_9 Reverse -247 -266 1.67108 0.283
NP_440356.1_9 Reverse -226 -245 16.1257 0.198
NP_441574.1_1 Reverse -177 -196 3.34271 0.146
NP_441574.1_1 Forward -237 -218 -6.09707 0.273
NP_441574.1_1 Forward -288 -269 -6.98204 0.283
NP_440276.1_8 Reverse -71 -90 10.6192 0.232
NP_442444.1_6 Forward -293 -275 14.6617 0.21
NP_441549.1_9 Reverse -272 -290 -9.81395 0.261
NP_442170.1_5 Reverse -294 -313 -1.96717 0.254
NP_442347.1_2 Reverse -346 -355 12.4878 0.056
NP_442347.1_2 Reverse -114 -123 12.4878 0.056
NP_442347.1_2 Forward -353 -344 11.1111 0.056
NP_442347.1_2 Forward -121 -112 11.1111 0.056
NP_442347.1_2 Forward -247 -238 8.35786 0.0927
NP_442347.1_2 Reverse -65 -74 3.93297 0.284
NP_442645.1_2 Forward -130 -111 5.40766 0.0214
NP_442645.1_2 Forward -287 -268 -8.06369 0.12
NP_442645.1_2 Reverse -246 -265 -13.2752 0.148
NP_442645.1_2 Forward -362 -343 -13.8652 0.165
NP_442645.1_2 Forward -171 -152 -17.3068 0.253
NP_442645.1_2 Reverse -337 -356 -22.5183 0.291
NP_442965.1_2 Forward -89 -70 -3.83545 0.255
NP_441037.1_4 Reverse -187 -197 15.2117 0.028
NP_441037.1_4 Reverse -343 -353 14.7245 0.028
NP_441037.1_4 Reverse -111 -121 7.02532 0.237
NP_441037.1_4 Forward -287 -277 5.85583 0.296
NP_442317.1_6 Reverse -289 -308 5.01433 0.24
NP_441633.1_3 Reverse -343 -356 3.36254 0.0699
NP_441633.1_3 Forward -356 -343 1.39592 0.109
NP_441633.1_3 Forward -124 -111 1.29759 0.109
NP_441633.1_3 Reverse -111 -124 -3.81562 0.177
NP_440136.1_2 Forward -353 -346 15.9687 0.0123
NP_440136.1_2 Reverse -346 -353 15.9687 0.0123
NP_440136.1_2 Forward -121 -114 15.9687 0.0123
NP_440136.1_2 Reverse -114 -121 15.9687 0.0123
NP_440136.1_2 Forward -197 -190 6.23397 0.171
NP_440136.1_2 Reverse -190 -197 6.13563 0.193
NP_442590.1_10 Forward -360 -341 7.57094 0.223
NP_442590.1_10 Forward -354 -335 7.27595 0.23
NP_442998.1_10 Forward -352 -345 15.5754 0.0102
NP_442998.1_10 Reverse -347 -354 15.5754 0.0102
NP_442998.1_10 Forward -196 -189 15.5754 0.0102
NP_442998.1_10 Forward -120 -113 15.5754 0.0102
NP_442998.1_10 Reverse -115 -122 15.5754 0.0102
NP_442998.1_10 Reverse -387 -394 12.5271 0.0457
NP_440299.1_1 Forward -126 -113 18.9965 0.00298
NP_440299.1_1 Reverse -341 -354 11.9167 0.0427
NP_440299.1_1 Reverse -109 -122 10.8351 0.0529
NP_440299.1_1 Forward -358 -345 10.2451 0.058
NP_440299.1_1 Reverse -185 -198 7.68852 0.107
NP_440299.1_1 Reverse -290 -303 5.82024 0.162
NP_441799.1_1 Forward -358 -344 18.5835 0.00832
NP_441799.1_1 Forward -126 -112 13.8636 0.0293
NP_441799.1_1 Reverse -109 -123 11.012 0.0629
NP_441799.1_1 Reverse -341 -355 5.70218 0.197
NP_441799.1_1 Forward -202 -188 5.50552 0.206
NP_441799.1_1 Reverse -272 -286 3.93223 0.274
NP_442528.1_10 Forward -80 -61 16.2241 0.205
NP_442802.1_6 Forward -199 -180 2.85105 0.204
NP_441007.1_10 Forward -290 -277 12.8023 0.0499
NP_441007.1_10 Forward -359 -346 1.69091 0.203
NP_441007.1_10 Forward -168 -155 1.39592 0.203
NP_441007.1_10 Reverse -108 -121 1.39592 0.203
NP_440256.1_1 Forward -357 -338 -0.688862 0.0954
NP_440256.1_1 Forward -125 -106 -3.04881 0.126
NP_440256.1_1 Reverse -273 -292 -9.24366 0.275
NP_441559.1_8 Reverse -340 -354 -6.29359 0.276
NP_441559.1_8 Forward -359 -345 -6.78525 0.279
NP_440915.1_6 Forward -307 -293 6.98109 0.0772
NP_440915.1_6 Reverse -185 -199 6.6861 0.081
NP_440915.1_6 Reverse -341 -355 6.29277 0.0828
NP_440915.1_6 Forward -126 -112 0.786239 0.153
NP_442158.1_4 Reverse -78 -88 13.2547 0.234
NP_442855.1_3 Forward -294 -275 17.994 0.113
NP_442785.1_7 Forward -265 -251 8.45605 0.297
NP_441704.1_8 Forward -133 -114 6.1935 0.262
NP_442069.1_1 Reverse -346 -365 17.8948 0.261
NP_440748.1_5 Forward -195 -176 -1.47551 0.267
NP_441464.1_8 Reverse -276 -290 9.2427 0.192
NP_441464.1_8 Reverse -160 -174 9.04604 0.192
NP_440695.1_6 Forward -112 -98 9.73265 0.276
NP_442993.1_1 Reverse -345 -361 0.156866 0.0653
NP_442993.1_1 Reverse -154 -170 -3.08806 0.125
NP_442993.1_1 Forward -122 -106 -9.38124 0.185
NP_442993.1_1 Reverse -189 -205 -10.1679 0.21
NP_442993.1_1 Forward -285 -269 -10.4629 0.22
NP_442993.1_1 Reverse -276 -292 -13.0195 0.283
NP_442386.1_9 Reverse -344 -353 15.7322 0.0144
NP_442386.1_9 Reverse -112 -121 15.7322 0.0144
NP_442386.1_9 Forward -355 -346 13.8639 0.0289
NP_442386.1_9 Forward -123 -114 13.8639 0.0289
NP_442386.1_9 Forward -164 -155 10.324 0.132
NP_442386.1_9 Reverse -188 -197 5.89917 0.233
NP_442386.1_9 Reverse -153 -162 4.81753 0.282
NP_440570.1_5 Forward -295 -276 -2.26216 0.278
NP_441340.1_5 Forward -353 -346 15.6737 0.0124
NP_441340.1_5 Reverse -346 -353 15.6737 0.0124
NP_441340.1_5 Forward -121 -114 15.6737 0.0124
NP_441340.1_5 Reverse -114 -121 15.6737 0.0124
NP_441340.1_5 Reverse -190 -197 6.13563 0.175
NP_441340.1_5 Forward -197 -190 5.93897 0.198
NP_441340.1_5 Reverse -155 -162 4.07068 0.239
NP_441340.1_5 Forward -162 -155 4.07068 0.239
NP_441340.1_5 Forward -393 -386 3.97235 0.274
NP_441340.1_5 Reverse -277 -284 3.97235 0.274
NP_441340.1_9 Forward -85 -75 7.00193 0.297
NP_441271.1_1 Forward -204 -186 12.4081 0.236
NP_440168.1_4 Reverse -150 -169 0.982764 0.22
NP_442506.1_2 Forward -365 -346 5.50599 0.269
NP_440161.1_3 Forward -124 -105 9.93088 0.237
NP_441134.1_4 Forward -245 -226 13.7658 0.0925
NP_440586.1_8 Forward -353 -346 13.2151 0.026
NP_440586.1_8 Forward -121 -114 13.2151 0.026
NP_440586.1_8 Reverse -346 -353 13.2151 0.026
NP_440586.1_8 Reverse -114 -121 13.2151 0.026
NP_440586.1_8 Reverse -190 -197 11.4451 0.0645
NP_440586.1_8 Reverse -352 -359 10.7568 0.128
NP_440586.1_8 Forward -162 -155 7.61025 0.227
NP_440586.1_8 Reverse -155 -162 7.61025 0.227
NP_440586.1_8 Forward -256 -249 5.64364 0.297
NP_442251.1_6 Forward -353 -346 15.2804 0.0124
NP_442251.1_6 Reverse -346 -353 15.2804 0.0124
NP_442251.1_6 Forward -121 -114 15.2804 0.0124
NP_442251.1_6 Reverse -114 -121 15.2804 0.0124
NP_442251.1_6 Forward -197 -190 12.0355 0.0627
NP_440192.1_3 Forward -305 -286 19.5673 0.048
NP_442959.1_6 Forward -47 -28 3.04771 0.245
NP_440684.1_9 Reverse -270 -284 14.6509 0.119
NP_440684.1_9 Reverse -339 -353 11.5043 0.173
