Your browser is old and dusty. Try Google Chrome!

Details for slr2084

ORF slr2084
Accession NP_441293.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -172 -186 18.2892 0.0205
NP_441061.1_2 Reverse -343 -357 6.6861 0.115
NP_441061.1_2 Forward -228 -214 -1.37704 0.258
NP_440557.1_1 Reverse -172 -191 1.96607 0.245
NP_440795.1_7 Forward -179 -172 14.6904 0.0123
NP_440795.1_7 Reverse -172 -179 14.6904 0.0123
NP_440795.1_7 Forward -188 -181 6.43063 0.265
NP_441418.1_6 Reverse -171 -190 -23.1083 0.191
NP_441418.1_6 Forward -180 -161 -29.6965 0.234
NP_442291.1_5 Forward -181 -165 3.69678 0.107
NP_442272.1_2 Reverse -120 -139 12.6523 0.217
NP_440897.1_6 Reverse -353 -372 -4.03287 0.262
NP_441453.1_4 Reverse -171 -179 16.539 0.00633
NP_441453.1_4 Forward -180 -172 16.539 0.00633
NP_441453.1_7 Forward -262 -255 13.4121 0.23
NP_441453.1_7 Reverse -12 -19 11.9372 0.298
NP_442151.1_6 Reverse -177 -191 7.76774 0.19
NP_442151.1_6 Forward -180 -166 5.50613 0.274
NP_441818.1_1 Reverse -172 -183 9.30127 0.246
NP_441818.1_1 Forward -276 -265 8.71129 0.28
NP_440226.1_1 Reverse -171 -190 10.2259 0.0646
NP_440226.1_1 Forward -180 -161 9.83255 0.0687
NP_440120.1_4 Forward -17 -3 15.3392 0.273
NP_442173.1_1 Forward -179 -171 15.4574 0.00633
NP_442173.1_1 Reverse -172 -180 15.4574 0.00633
NP_442752.1_4 Forward -180 -173 13.8055 0.0199
NP_442752.1_4 Reverse -171 -178 13.8055 0.0199
NP_442752.1_4 Forward -9 -2 7.6106 0.151
NP_443027.1_4 Reverse -169 -179 16.2046 0.0437
NP_443027.1_4 Forward -182 -172 14.828 0.0437
NP_441812.1_3 Forward -181 -167 16.8142 0.0639
NP_441812.1_3 Reverse -170 -184 6.88276 0.287
NP_442975.1_10 Forward -184 -170 13.077 0.0459
NP_442975.1_10 Reverse -167 -181 4.32555 0.245
NP_440784.1_7 Forward -179 -172 15.9687 0.0123
NP_440784.1_7 Reverse -172 -179 15.9687 0.0123
NP_440784.1_7 Reverse -221 -228 4.26735 0.272
NP_442909.1_7 Reverse -172 -186 13.2736 0.128
NP_441934.1_9 Forward -322 -303 16.8141 0.161
NP_440061.1_9 Forward -231 -217 11.012 0.117
NP_442062.1_8 Reverse -171 -181 19.4496 0.000558
NP_442062.1_8 Forward -180 -170 10.3048 0.0493
NP_440304.1_4 Reverse -169 -179 19.9412 0.00364
NP_440304.1_4 Forward -182 -172 10.8948 0.051
NP_440304.1_4 Forward -188 -178 3.51995 0.296
NP_442242.1_4 Forward -179 -172 14.3954 0.0124
NP_442242.1_4 Reverse -172 -179 14.3954 0.0124
NP_441781.1_7 Forward -342 -323 -0.000545616 0.256
NP_440916.1_1 Reverse -297 -311 10.226 0.21
NP_439918.1_2 Forward -324 -305 -4.72043 0.283
NP_441620.1_1 Forward -146 -127 22.9557 0.0453
NP_441619.1_8 Reverse -69 -83 11.307 0.184
NP_441208.1_9 Reverse -168 -182 6.19444 0.253
NP_441594.1_6 Forward -189 -170 5.30933 0.209
NP_440370.1_10 Reverse -162 -181 15.7324 0.0782
NP_442110.1_7 Forward -180 -166 2.65453 0.222
NP_442110.1_7 Reverse -171 -185 1.37622 0.23
NP_441925.1_4 Reverse -178 -197 -12.8826 0.257
NP_441925.1_4 Forward -228 -209 -14.3576 0.262
NP_441925.1_4 Reverse -335 -354 -16.9142 0.287
NP_441083.1_5 Reverse -171 -181 11.3864 0.0159
NP_441083.1_5 Forward -180 -170 11.2881 0.0159
NP_441083.1_5 Forward -319 -309 4.69992 0.134
NP_442827.1_8 Forward -188 -169 13.3716 0.0402
NP_442827.1_8 Reverse -169 -188 0.293673 0.212
NP_441738.1_2 Forward -178 -171 15.28 0.0102
NP_441738.1_2 Reverse -173 -180 15.28 0.0102
NP_441738.1_2 Reverse -300 -307 6.23363 0.264
NP_441558.1_5 Reverse -169 -188 6.58763 0.21
NP_440209.1_1 Reverse -171 -179 18.1123 0.00295
NP_440209.1_1 Forward -180 -172 18.1123 0.00295
NP_441713.1_1 Forward -186 -167 -15.5368 0.265
NP_440178.1_7 Forward -181 -162 6.09597 0.0153
NP_440178.1_7 Reverse -170 -189 -21.6334 0.232
NP_442570.1_3 Forward -360 -341 -5.01543 0.237
NP_442570.1_3 Forward -171 -152 -6.49039 0.258
NP_442570.1_3 Forward -344 -325 -7.27704 0.269
NP_441716.1_1 Forward -180 -166 8.25939 0.145
NP_442111.1_4 Reverse -170 -184 5.30946 0.169
NP_442111.1_4 Forward -181 -167 1.76955 0.294
NP_440906.1_5 Forward -179 -172 15.8704 0.0124
NP_440906.1_5 Reverse -172 -179 15.8704 0.0124
NP_440747.1_10 Reverse -168 -180 7.80712 0.00223
NP_440747.1_10 Forward -183 -171 -2.02597 0.0196
NP_440747.1_10 Reverse -307 -319 -12.5474 0.297
NP_441486.1_1 Forward -183 -169 11.5043 0.016
NP_441486.1_1 Reverse -168 -182 1.96621 0.0939
NP_441486.1_1 Forward -232 -218 -3.54032 0.179
NP_440944.1_2 Forward -192 -173 -1.67217 0.259
NP_442634.1_4 Forward -182 -168 7.86607 0.0479
NP_442634.1_4 Reverse -169 -183 -2.26202 0.149
NP_440842.1_10 Reverse -217 -231 2.35953 0.274
NP_442848.1_1 Reverse -165 -179 -1.27871 0.263
NP_442848.1_1 Forward -186 -172 -2.36035 0.263
NP_442848.1_4 Forward -371 -357 8.16106 0.282
NP_441012.1_4 Reverse -173 -186 7.00078 0.272
NP_443018.1_3 Forward -179 -172 14.8871 0.0123
NP_443018.1_3 Reverse -172 -179 14.8871 0.0123
NP_441316.1_7 Forward -182 -167 6.27308 0.107
NP_441634.1_8 Reverse -169 -183 3.14618 0.155
NP_441634.1_8 Reverse -331 -345 -1.96703 0.295
NP_440376.1_1 Forward -180 -171 19.4693 0.000692
NP_440376.1_1 Reverse -171 -180 19.4693 0.000692
NP_440376.1_1 Forward -257 -248 -0.393597 0.289
NP_441588.1_4 Reverse -222 -232 6.76487 0.185
NP_441588.1_4 Reverse -105 -115 5.38824 0.272
NP_442687.1_7 Forward -181 -171 15.8113 0.0125
NP_442687.1_7 Reverse -170 -180 9.02648 0.0994
NP_442485.1_3 Forward -191 -172 -5.9004 0.296
NP_441846.1_10 Forward -363 -344 -3.44213 0.143
NP_441846.1_10 Forward -198 -179 -20.8467 0.256
NP_441422.1_7 Forward -182 -165 -3.79607 0.235
NP_441422.1_7 Reverse -169 -186 -7.33598 0.258
NP_440667.1_2 Forward -347 -328 -3.24547 0.232
NP_442658.1_1 Forward -182 -172 15.9091 0.00966
NP_442658.1_1 Reverse -169 -179 13.0576 0.04
NP_442658.1_1 Reverse -82 -92 4.99446 0.288
NP_442782.1_2 Forward -180 -166 2.2612 0.275
NP_442205.1_9 Forward -186 -170 16.8731 0.0219
NP_442205.1_9 Reverse -165 -181 -2.98973 0.277
NP_440656.1_8 Reverse -160 -179 -7.37537 0.252
NP_441414.1_9 Forward -180 -161 -2.26216 0.112
NP_441487.1_6 Reverse -163 -182 0.294447 0.259
NP_441958.1_5 Reverse -170 -180 21.2195 0.000805
NP_441958.1_5 Forward -181 -171 12.2714 0.00183
NP_439905.1_1 Reverse -172 -185 12.8023 0.178
NP_439990.1_5 Forward -117 -104 12.5073 0.11
NP_442376.1_2 Forward -357 -338 -5.21209 0.283
NP_442376.1_2 Forward -324 -305 -12.5869 0.286
NP_442911.1_2 Forward -190 -171 9.14423 0.0183
NP_442911.1_2 Reverse -161 -180 -1.18052 0.082
NP_440153.1_5 Forward -179 -165 8.16106 0.149
NP_440153.1_5 Reverse -172 -186 2.2612 0.231
NP_442536.1_8 Forward -186 -167 12.0942 0.253
NP_443055.1_3 Reverse -162 -181 14.9422 0.111
NP_443055.1_6 Forward -229 -211 0.706727 0.24
NP_440993.1_2 Reverse -166 -182 8.515 0.143
NP_440993.1_4 Reverse -327 -344 2.39878 0.3