NP_440684.1_9 Reverse -107 -121 9.43936 0.221
NP_441262.1_3 Reverse -345 -352 14.7888 0.0223
NP_441262.1_3 Reverse -189 -196 14.7888 0.0223
NP_441262.1_3 Reverse -113 -120 14.7888 0.0223
NP_441262.1_3 Forward -354 -347 14.7888 0.0223
NP_441262.1_3 Forward -122 -115 14.7888 0.0223
NP_440523.1_7 Reverse -352 -371 9.83255 0.296
NP_440027.1_3 Forward -303 -285 2.87 0.284
NP_440027.1_3 Reverse -335 -353 2.67334 0.289
NP_443051.1_1 Reverse -344 -353 10.4228 0.00754
NP_443051.1_1 Reverse -112 -121 10.4228 0.00754
NP_443051.1_1 Forward -355 -346 10.4228 0.00754
NP_443051.1_1 Forward -123 -114 10.4228 0.00754
NP_443051.1_1 Forward -395 -386 5.3096 0.0964
NP_443051.1_1 Reverse -188 -197 0.786375 0.125
NP_443051.1_1 Forward -199 -190 0.491382 0.151
NP_443051.1_1 Forward -286 -277 0.393051 0.169
NP_441232.1_10 Forward -365 -346 7.96426 0.142
NP_439937.1_8 Reverse -175 -194 -1.47551 0.249
NP_439937.1_9 Reverse -344 -361 -6.64833 0.157
NP_439937.1_9 Reverse -112 -129 -16.4814 0.287
NP_440439.1_1 Forward -357 -344 9.55739 0.0454
NP_440439.1_1 Reverse -110 -123 1.10092 0.162
NP_440439.1_1 Reverse -186 -199 0.510939 0.188
NP_440439.1_1 Forward -125 -112 0.0192843 0.203
NP_439943.1_4 Forward -372 -353 3.93269 0.287
NP_440372.1_2 Forward -353 -346 16.3621 0.0124
NP_440372.1_2 Reverse -346 -353 16.3621 0.0124
NP_440372.1_2 Forward -121 -114 16.3621 0.0124
NP_440372.1_2 Reverse -114 -121 16.3621 0.0124
NP_440372.1_2 Reverse -190 -197 6.72562 0.0929
NP_440372.1_2 Forward -197 -190 6.62729 0.151
NP_440819.1_5 Forward -103 -95 7.59091 0.272
NP_440316.1_10 Forward -395 -385 14.6313 0.182
NP_440316.1_10 Forward -164 -154 8.4365 0.239
NP_441803.1_2 Reverse -155 -174 5.211 0.17
NP_441803.1_2 Reverse -258 -277 4.916 0.171
NP_441803.1_2 Forward -359 -340 1.47442 0.23
NP_439977.1_5 Reverse -107 -126 -2.55715 0.284
NP_440139.1_1 Reverse -107 -126 8.75009 0.109
NP_440139.1_1 Forward -128 -109 4.52188 0.18
NP_440139.1_1 Reverse -379 -398 3.9319 0.194
NP_441572.1_7 Reverse -107 -126 -6.49039 0.293
NP_442384.1_10 Reverse -345 -358 17.1289 0.00642
NP_442384.1_10 Reverse -113 -126 16.7355 0.00732
NP_442384.1_10 Forward -303 -290 16.3422 0.00854
NP_442384.1_10 Forward -122 -109 14.1789 0.0163
NP_442384.1_10 Forward -354 -341 8.37742 0.0656
NP_442384.1_10 Forward -169 -156 5.82081 0.118
NP_442384.1_10 Reverse -248 -261 4.14919 0.167
NP_442114.1_4 Forward -198 -187 16.7749 0.107
NP_441877.1_7 Forward -268 -249 1.08032 0.244
NP_442790.1_4 Reverse -267 -286 -10.6203 0.215
NP_442790.1_4 Reverse -336 -355 -13.8652 0.268
NP_442790.1_4 Reverse -104 -123 -14.1602 0.272
NP_442262.1_10 Forward -353 -346 14.1988 0.0123
NP_442262.1_10 Reverse -346 -353 14.1988 0.0123
NP_442262.1_10 Forward -121 -114 14.1988 0.0123
NP_442262.1_10 Reverse -114 -121 14.1988 0.0123
NP_442262.1_10 Forward -162 -155 10.4622 0.145
NP_442262.1_10 Reverse -155 -162 10.4622 0.145
NP_442262.1_10 Reverse -386 -393 9.47889 0.187
NP_442262.1_10 Forward -374 -367 8.8889 0.219
NP_441689.1_5 Forward -356 -346 15.3192 0.0403
NP_441689.1_5 Forward -124 -114 15.3192 0.0403
NP_441689.1_5 Forward -200 -190 10.8943 0.132
NP_441689.1_5 Reverse -111 -121 8.53436 0.132
NP_440163.1_10 Reverse -110 -120 14.238 0.102
NP_440163.1_10 Forward -166 -156 13.5497 0.122
NP_440163.1_10 Reverse -273 -283 10.6981 0.198
NP_440163.1_10 Forward -125 -115 10.4031 0.201
NP_440163.1_10 Reverse -157 -167 9.12481 0.247
NP_440344.1_10 Reverse -338 -355 10.3636 0.0072
NP_440344.1_10 Reverse -106 -123 1.71047 0.0299
NP_440344.1_10 Forward -361 -344 -8.51595 0.129
NP_440344.1_10 Reverse -147 -164 -8.51595 0.129
NP_440344.1_10 Reverse -182 -199 -9.99092 0.163
NP_440344.1_10 Forward -129 -112 -10.2859 0.174
NP_440344.1_10 Forward -193 -176 -10.4826 0.182
NP_440531.1_6 Forward -362 -343 17.8957 0.0353
NP_441965.1_10 Forward -125 -109 8.90832 0.123
NP_441965.1_10 Reverse -342 -358 7.63002 0.144
NP_441965.1_10 Reverse -110 -126 2.41848 0.288
NP_441640.1_8 Reverse -346 -365 -1.96717 0.225
NP_442529.1_4 Reverse -180 -199 10.7175 0.221
NP_442693.1_7 Forward -264 -245 8.06259 0.275
NP_440297.1_9 Reverse -346 -356 9.32148 0.0917
NP_440297.1_9 Reverse -155 -165 9.32148 0.0917
NP_440297.1_9 Forward -121 -111 9.32148 0.0917
NP_440297.1_9 Reverse -114 -124 9.32148 0.0917
NP_440297.1_9 Reverse -386 -396 0.471689 0.282
NP_440297.1_9 Forward -353 -343 -0.118297 0.282
NP_440297.1_9 Forward -284 -274 -0.41329 0.283
NP_440297.1_9 Forward -302 -292 -0.511621 0.289
NP_442280.1_10 Reverse -71 -89 10.3244 0.223
NP_442280.1_10 Reverse -382 -400 7.69463 0.268
NP_442280.1_10 Reverse -77 -95 6.42843 0.275
NP_441592.1_4 Reverse -154 -173 -3.04881 0.274
NP_440700.1_8 Forward -84 -70 10.3243 0.292
NP_440894.1_10 Reverse -172 -191 5.70265 0.228
NP_440894.1_10 Forward -359 -340 4.42435 0.254
NP_440894.1_10 Reverse -380 -399 2.3594 0.29
NP_440999.1_9 Reverse -341 -355 14.0609 0.0277
NP_440999.1_9 Reverse -109 -123 2.2612 0.152
NP_440999.1_9 Reverse -185 -199 1.47456 0.164
NP_440999.1_9 Reverse -253 -267 -3.04867 0.283
NP_440999.1_9 Reverse -272 -286 -3.24533 0.289
NP_440888.1_2 Reverse -113 -127 18.6818 0.00204
NP_440888.1_2 Reverse -345 -359 15.1419 0.0122
NP_440888.1_2 Forward -122 -108 13.9619 0.022
NP_440888.1_2 Reverse -276 -290 12.2903 0.0476
NP_440888.1_2 Forward -354 -340 9.43874 0.127
NP_440888.1_2 Forward -198 -184 7.96378 0.175
NP_440888.1_2 Reverse -294 -308 7.07881 0.208
NP_440179.1_6 Reverse -114 -133 4.12936 0.246
NP_442033.1_10 Reverse -343 -362 3.6377 0.086
NP_441543.1_2 Forward -353 -344 18.486 0.00236
NP_441543.1_2 Forward -121 -112 18.486 0.00236
NP_441543.1_2 Reverse -346 -355 16.9127 0.00359
NP_441543.1_2 Reverse -114 -123 16.9127 0.00359
NP_441543.1_2 Forward -197 -188 8.75118 0.0968
NP_441543.1_2 Reverse -217 -226 8.25953 0.104
NP_441543.1_2 Reverse -155 -164 5.11294 0.209
NP_441543.1_2 Reverse -277 -286 4.12963 0.279
NP_442845.1_2 Forward -169 -155 17.6008 0.0608
NP_442845.1_2 Forward -360 -346 14.6509 0.0775
NP_442845.1_2 Forward -128 -114 6.78443 0.202
NP_442845.1_2 Forward -309 -295 6.29277 0.212
NP_442845.1_2 Reverse -148 -162 5.70279 0.225
NP_442845.1_2 Reverse -107 -121 5.60446 0.228
NP_442845.1_2 Reverse -270 -284 4.62115 0.256
NP_442845.1_2 Forward -204 -190 4.32615 0.261
NP_440771.1_10 Reverse -118 -137 18.4855 0.282
NP_441319.1_8 Forward -128 -110 12.8022 0.125
NP_441918.1_7 Forward -355 -336 -2.45882 0.297
NP_440982.1_1 Reverse -351 -370 3.34192 0.297
NP_441469.1_8 Reverse -344 -353 16.126 0.00797
NP_441469.1_8 Reverse -112 -121 16.126 0.00797
NP_441469.1_8 Forward -355 -346 6.48957 0.227
NP_441469.1_8 Forward -123 -114 6.48957 0.227
NP_441469.1_8 Reverse -188 -197 6.29291 0.227
NP_441469.1_8 Forward -187 -178 5.40793 0.272
NP_443064.1_6 Reverse -345 -355 12.5669 0.0796
NP_443064.1_6 Reverse -113 -123 12.5669 0.0796
NP_442337.1_8 Reverse -80 -99 0.0977854 0.258
NP_442578.1_7 Forward -353 -346 14.5921 0.026
NP_442578.1_7 Forward -121 -114 14.5921 0.026
NP_442578.1_7 Reverse -346 -353 14.5921 0.026
NP_442578.1_7 Reverse -114 -121 14.5921 0.026
NP_442578.1_7 Reverse -190 -197 5.93897 0.183
NP_440710.1_1 Forward -130 -112 -9.12563 0.294
NP_440220.1_4 Reverse -68 -87 5.11187 0.205
NP_440148.1_3 Forward -289 -275 18.1908 0.208
NP_441462.1_2 Forward -354 -344 11.5831 0.00406
NP_441462.1_2 Reverse -345 -355 11.5831 0.00406
NP_441462.1_2 Forward -122 -112 11.5831 0.00406
NP_441462.1_2 Reverse -113 -123 11.5831 0.00406
NP_441462.1_2 Reverse -189 -199 9.81313 0.0143
NP_441462.1_2 Reverse -276 -286 8.92815 0.0286
NP_441462.1_2 Reverse -294 -304 -0.314959 0.206
NP_441621.1_7 Reverse -178 -192 -6.49025 0.295
NP_443062.1_1 Forward -122 -104 14.2013 0.051
NP_443062.1_1 Forward -198 -180 6.79079 0.192
NP_443062.1_1 Forward -354 -336 6.01073 0.211
NP_443062.1_1 Reverse -113 -131 4.45062 0.26
NP_443062.1_6 Reverse -337 -356 6.68596 0.18
NP_443062.1_6 Forward -130 -111 2.65439 0.252
NP_443062.1_6 Reverse -105 -124 1.27776 0.276
NP_441560.1_8 Forward -203 -184 16.3821 0.0748
NP_441351.1_8 Forward -281 -262 1.86774 0.265
NP_440516.1_2 Reverse -339 -357 9.45892 0.0998
NP_440516.1_2 Forward -360 -342 -2.73412 0.299
NP_440516.1_8 Forward -354 -345 16.9127 0.00442
NP_440516.1_8 Reverse -345 -354 16.9127 0.00442
NP_440516.1_8 Forward -122 -113 16.9127 0.00442
NP_440516.1_8 Reverse -113 -122 16.9127 0.00442
NP_440516.1_8 Forward -394 -385 9.14451 0.0354
NP_440516.1_8 Reverse -189 -198 8.1612 0.0417
NP_440516.1_8 Forward -163 -154 -0.590259 0.283
NP_441785.1_1 Forward -198 -184 12.3505 0.25
NP_442428.1_4 Reverse -112 -131 2.26107 0.266
NP_442428.1_5 Forward -353 -346 15.8704 0.0124
NP_442428.1_5 Reverse -346 -353 15.8704 0.0124
NP_442428.1_5 Forward -121 -114 15.8704 0.0124
NP_442428.1_5 Reverse -114 -121 15.8704 0.0124
NP_442428.1_5 Forward -302 -295 10.6589 0.0727
NP_442428.1_5 Forward -197 -190 6.13563 0.209
NP_442428.1_5 Reverse -190 -197 6.0373 0.212
NP_442428.1_5 Forward -284 -277 4.759 0.223
NP_442428.1_5 Forward -162 -155 4.36568 0.271
NP_442428.1_5 Reverse -155 -162 4.36568 0.271
NP_442120.1_10 Reverse -276 -295 -12.5869 0.273
NP_442823.1_8 Forward -101 -82 12.2908 0.275
NP_441867.1_2 Forward -80 -61 -14.5535 0.288
NP_440673.1_2 Forward -132 -113 10.6822 0.198
NP_440673.1_2 Reverse -266 -285 9.02386 0.259
NP_440673.1_2 Reverse -103 -122 7.75569 0.292
NP_440673.1_3 Forward -352 -345 12.4288 0.0426
NP_440673.1_3 Forward -196 -189 12.4288 0.0426
NP_440673.1_3 Forward -120 -113 12.4288 0.0426
NP_440673.1_3 Reverse -347 -354 12.4288 0.0426
NP_440673.1_3 Reverse -115 -122 12.4288 0.0426
NP_440673.1_3 Forward -373 -366 9.67555 0.179
NP_441052.1_2 Reverse -345 -355 19.9412 0.00106
NP_441052.1_2 Reverse -113 -123 19.9412 0.00106
NP_441052.1_2 Reverse -154 -164 14.3364 0.0224
NP_441052.1_2 Forward -354 -344 10.5014 0.0285
NP_441052.1_2 Forward -122 -112 10.5014 0.0285
NP_441052.1_2 Forward -285 -275 7.35486 0.0742
NP_441052.1_2 Forward -169 -159 5.09324 0.132
NP_441052.1_2 Forward -263 -253 4.0116 0.168
NP_441052.1_2 Reverse -64 -74 3.71661 0.175
NP_441052.1_2 Reverse -332 -342 -0.708283 0.294
NP_442219.1_8 Reverse -259 -278 7.87721 0.26
NP_442219.1_9 Reverse -346 -355 17.7976 0.00718
NP_442219.1_9 Reverse -114 -123 17.7976 0.00718
NP_442219.1_9 Forward -353 -344 8.35786 0.0681
NP_442219.1_9 Forward -121 -112 8.35786 0.0681
NP_442219.1_9 Forward -247 -238 2.35967 0.28
NP_440436.1_4 Forward -353 -344 18.1905 0.00233
NP_440436.1_4 Forward -121 -112 18.1905 0.00233
NP_440436.1_4 Reverse -346 -355 17.2072 0.00233
NP_440436.1_4 Reverse -114 -123 17.2072 0.00233
NP_440436.1_4 Forward -197 -188 14.9456 0.0103
NP_440436.1_4 Reverse -190 -199 4.7192 0.244
NP_440436.1_4 Reverse -155 -164 4.7192 0.244
NP_441884.1_9 Reverse -342 -361 -14.4552 0.138
NP_441884.1_9 Forward -288 -269 -23.6 0.284
NP_440314.1_9 Forward -121 -102 1.47442 0.0898
NP_440314.1_9 Reverse -346 -365 -5.70374 0.225
NP_440314.1_9 Forward -197 -178 -9.34199 0.264
NP_441719.1_4 Forward -353 -346 16.3621 0.0124
NP_441719.1_4 Reverse -346 -353 16.3621 0.0124
NP_441719.1_4 Forward -121 -114 16.3621 0.0124
NP_441719.1_4 Reverse -114 -121 16.3621 0.0124
NP_441719.1_4 Reverse -190 -197 6.72562 0.093
NP_441719.1_4 Forward -197 -190 6.62729 0.151
NP_441733.1_10 Forward -125 -112 7.19745 0.156
NP_441733.1_10 Forward -306 -293 3.46087 0.3
NP_441004.1_1 Reverse -264 -283 -11.1119 0.234
NP_441004.1_1 Forward -175 -156 -15.2418 0.273
NP_441004.1_1 Forward -89 -70 -16.9135 0.287
NP_441004.1_4 Forward -172 -162 9.12481 0.259
NP_442366.1_3 Forward -355 -337 9.45892 0.0558
NP_442366.1_3 Reverse -112 -130 -5.48739 0.288
NP_442366.1_5 Reverse -342 -352 12.7626 0.108
NP_442366.1_5 Reverse -291 -301 12.0743 0.147
NP_441115.1_4 Reverse -344 -362 10.3431 0.181
NP_442206.1_10 Forward -122 -107 5.28977 0.178
NP_442206.1_10 Forward -242 -227 -0.0201027 0.279
NP_442206.1_10 Forward -354 -339 -0.511758 0.298
NP_443054.1_2 Forward -356 -342 20.4524 0.0119
NP_443054.1_2 Forward -124 -110 3.04785 0.24
NP_443054.1_2 Forward -200 -186 2.85119 0.24
NP_443054.1_2 Reverse -158 -172 0.491246 0.262
NP_442430.1_2 Reverse -150 -169 2.65439 0.268
NP_442308.1_4 Forward -192 -173 7.57094 0.267
NP_441851.1_10 Reverse -344 -354 16.008 0.00552
NP_441851.1_10 Reverse -112 -122 16.008 0.00552
NP_441851.1_10 Forward -355 -345 15.8113 0.00552
NP_441851.1_10 Forward -123 -113 15.8113 0.00552
NP_441851.1_10 Reverse -293 -303 7.55152 0.137
NP_441851.1_10 Reverse -188 -198 7.45319 0.14
NP_442208.1_5 Forward -272 -253 -7.37537 0.271
NP_441542.1_4 Forward -106 -92 4.03116 0.264
NP_442856.1_7 Forward -369 -350 -6.29373 0.297
NP_441668.1_4 Reverse -103 -122 -2.26216 0.288
NP_442515.1_1 Forward -123 -109 13.3726 0.0278
NP_442515.1_1 Reverse -344 -358 9.04604 0.0671
NP_442515.1_1 Reverse -112 -126 2.2612 0.14
NP_442515.1_1 Reverse -275 -289 -4.52363 0.298
NP_442515.1_1 Reverse -159 -173 -4.52363 0.298
NP_440593.1_3 Forward -284 -265 1.96607 0.182
NP_440593.1_3 Reverse -346 -365 -6.88371 0.282
NP_440593.1_3 Reverse -265 -284 -7.17871 0.288
NP_440593.1_3 Forward -302 -283 -7.67036 0.298
NP_441046.1_2 Reverse -243 -262 7.96426 0.221
NP_441046.1_2 Reverse -102 -121 -1.7705 0.292
NP_440940.1_7 Reverse -335 -353 3.16499 0.277
NP_441349.1_10 Forward -364 -345 9.63589 0.0242
NP_441349.1_10 Forward -132 -113 -4.91709 0.186
NP_441661.1_3 Forward -389 -372 -5.76269 0.283
NP_441409.1_6 Forward -360 -341 1.37609 0.0606
NP_441409.1_6 Forward -204 -185 -5.99873 0.118
NP_441409.1_6 Reverse -288 -307 -11.8003 0.224
NP_441409.1_6 Reverse -107 -126 -14.7502 0.266
NP_442314.1_1 Forward -274 -256 -4.40575 0.259
NP_440432.1_9 Reverse -295 -310 8.92802 0.0427
NP_440432.1_9 Reverse -277 -292 4.99478 0.0602
NP_440432.1_9 Forward -197 -182 -2.97003 0.177
NP_440432.1_9 Forward -353 -338 -3.26502 0.179
NP_440432.1_9 Forward -121 -106 -3.36336 0.179
NP_442843.1_1 Forward -89 -70 5.50599 0.144
NP_442843.1_1 Forward -88 -69 -9.34199 0.265
NP_439960.1_10 Forward -367 -349 -3.32411 0.27
NP_440474.1_8 Forward -121 -107 12.2903 0.0894
NP_440474.1_8 Reverse -114 -128 5.21053 0.254
NP_440474.1_8 Reverse -277 -291 4.62054 0.271
NP_442450.1_5 Reverse -111 -121 9.32148 0.115
NP_442450.1_5 Forward -356 -346 9.32148 0.115
NP_442450.1_5 Forward -124 -114 9.32148 0.115
NP_442450.1_5 Reverse -343 -353 7.55152 0.13
NP_442450.1_5 Reverse -292 -302 5.09324 0.263
NP_440588.1_2 Forward -363 -344 12.7825 0.024
NP_440588.1_3 Reverse -259 -278 10.0292 0.253
NP_440195.1_4 Reverse -101 -120 13.0775 0.127
NP_440195.1_4 Reverse -177 -196 5.70265 0.284
NP_440943.1_5 Forward -236 -222 16.4209 0.22
NP_441570.1_1 Reverse -345 -363 -4.20908 0.0743
NP_441570.1_1 Reverse -276 -294 -11.3872 0.194
NP_441570.1_1 Reverse -113 -131 -15.6155 0.231
NP_441570.1_1 Forward -354 -336 -17.2871 0.269
NP_441078.1_4 Forward -354 -345 19.6659 0.0007
NP_441078.1_4 Reverse -345 -354 19.6659 0.0007
NP_441078.1_4 Forward -122 -113 19.6659 0.0007
NP_441078.1_4 Reverse -113 -122 19.6659 0.0007
NP_441078.1_4 Forward -285 -276 7.96454 0.0404
NP_441078.1_4 Forward -263 -254 6.29291 0.079
NP_441078.1_4 Forward -303 -294 5.11294 0.118
NP_441078.1_4 Reverse -276 -285 0.786375 0.157
NP_441078.1_4 Forward -198 -189 0.196389 0.205
NP_441078.1_4 Reverse -189 -198 -0.000272808 0.205
NP_441078.1_4 Forward -394 -385 -1.37691 0.254
NP_441078.1_4 Reverse -254 -263 -1.6719 0.266
NP_441078.1_4 Forward -169 -160 -1.6719 0.266
NP_441078.1_4 Forward -163 -154 -1.6719 0.266
NP_441078.1_4 Reverse -154 -163 -1.77023 0.266
NP_442729.1_5 Forward -164 -154 8.33817 0.248
NP_442729.1_8 Reverse -109 -122 18.8988 0.0312
NP_442729.1_8 Forward -126 -113 10.1474 0.125
NP_442729.1_8 Forward -358 -345 9.75405 0.125
NP_442388.1_3 Forward -175 -156 4.32602 0.293
NP_440526.1_3 Forward -197 -186 8.90795 0.11
NP_440526.1_3 Reverse -277 -288 2.12315 0.267
NP_440526.1_3 Forward -353 -342 2.02482 0.267
NP_440526.1_3 Reverse -161 -172 1.92649 0.267
NP_440526.1_3 Reverse -114 -125 0.943182 0.267
NP_440526.1_3 Reverse -346 -357 0.844851 0.267
NP_440526.1_3 Reverse -155 -166 0.451529 0.281
NP_441432.1_8 Forward -355 -346 16.8143 0.00595
NP_441432.1_8 Forward -123 -114 16.8143 0.00595
NP_441432.1_8 Reverse -344 -353 8.25953 0.0755
NP_441432.1_8 Reverse -112 -121 8.25953 0.0755
NP_441432.1_8 Forward -164 -155 6.19458 0.118
NP_441432.1_8 Forward -286 -277 4.81794 0.196
NP_441432.1_8 Forward -395 -386 4.32629 0.223
NP_442320.1_4 Forward -209 -190 16.6165 0.267
NP_442320.1_8 Reverse -107 -121 13.8643 0.0144
NP_442320.1_8 Reverse -339 -353 5.30946 0.0394
NP_442320.1_8 Reverse -183 -197 -2.36035 0.0871
NP_442320.1_8 Forward -360 -346 -2.85201 0.1
NP_442320.1_8 Forward -128 -114 -3.83532 0.134
NP_442320.1_8 Forward -309 -295 -5.31028 0.217
NP_441732.1_2 Reverse -341 -357 2.91013 0.0145
NP_441732.1_2 Reverse -109 -125 -16.7561 0.195
NP_441732.1_2 Forward -358 -342 -17.346 0.253
NP_442003.1_4 Reverse -346 -365 20.354 0.0905
NP_442003.1_4 Forward -302 -283 9.93088 0.296
NP_442157.1_9 Reverse -224 -243 19.174 0.138
NP_440760.1_1 Forward -354 -335 -13.9635 0.119
NP_440760.1_1 Reverse -113 -132 -20.4534 0.222
NP_440760.1_1 Forward -263 -244 -23.2067 0.288
NP_440199.1_10 Forward -166 -156 15.6147 0.0861
NP_440199.1_10 Forward -357 -347 15.5163 0.0861
NP_440199.1_10 Forward -397 -387 9.41981 0.198
NP_440199.1_10 Reverse -273 -283 8.82982 0.229
NP_440199.1_10 Forward -125 -115 7.64985 0.231
NP_441945.1_10 Forward -298 -279 8.75091 0.273
NP_442353.1_4 Reverse -339 -358 16.5182 0.064
NP_440913.1_1 Reverse -274 -292 4.73903 0.257
NP_440713.1_4 Forward -364 -345 9.0459 0.157
NP_442489.1_7 Forward -354 -345 20.1576 0.000695
NP_442489.1_7 Reverse -345 -354 20.1576 0.000695
NP_442489.1_7 Forward -122 -113 20.1576 0.000695
NP_442489.1_7 Reverse -113 -122 20.1576 0.000695
NP_442489.1_7 Forward -285 -276 8.45619 0.0206
NP_442489.1_7 Forward -198 -189 0.884706 0.145
NP_442489.1_7 Reverse -276 -285 0.786375 0.152
NP_442489.1_7 Reverse -189 -198 0.491382 0.178
NP_442489.1_7 Forward -263 -254 -1.47524 0.203
NP_442489.1_7 Forward -303 -294 -1.6719 0.235
NP_442489.1_7 Forward -169 -160 -1.6719 0.235
NP_442489.1_7 Forward -163 -154 -1.6719 0.235
NP_442489.1_7 Reverse -154 -163 -1.77023 0.247
NP_442489.1_7 Reverse -160 -169 -1.96689 0.28
NP_442079.1_7 Reverse -190 -209 11.4058 0.101
NP_442079.1_7 Reverse -346 -365 4.916 0.184
NP_442079.1_7 Forward -121 -102 4.81767 0.187
NP_442079.1_7 Reverse -114 -133 1.17943 0.26
NP_440559.1_1 Reverse -346 -355 17.4043 0.00658
NP_440559.1_1 Reverse -114 -123 17.4043 0.00658
NP_440559.1_1 Forward -353 -344 8.75118 0.0586
NP_440559.1_1 Forward -121 -112 8.75118 0.0586
NP_440559.1_1 Forward -197 -188 5.50626 0.14
NP_441659.2_8 Reverse -345 -355 18.1713 0.00133
NP_441659.2_8 Reverse -113 -123 18.1713 0.00133
NP_441659.2_8 Reverse -276 -286 15.9097 0.00467
NP_441659.2_8 Forward -354 -344 11.9764 0.0147
NP_441659.2_8 Forward -122 -112 11.9764 0.0147
NP_441659.2_8 Reverse -189 -199 7.94484 0.052
NP_441659.2_8 Forward -198 -188 0.176696 0.271
NP_441022.1_1 Reverse -132 -141 10.587 0.294
NP_442913.1_10 Forward -294 -275 1.0811 0.147
NP_442913.1_10 Reverse -336 -355 0.196116 0.155
NP_442913.1_10 Forward -178 -159 -2.55715 0.187
NP_442346.1_5 Forward -355 -345 16.6963 0.00248
NP_442346.1_5 Forward -123 -113 16.6963 0.00248
NP_442346.1_5 Reverse -275 -285 11.6814 0.0606
NP_442346.1_5 Reverse -153 -163 10.5014 0.0934
NP_442346.1_5 Forward -170 -160 10.0098 0.11
NP_442346.1_5 Reverse -344 -354 9.02648 0.118
NP_442346.1_5 Reverse -112 -122 9.02648 0.118
NP_442346.1_5 Reverse -188 -198 7.15819 0.178
NP_442346.1_5 Reverse -293 -303 6.66654 0.195
NP_442346.1_5 Forward -164 -154 6.27322 0.208
NP_442346.1_5 Forward -286 -276 6.07655 0.216
NP_442346.1_5 Forward -199 -189 4.40493 0.29
NP_440545.1_3 Reverse -341 -358 -3.8944 0.214
NP_440545.1_3 Forward -126 -109 -4.87771 0.235
NP_441856.1_3 Forward -125 -106 -2.45882 0.261
NP_441786.1_10 Forward -363 -344 8.55425 0.233
NP_441653.1_2 Reverse -178 -197 7.2017 0.223
NP_442311.1_3 Reverse -328 -347 13.7649 0.227
NP_442603.1_7 Reverse -345 -359 18.6818 0.0125
NP_442603.1_7 Reverse -113 -127 11.1104 0.122
NP_442603.1_7 Forward -122 -108 6.48882 0.24
NP_441888.1_7 Reverse -340 -354 11.996 0.0743
NP_441888.1_7 Reverse -108 -122 2.85119 0.225
NP_441948.1_4 Forward -129 -111 -0.275845 0.139
NP_441833.1_4 Forward -353 -346 15.9687 0.0124
NP_441833.1_4 Reverse -346 -353 15.9687 0.0124
NP_441833.1_4 Forward -121 -114 15.9687 0.0124
NP_441833.1_4 Reverse -114 -121 15.9687 0.0124
NP_441833.1_4 Forward -197 -190 14.1004 0.0258
NP_441833.1_4 Reverse -190 -197 6.13563 0.198
NP_441329.1_1 Reverse -322 -341 5.68135 0.265
NP_441329.1_6 Reverse -197 -216 1.67069 0.232
NP_441329.1_6 Forward -33 -14 0.238307 0.26
NP_441895.1_2 Forward -90 -71 -17.7985 0.234
NP_442162.1_9 Forward -353 -346 16.2637 0.0124
NP_442162.1_9 Reverse -346 -353 16.2637 0.0124
NP_442162.1_9 Forward -121 -114 16.2637 0.0124
NP_442162.1_9 Reverse -114 -121 16.2637 0.0124
NP_442162.1_9 Forward -197 -190 6.62729 0.142
NP_442162.1_9 Reverse -190 -197 6.52896 0.178
NP_440671.1_4 Reverse -339 -353 8.94771 0.188
NP_440224.1_1 Forward -365 -346 3.83436 0.132
NP_441915.1_4 Reverse -253 -272 6.78348 0.293
NP_442199.1_5 Forward -194 -175 -4.81876 0.231
NP_442140.1_3 Forward -353 -343 16.2046 0.0255
NP_442140.1_3 Forward -121 -111 8.33817 0.119
NP_442140.1_3 Forward -197 -187 8.04317 0.124
NP_442140.1_3 Reverse -346 -356 4.40493 0.243
NP_442140.1_3 Reverse -114 -124 4.40493 0.243
NP_442140.1_3 Forward -374 -364 4.20827 0.254
NP_442140.1_3 Forward -162 -152 3.61828 0.288
NP_440875.1_9 Forward -196 -186 17.619 0.0104
NP_440875.1_9 Forward -352 -342 8.46937 0.233
NP_441813.1_5 Reverse -111 -121 17.188 0.00979
NP_441813.1_5 Forward -356 -346 15.9097 0.01
NP_441813.1_5 Forward -124 -114 15.9097 0.01
NP_441813.1_5 Reverse -343 -353 9.91146 0.021
NP_441813.1_5 Reverse -383 -393 6.56821 0.0875
NP_441813.1_5 Forward -200 -190 5.5849 0.118
NP_441813.1_5 Reverse -187 -197 0.176696 0.215
NP_440594.1_8 Reverse -190 -203 10.5401 0.16
NP_440590.1_4 Forward -197 -184 20.8655 0.00446
NP_440590.1_4 Forward -353 -340 12.8023 0.013
NP_440590.1_4 Reverse -346 -359 4.93583 0.0585
NP_440590.1_4 Reverse -114 -127 2.96921 0.0783
NP_440590.1_4 Forward -121 -108 -5.29059 0.277
NP_440567.1_1 Forward -121 -107 12.6843 0.022
NP_440567.1_1 Reverse -346 -360 7.76774 0.0654
NP_440567.1_1 Reverse -114 -128 6.88276 0.08
NP_440567.1_1 Forward -353 -339 4.81781 0.111
NP_440567.1_1 Forward -197 -183 -0.197071 0.27
NP_442497.1_10 Forward -353 -344 10.4228 0.0087
NP_442497.1_10 Forward -121 -112 10.4228 0.0087
NP_442497.1_10 Reverse -346 -355 10.4228 0.0087
NP_442497.1_10 Reverse -114 -123 10.4228 0.0087
NP_442497.1_10 Reverse -190 -199 5.89959 0.109
NP_442497.1_10 Forward -197 -188 0.688044 0.141
NP_442497.1_10 Reverse -386 -395 0.29472 0.199
NP_442497.1_10 Forward -302 -293 0.29472 0.199
NP_440821.1_4 Reverse -111 -121 19.0562 0.00399
NP_440821.1_4 Forward -356 -346 18.2696 0.00448
NP_440821.1_4 Forward -124 -114 18.2696 0.00448
NP_440821.1_4 Reverse -343 -353 10.2065 0.0163
NP_440821.1_4 Reverse -187 -197 8.92815 0.0382
NP_440821.1_4 Forward -396 -386 0.275027 0.19
NP_441239.1_9 Reverse -111 -123 13.3137 0.037
NP_441239.1_9 Reverse -343 -355 12.3303 0.0477
NP_441239.1_9 Reverse -152 -164 10.9537 0.0695
NP_441239.1_9 Reverse -383 -395 7.21714 0.169
NP_441239.1_9 Forward -356 -344 6.92215 0.173
NP_441239.1_9 Forward -124 -112 6.92215 0.173
NP_441239.1_9 Forward -305 -293 6.52882 0.185
NP_441239.1_9 Forward -287 -275 5.44718 0.221
NP_441239.1_9 Forward -188 -176 5.44718 0.221
NP_441239.1_9 Forward -200 -188 3.87389 0.272
NP_441239.1_9 Reverse -292 -304 3.38223 0.285
NP_441892.1_1 Forward -294 -277 -0.846137 0.192
NP_441892.1_1 Reverse -336 -353 -3.8944 0.251
NP_441892.1_1 Reverse -285 -302 -4.38605 0.26
NP_441892.1_1 Reverse -145 -162 -4.77938 0.268
NP_441892.1_1 Reverse -342 -359 -5.95935 0.294
NP_440949.1_7 Reverse -105 -124 16.7149 0.154
NP_440354.1_7 Forward -128 -110 17.1287 0.167
NP_440546.1_4 Reverse -189 -199 13.1486 0.0572
NP_440546.1_4 Forward -163 -153 12.4699 0.0679
NP_440546.1_4 Forward -354 -344 11.8882 0.0679
NP_440546.1_4 Forward -122 -112 11.8882 0.0679
NP_440546.1_4 Forward -394 -384 10.8217 0.104
NP_440546.1_4 Reverse -294 -304 10.2399 0.109
NP_440546.1_4 Reverse -345 -355 10.046 0.109
NP_440546.1_4 Reverse -113 -123 10.046 0.109
NP_440546.1_6 Forward -49 -30 9.93088 0.247
NP_441230.1_8 Forward -275 -256 15.6341 0.228
NP_440675.1_1 Forward -237 -218 7.86593 0.195
NP_440462.1_6 Reverse -111 -121 15.418 0.0142
NP_440462.1_6 Reverse -343 -353 9.02648 0.0498
NP_440462.1_6 Reverse -187 -197 8.33817 0.0646
NP_440462.1_6 Forward -356 -346 7.74818 0.0699
NP_440462.1_6 Forward -124 -114 7.74818 0.0699
NP_440462.1_6 Forward -200 -190 6.66654 0.105
NP_440462.1_6 Reverse -383 -393 3.61828 0.234
NP_442592.1_7 Reverse -346 -365 23.0089 0.0231
NP_440868.1_4 Forward -358 -346 17.7386 0.0124
NP_440868.1_4 Reverse -109 -121 10.6587 0.0364
NP_440868.1_4 Forward -126 -114 6.1355 0.0878
NP_440868.1_4 Reverse -341 -353 1.7106 0.174
NP_440868.1_4 Reverse -362 -374 -1.14099 0.296
NP_440401.1_9 Reverse -68 -75 14.5917 0.287
NP_441497.1_1 Forward -57 -43 18.6825 0.174
NP_441497.1_3 Reverse -365 -384 -2.36049 0.2
NP_441474.1_1 Forward -208 -189 -2.8529 0.29
NP_441474.1_1 Forward -258 -239 -3.34455 0.298
NP_440402.1_3 Reverse -201 -220 4.71934 0.276
NP_442402.1_4 Reverse -56 -75 -2.45958 0.199
NP_441848.1_7 Reverse -71 -90 -0.591301 0.244
NP_441084.1_6 Forward -200 -186 12.5437 0.16
NP_442358.1_1 Reverse -105 -123 15.5554 0.196
NP_442358.1_1 Forward -130 -112 14.9655 0.233
NP_442358.1_1 Forward -362 -344 13.9821 0.254
NP_442039.1_4 Forward -353 -346 15.1821 0.0124
NP_442039.1_4 Reverse -346 -353 15.1821 0.0124
NP_442039.1_4 Forward -121 -114 15.1821 0.0124
NP_442039.1_4 Reverse -114 -121 15.1821 0.0124
NP_441811.1_8 Forward -128 -114 9.5377 0.227
NP_441811.1_8 Forward -360 -346 6.88276 0.259
NP_441926.1_3 Reverse -113 -129 4.0901 0.201
NP_440825.1_7 Forward -353 -343 12.4217 0.155
NP_442837.1_3 Forward -353 -346 15.7721 0.0124
NP_442837.1_3 Reverse -346 -353 15.7721 0.0124
NP_442837.1_3 Forward -121 -114 15.7721 0.0124
NP_442837.1_3 Reverse -114 -121 15.7721 0.0124
NP_442837.1_3 Forward -247 -240 6.52896 0.2
NP_442837.1_3 Forward -197 -190 6.13563 0.25
NP_442837.1_3 Reverse -190 -197 5.93897 0.265
NP_442053.1_1 Forward -354 -345 18.3876 0.0007
NP_442053.1_1 Reverse -345 -354 18.3876 0.0007
NP_442053.1_1 Forward -122 -113 18.3876 0.0007
NP_442053.1_1 Reverse -113 -122 18.3876 0.0007
NP_442053.1_1 Reverse -385 -394 4.71961 0.228
NP_440505.1_3 Forward -356 -346 16.303 0.00696
NP_440505.1_3 Forward -124 -114 16.303 0.00696
NP_440505.1_3 Reverse -111 -121 13.8447 0.0247
NP_440505.1_3 Reverse -187 -197 12.8614 0.0427
NP_440505.1_3 Reverse -343 -353 6.76487 0.169
NP_441203.1_6 Reverse -343 -362 12.4875 0.0899
NP_442532.1_7 Forward -122 -108 4.52282 0.171
NP_440548.1_10 Reverse -174 -193 5.99764 0.221
NP_440914.1_1 Reverse -345 -355 17.5935 0.000537
NP_440914.1_1 Reverse -113 -123 17.5935 0.000537
NP_440914.1_1 Forward -354 -344 8.6151 0.186
NP_440914.1_1 Forward -122 -112 8.6151 0.186
NP_440914.1_1 Forward -285 -275 6.95605 0.257
NP_441011.1_8 Forward -353 -344 16.9127 0.00602
NP_441011.1_8 Forward -121 -112 16.9127 0.00602
NP_441011.1_8 Forward -393 -384 9.04618 0.141
NP_441011.1_8 Reverse -346 -355 8.25953 0.144
NP_441011.1_8 Reverse -114 -123 8.25953 0.144
NP_441011.1_8 Reverse -190 -199 8.1612 0.147
NP_441011.1_8 Forward -302 -293 7.27622 0.179
NP_441011.1_8 Forward -197 -188 7.17789 0.179
NP_441011.1_10 Reverse -87 -106 11.8975 0.294
NP_442101.1_10 Forward -130 -111 -10.227 0.255
NP_442533.1_6 Forward -354 -345 17.2076 0.00137
NP_442533.1_6 Reverse -345 -354 17.2076 0.00137
NP_442533.1_6 Forward -122 -113 17.2076 0.00137
NP_442533.1_6 Reverse -113 -122 17.2076 0.00137
NP_442533.1_6 Forward -285 -276 13.5694 0.021
NP_442533.1_6 Reverse -276 -285 8.1612 0.0807
NP_442533.1_6 Forward -163 -154 7.17789 0.0948
NP_442533.1_6 Reverse -154 -163 6.68623 0.105
NP_442533.1_6 Forward -303 -294 5.80125 0.128
NP_442533.1_6 Reverse -294 -303 5.70292 0.132
NP_442533.1_6 Reverse -254 -263 5.70292 0.132
NP_442533.1_6 Reverse -160 -169 5.70292 0.132
NP_442533.1_6 Reverse -189 -198 5.3096 0.145
NP_442533.1_6 Forward -257 -248 3.63797 0.206
NP_442229.1_1 Forward -188 -174 12.192 0.18
NP_442229.1_1 Forward -356 -342 9.53707 0.184
NP_441482.1_7 Reverse -339 -353 -0.787057 0.0612
NP_441482.1_7 Reverse -107 -121 -3.54032 0.129
NP_441482.1_7 Forward -128 -114 -11.0135 0.229
NP_439944.1_9 Reverse -346 -356 19.0562 0.00329
NP_439944.1_9 Reverse -114 -124 19.0562 0.00329
NP_439944.1_9 Reverse -190 -200 14.0414 0.0456
NP_439944.1_9 Forward -121 -111 10.3048 0.0887
NP_439944.1_9 Forward -284 -274 7.35486 0.144
NP_439944.1_9 Reverse -155 -165 6.96153 0.162
NP_440116.1_8 Reverse -114 -133 -4.72043 0.178
NP_440116.1_8 Reverse -190 -209 -6.1954 0.204
NP_440115.1_6 Forward -357 -347 8.4365 0.13
NP_440007.1_9 Forward -167 -153 6.58777 0.221
NP_442492.1_2 Reverse -294 -313 2.55606 0.224
NP_441602.1_3 Forward -359 -340 -2.65548 0.235
NP_441602.1_3 Forward -284 -265 -2.95047 0.239
NP_441972.1_5 Forward -302 -283 2.45773 0.121
NP_441972.1_5 Forward -197 -178 -8.85033 0.272
NP_441972.1_5 Reverse -346 -365 -9.34199 0.283
NP_441106.1_1 Reverse -344 -353 18.191 0.0028
NP_441106.1_1 Reverse -112 -121 18.191 0.0028
NP_441106.1_1 Forward -199 -190 14.2577 0.0252
NP_441106.1_1 Forward -355 -346 9.63616 0.0311
NP_441106.1_1 Forward -123 -114 9.63616 0.0311
NP_441106.1_1 Reverse -188 -197 8.35786 0.0585
NP_441106.1_1 Forward -286 -277 5.89959 0.121
NP_441106.1_1 Forward -304 -295 4.62128 0.213
NP_441106.1_1 Forward -264 -255 2.458 0.283
NP_439903.1_6 Reverse -245 -264 10.0284 0.114
NP_439903.1_6 Reverse -72 -91 1.57197 0.243
NP_439903.1_6 Forward -288 -269 0.0970122 0.271
NP_442306.1_10 Forward -359 -340 -19.9617 0.201
NP_442306.1_10 Forward -127 -108 -21.0434 0.242
NP_441286.1_1 Forward -123 -111 14.4936 0.00418
NP_441286.1_1 Reverse -344 -356 11.8387 0.0114
NP_441286.1_1 Reverse -112 -124 11.8387 0.0114
NP_441286.1_1 Forward -355 -343 6.03717 0.0258
NP_441286.1_1 Reverse -275 -287 -4.68091 0.168
NP_441286.1_1 Reverse -159 -171 -5.17256 0.192
NP_441286.1_1 Reverse -188 -200 -6.94252 0.288
NP_440670.1_8 Forward -354 -345 18.3876 0.000699
NP_440670.1_8 Reverse -345 -354 18.3876 0.000699
NP_440670.1_8 Forward -122 -113 18.3876 0.000699
NP_440670.1_8 Reverse -113 -122 18.3876 0.000699
NP_440670.1_8 Forward -198 -189 6.98123 0.0882
NP_440670.1_8 Reverse -177 -186 3.63797 0.239
NP_441930.1_1 Forward -126 -107 7.17762 0.235
NP_440886.1_7 Reverse -344 -354 17.7774 0.0011
NP_440886.1_7 Reverse -112 -122 17.7774 0.0011
NP_440886.1_7 Forward -355 -345 7.94438 0.0805
NP_440886.1_7 Forward -123 -113 7.94438 0.0805
NP_440886.1_7 Reverse -384 -394 6.76441 0.114
NP_440886.1_7 Reverse -275 -285 6.66608 0.115
NP_440886.1_7 Forward -264 -254 6.46942 0.123
NP_440886.1_7 Reverse -188 -198 4.50281 0.232
NP_440083.1_9 Forward -88 -69 11.1637 0.281
NP_442614.1_2 Reverse -345 -359 16.4209 0.0675
NP_442614.1_2 Reverse -113 -127 7.27608 0.275
NP_442072.1_9 Forward -355 -337 -5.78238 0.0691
NP_442072.1_9 Forward -199 -181 -13.7472 0.121
NP_442072.1_9 Forward -123 -105 -21.9087 0.215
NP_441753.1_10 Forward -294 -275 5.30933 0.186
NP_441808.1_8 Reverse -242 -261 7.17762 0.283
NP_440907.2_8 Forward -353 -343 14.2375 0.0312
NP_440907.2_8 Forward -197 -187 8.14104 0.117
NP_440907.2_8 Forward -121 -111 7.84605 0.117
NP_440907.2_8 Forward -302 -292 5.48612 0.198
NP_442264.1_2 Forward -173 -156 14.3952 0.131
NP_441021.1_1 Forward -197 -178 0.982764 0.0848
NP_441021.1_1 Forward -353 -334 -6.09707 0.177
NP_441021.1_8 Reverse -340 -358 11.1305 0.122
NP_440841.1_4 Forward -396 -377 -3.73712 0.184
NP_441463.1_3 Reverse -103 -122 1.86774 0.123
NP_441463.1_3 Forward -196 -177 -0.197208 0.132
NP_441463.1_3 Forward -364 -345 -2.0655 0.149
NP_441463.1_3 Forward -295 -276 -6.1954 0.241
NP_441463.1_6 Forward -124 -110 12.0207 0.224
NP_441463.1_6 Reverse -111 -125 5.35296 0.291
NP_441626.1_2 Forward -353 -346 15.7721 0.0124
NP_441626.1_2 Reverse -346 -353 15.7721 0.0124
NP_441626.1_2 Forward -121 -114 15.7721 0.0124
NP_441626.1_2 Reverse -114 -121 15.7721 0.0124
NP_441626.1_2 Forward -197 -190 6.0373 0.212
NP_441626.1_2 Reverse -190 -197 6.0373 0.212
NP_441626.1_6 Reverse -341 -359 6.1149 0.267
NP_442365.1_7 Reverse -109 -128 -0.295539 0.177
NP_442365.1_7 Forward -358 -339 -0.787193 0.185
NP_442365.1_7 Reverse -250 -269 -4.6221 0.248
NP_442794.1_1 Forward -126 -114 7.11881 0.148
NP_442794.1_1 Reverse -341 -353 2.89058 0.286
NP_442615.1_1 Reverse -104 -122 -1.94747 0.136
NP_442615.1_1 Forward -131 -113 -2.24246 0.141
NP_442615.1_1 Reverse -180 -198 -6.07737 0.233
NP_441962.1_4 Forward -127 -108 -0.4922 0.117
NP_441962.1_4 Forward -359 -340 -8.752 0.206
NP_441962.1_4 Forward -284 -265 -10.3253 0.226
NP_441962.1_4 Forward -290 -271 -11.0136 0.236
NP_440387.1_1 Forward -122 -106 14.7098 0.00635
NP_440387.1_1 Forward -354 -338 14.5132 0.00649
NP_440387.1_1 Reverse -113 -129 14.3165 0.00649
NP_440387.1_1 Reverse -345 -361 4.48343 0.0417
NP_440387.1_1 Forward -285 -269 -6.13632 0.268
NP_441431.1_2 Forward -266 -252 7.17714 0.247
NP_441836.1_1 Forward -133 -114 15.4927 0.147
NP_441836.1_2 Forward -204 -185 -5.70374 0.284
NP_441993.1_1 Forward -169 -150 1.94669 0.267
NP_441174.1_1 Forward -395 -380 16.8928 0.231
NP_441174.1_2 Forward -357 -343 14.5526 0.161
NP_440814.1_4 Reverse -180 -199 -6.98204 0.221
NP_440114.1_10 Forward -122 -108 11.406 0.115
NP_440114.1_10 Forward -163 -149 10.0294 0.155
NP_440114.1_10 Reverse -294 -308 9.43936 0.172
NP_440114.1_10 Reverse -276 -290 7.57108 0.231
NP_440114.1_10 Forward -394 -380 6.98109 0.25
NP_440114.1_10 Forward -354 -340 6.6861 0.26
NP_440114.1_10 Reverse -154 -168 6.29277 0.276
NP_440114.1_10 Reverse -345 -359 6.09611 0.285
NP_442090.1_10 Forward -393 -380 10.4424 0.286
NP_442323.1_7 Reverse -70 -89 5.99684 0.201
NP_441510.2_7 Reverse -270 -284 12.5853 0.28
NP_441510.2_7 Reverse -339 -353 9.93039 0.281
NP_440287.1_6 Reverse -180 -199 3.6377 0.216
NP_440293.1_3 Forward -227 -208 -6.49039 0.29
NP_440766.1_4 Forward -398 -384 12.3893 0.054
NP_440766.1_4 Forward -190 -176 8.55439 0.0871
NP_440766.1_4 Forward -358 -344 7.66941 0.0884
NP_440766.1_4 Reverse -185 -199 2.5562 0.179
NP_439910.1_2 Reverse -105 -122 -2.91109 0.0305
NP_439910.1_2 Forward -206 -189 -13.0392 0.127
NP_439910.1_2 Reverse -337 -354 -13.4325 0.162
NP_439910.1_2 Forward -130 -113 -21.594 0.183
NP_439910.1_2 Reverse -181 -198 -21.9873 0.202
NP_439910.1_2 Forward -362 -345 -22.184 0.215
NP_439910.1_2 Forward -311 -294 -22.6756 0.285
NP_440457.1_1 Forward -126 -114 9.57708 0.092
NP_440457.1_1 Forward -398 -386 9.28209 0.0929
NP_440457.1_1 Forward -358 -346 1.80894 0.223
NP_440457.1_1 Reverse -109 -121 -0.0593532 0.25
NP_442680.1_7 Forward -110 -91 -3.3438 0.265
NP_440942.1_8 Forward -376 -357 17.7974 0.0422
NP_441984.1_1 Forward -366 -348 5.62401 0.288
NP_441984.1_3 Reverse -381 -399 10.7372 0.184
NP_441889.1_4 Forward -363 -344 4.42435 0.223
NP_440473.1_9 Forward -180 -161 -7.4737 0.236
NP_442509.1_9 Forward -354 -344 16.2041 0.00739
NP_442509.1_9 Forward -122 -112 16.2041 0.00739
NP_442509.1_9 Reverse -345 -355 8.14104 0.192
NP_442509.1_9 Reverse -113 -123 8.14104 0.192
NP_442509.1_9 Forward -198 -188 6.56775 0.263
NP_442784.1_3 Reverse -226 -245 11.7992 0.293
NP_440448.1_5 Reverse -42 -61 8.84924 0.261
NP_440554.1_4 Forward -121 -111 14.6313 0.02
NP_440554.1_4 Reverse -190 -200 8.33817 0.0773
NP_440554.1_4 Forward -353 -343 7.35486 0.103
NP_440554.1_4 Reverse -346 -356 7.05986 0.106
NP_440554.1_4 Reverse -114 -124 7.05986 0.106
NP_440554.1_4 Reverse -295 -305 4.99491 0.167
NP_440554.1_4 Forward -197 -187 4.40493 0.19
NP_440554.1_4 Reverse -277 -287 2.92996 0.248
NP_442862.1_3 Forward -49 -32 6.62702 0.263
NP_441845.1_6 Reverse -177 -195 1.29745 0.274
NP_441845.1_6 Reverse -101 -119 0.609134 0.274
NP_441885.1_5 Reverse -345 -355 20.9245 0.000538
NP_441885.1_5 Reverse -113 -123 20.9245 0.000538
NP_441885.1_5 Forward -354 -344 11.4848 0.00668
NP_441885.1_5 Forward -122 -112 11.4848 0.00668
NP_441885.1_5 Forward -285 -275 1.74999 0.0991
NP_441885.1_5 Reverse -189 -199 0.57002 0.137
NP_441885.1_5 Forward -263 -253 0.373358 0.164
NP_441885.1_5 Forward -394 -384 -1.19994 0.255
NP_440478.1_10 Reverse -343 -357 10.521 0.193
NP_441428.1_8 Reverse -268 -287 1.86774 0.294
NP_442341.1_5 Forward -271 -252 13.8641 0.207
NP_442341.1_7 Forward -355 -341 19.7641 0.00702
NP_442341.1_7 Forward -123 -109 15.3392 0.0229
NP_442341.1_7 Reverse -344 -358 13.9626 0.0326
NP_442341.1_7 Reverse -112 -126 7.66941 0.0994
NP_442341.1_7 Reverse -384 -398 3.24451 0.23
NP_442341.1_9 Reverse -343 -357 14.5519 0.0671
NP_442341.1_9 Reverse -111 -125 6.88214 0.21
NP_442341.1_9 Reverse -152 -166 6.0955 0.243
NP_442395.2_4 Forward -103 -84 7.76679 0.137
NP_443000.1_7 Forward -356 -346 17.0896 0.00865
NP_443000.1_7 Forward -124 -114 17.0896 0.00865
NP_443000.1_7 Reverse -111 -121 8.73149 0.0437
NP_443000.1_7 Forward -200 -190 7.05986 0.102
NP_443000.1_7 Reverse -343 -353 1.94665 0.226
NP_443000.1_7 Reverse -246 -256 1.65166 0.235
NP_440507.2_3 Forward -363 -344 11.995 0.166
NP_440727.1_2 Forward -171 -152 3.24438 0.288
NP_441842.1_1 Reverse -347 -360 12.1134 0.226
NP_440275.1_3 Reverse -111 -121 8.4365 0.0602
NP_440275.1_3 Reverse -343 -353 8.33817 0.0602
NP_440275.1_3 Reverse -187 -197 8.33817 0.0602
NP_440275.1_3 Forward -356 -346 8.1415 0.0602
NP_440275.1_3 Forward -124 -114 8.1415 0.0602
NP_440091.1_1 Forward -126 -114 8.9871 0.0567
NP_440091.1_1 Forward -358 -346 6.43049 0.095
NP_440091.1_1 Reverse -341 -353 3.18557 0.166
NP_440091.1_1 Reverse -185 -197 2.79224 0.184
NP_440091.1_1 Reverse -109 -121 1.41561 0.197
NP_443060.1_5 Reverse -159 -178 6.68515 0.235
NP_443010.1_10 Reverse -342 -359 11.1779 0.115
NP_443010.1_10 Reverse -110 -127 7.31258 0.175
NP_443010.1_10 Reverse -186 -203 1.90109 0.289
NP_443010.1_10 Forward -288 -271 1.90109 0.289
NP_442753.1_6 Reverse -151 -170 5.99684 0.284
NP_440175.1_4 Forward -171 -152 -9.93197 0.171
NP_440175.1_4 Forward -362 -343 -14.5535 0.277
NP_440175.1_10 Reverse -71 -90 11.6025 0.219
NP_440149.1_8 Forward -169 -150 1.27776 0.127
NP_440149.1_8 Reverse -345 -364 0.884433 0.132
NP_440149.1_8 Reverse -113 -132 -2.75381 0.175
NP_441105.1_3 Forward -268 -249 -8.94866 0.281
NP_440216.1_1 Forward -354 -340 -1.47537 0.0328
NP_440216.1_1 Reverse -113 -127 -1.47537 0.0328
NP_440216.1_1 Forward -122 -108 -2.55701 0.0521
NP_440216.1_1 Forward -394 -380 -4.32697 0.107
NP_440216.1_1 Reverse -345 -359 -9.34185 0.145
NP_440216.1_1 Reverse -254 -268 -12.5868 0.288
NP_440216.1_9 Forward -88 -79 14.2577 0.183
NP_440172.1_1 Reverse -345 -355 15.0247 0.00945
NP_440172.1_1 Reverse -113 -123 15.0247 0.00945
NP_440172.1_1 Reverse -189 -199 10.0098 0.0572
NP_440172.1_1 Forward -354 -344 8.73149 0.0586
NP_440172.1_1 Forward -122 -112 8.73149 0.0586
NP_440172.1_1 Forward -163 -153 6.17489 0.11
NP_440172.1_1 Forward -285 -275 2.83163 0.264
NP_442015.1_10 Reverse -341 -354 11.6223 0.0372
NP_442015.1_10 Forward -358 -345 9.45906 0.0486
NP_442015.1_10 Reverse -109 -122 0.707601 0.221
NP_442015.1_10 Forward -126 -113 0.510939 0.224
NP_442015.1_10 Forward -364 -351 -0.177378 0.255
NP_442015.1_10 Reverse -290 -303 -0.767364 0.281
NP_441226.1_7 Forward -353 -346 14.4934 0.0123
NP_441226.1_7 Reverse -346 -353 14.4934 0.0123
NP_441226.1_7 Forward -121 -114 14.4934 0.0123
NP_441226.1_7 Reverse -114 -121 14.4934 0.0123
NP_442446.1_3 Forward -240 -221 12.4875 0.223
NP_442446.1_3 Forward -291 -272 9.14423 0.289
NP_441111.1_7 Forward -353 -345 18.7023 0.00294
NP_441111.1_7 Forward -121 -113 18.7023 0.00294
NP_441111.1_7 Reverse -346 -354 18.7023 0.00294
NP_441111.1_7 Reverse -114 -122 18.7023 0.00294
NP_441111.1_7 Forward -197 -189 8.96754 0.0463
NP_441111.1_7 Forward -284 -276 -0.472234 0.131
NP_441111.1_7 Forward -185 -177 -0.570565 0.233
NP_441111.1_7 Reverse -277 -285 -0.668896 0.274
NP_442379.1_10 Forward -129 -112 -0.747806 0.223
NP_441766.1_2 Forward -354 -345 17.5026 0.00297
NP_441766.1_2 Reverse -345 -354 17.5026 0.00297
NP_441766.1_2 Forward -122 -113 17.5026 0.00297
NP_441766.1_2 Reverse -113 -122 17.5026 0.00297
NP_441766.1_2 Reverse -189 -198 8.06287 0.0691
NP_441766.1_2 Reverse -385 -394 5.01461 0.148
NP_441766.1_2 Forward -285 -276 4.52295 0.179
NP_442417.1_5 Forward -122 -108 12.6843 0.094
NP_442417.1_5 Forward -354 -340 11.406 0.101
NP_440416.1_1 Reverse -294 -313 -8.752 0.254
NP_440416.1_1 Reverse -276 -295 -9.93197 0.272
NP_440416.1_9 Forward -193 -174 -11.9969 0.155
NP_440416.1_9 Reverse -153 -172 -16.1268 0.208
NP_440416.1_9 Forward -129 -110 -17.7001 0.245
NP_440416.1_9 Forward -376 -357 -21.6334 0.295
NP_443052.1_8 Reverse -103 -122 4.12936 0.0452
NP_443052.1_8 Forward -295 -276 -10.9153 0.218
NP_443052.1_8 Forward -313 -294 -11.2103 0.224
NP_443052.1_9 Reverse -278 -297 4.32602 0.156
NP_441135.1_4 Forward -195 -176 2.75272 0.284
NP_442154.1_1 Forward -171 -153 -12.9605 0.217
NP_440261.1_5 Reverse -346 -359 4.93583 0.0478
NP_440261.1_5 Forward -302 -289 -6.07724 0.193
NP_440261.1_5 Forward -121 -108 -10.4038 0.201
NP_440261.1_5 Reverse -114 -127 -12.3704 0.284
NP_440988.1_2 Reverse -224 -242 6.31233 0.299
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCAAGGGCTATCGGGGGATGATATTCCCATTGCGGCCCGTTTGATGGCGATCGCCGATGTTTATGACGCTTTAATTAGTAGTCGGGTTTATAAAGAAGCGATGCCCCACGAAGAGGCGGTGGCCATTATCGAAGCCGGCTACGGCCAACACTTTGATCCCGATGTGGTTGATGCGTTTATGGCTATTCATCCCACTTTTAAAACGATCGCCGCTGAGTTCGCCGATAAGGGGTAATGGCCATGGCGTATTAAAGAAGTACAGGTTTTGTGACTGTATGGCGATCGCCGTAATATTCCGGCAAAAAGCCTAGCCAAGGGAAAAGTTTGGGGTTAACGGGCTGAAATTAAGATTTATGGCGCAGAATTGGTTAAGACTAGCAACATTAGACCCTGAGCACC

CDS

ATGAAATTTATCTCCAGCTTCTTTGCCCTAGCCACAGTTCTTGCTTGCCAACCCACGGTTTTTGCTTTCGAGCCAGCGGAAGCAATTAAGGTAGAAACCATCCTCAAAACCGAAACTAGTTGGGATGGTCAACCTCTGGCTTACCCAGAAGGCCAAGCAGAAATCACTGGCATGATGATCGAAATTGCCCCCGGTGCCGAAACGGGTTGGCATTCCCATCCAGTGCCCTCCTTTGGCATTTTGCTGGAAGGGGAATTGGAGGTCACCCTCCTAAATGGGCAGAAAAAGCTCATCAAAACCGGGGACGCCATCGCTGAAGTGGTGAATACAGTACACAATGGCCGCAACGTGGGGGAGGGCCCTGTGAAAATTTTGGTGTTTTATGCCGGAGCGAAGGATTTGCCCGTAACCGTTAAGGATCAGCCCAATTAA

Protein

MKFISSFFALATVLACQPTVFAFEPAEAIKVETILKTETSWDGQPLAYPEGQAEITGMMIEIAPGAETGWHSHPVPSFGILLEGELEVTLLNGQKKLIKTGDAIAEVVNTVHNGRNVGEGPVKILVFYAGAKDLPVTVKDQPN