NP_440138.1_6 Forward -179 -160 3.24359 0.246
NP_441129.1_8 Reverse -210 -229 8.45592 0.296
NP_441099.1_5 Reverse -210 -229 -8.26035 0.191
NP_442002.1_9 Forward -181 -174 10.7572 0.185
NP_441294.1_7 Reverse -271 -285 10.1145 0.207
NP_440411.1_10 Forward -258 -239 9.96891 0.279
NP_442438.1_10 Forward -185 -171 12.6843 0.0398
NP_441000.1_6 Reverse -170 -184 -4.03198 0.225
NP_441000.1_6 Forward -181 -167 -5.40861 0.275
NP_442771.1_1 Reverse -169 -187 1.39578 0.08
NP_440147.1_4 Forward -182 -169 2.77255 0.202
NP_440147.1_4 Reverse -169 -182 2.37923 0.208
NP_440147.1_4 Forward -231 -218 0.0192843 0.268
NP_441550.1_8 Reverse -169 -179 13.0576 0.0273
NP_441550.1_8 Forward -182 -172 6.0761 0.214
NP_441916.1_7 Forward -180 -170 18.9579 0.00144
NP_441916.1_7 Reverse -171 -181 18.4663 0.00144
NP_441916.1_10 Reverse -240 -259 0.982764 0.27
NP_441041.1_4 Forward -180 -161 -1.57384 0.101
NP_441041.1_7 Reverse -265 -277 6.44582 0.21
NP_441041.1_7 Reverse -168 -180 6.34865 0.211
NP_442396.1_5 Forward -233 -220 11.7207 0.0913
NP_442396.1_5 Forward -184 -171 6.90245 0.215
NP_442004.1_6 Reverse -171 -185 11.701 0.115
NP_442004.1_6 Reverse -220 -234 1.17956 0.296
NP_441725.1_4 Reverse -166 -180 3.24392 0.279
NP_441725.1_5 Reverse -172 -182 11.2881 0.0247
NP_441725.1_5 Forward -179 -169 11.1898 0.0247
NP_439966.1_7 Forward -182 -172 18.4657 0.00473
NP_439966.1_7 Reverse -169 -179 14.8275 0.0177
NP_439966.1_7 Forward -223 -213 6.76441 0.168
NP_439966.1_9 Forward -182 -173 0.983037 0.253
NP_440736.1_3 Reverse -169 -188 -0.0988766 0.282
NP_440202.1_8 Forward -195 -176 13.016 0.26
NP_442941.1_3 Forward -179 -169 19.9412 0.00262
NP_442941.1_3 Reverse -172 -182 11.4848 0.0116
NP_442941.1_3 Reverse -221 -231 -0.609952 0.264
NP_440289.1_2 Forward -183 -170 5.13249 0.0636
NP_440289.1_2 Reverse -168 -181 -2.83231 0.262
NP_440983.1_9 Forward -360 -341 7.86593 0.241
NP_440983.1_9 Reverse -162 -181 2.3594 0.292
NP_440260.1_8 Forward -345 -327 3.16574 0.174
NP_442281.1_1 Reverse -166 -180 17.9935 0.00513
NP_442281.1_1 Forward -185 -171 9.24208 0.0726
NP_441334.1_7 Forward -323 -304 -20.7484 0.28
NP_441079.1_7 Reverse -83 -102 -3.14789 0.231
NP_440437.1_1 Reverse -165 -184 3.14605 0.126
NP_442012.1_1 Forward -235 -216 3.14605 0.186
NP_441556.1_10 Reverse -304 -318 11.9739 0.205
NP_440498.1_1 Forward -189 -171 15.9488 0.0241
NP_440498.1_1 Reverse -162 -180 6.80398 0.0845
NP_442982.1_5 Reverse -161 -180 -1.67217 0.268
NP_442982.1_5 Forward -190 -171 -3.3438 0.297
NP_441644.1_6 Forward -180 -170 19.0557 0.000803
NP_441644.1_6 Reverse -171 -181 10.1076 0.0628
NP_441644.1_6 Reverse -177 -187 5.38779 0.194
NP_442501.1_2 Reverse -342 -361 7.07928 0.157
NP_440867.1_10 Forward -352 -333 7.86593 0.251
NP_440867.1_10 Reverse -344 -363 6.39097 0.256
NP_442215.1_1 Reverse -167 -186 14.0608 0.105
NP_442247.1_8 Forward -231 -217 18.5841 0.11
NP_440929.1_8 Forward -180 -171 19.2726 0.000701
NP_440929.1_8 Reverse -171 -180 19.2726 0.000701
NP_442933.1_1 Forward -144 -125 14.2756 0.214
NP_442933.1_1 Forward -134 -115 6.34979 0.27
NP_442933.1_2 Reverse -126 -144 13.4663 0.227
NP_442933.1_2 Reverse -118 -136 9.93315 0.257
NP_442933.1_10 Forward -180 -171 17.601 0.00325
NP_442933.1_10 Reverse -171 -180 17.601 0.00325
NP_442933.1_10 Forward -229 -220 5.89959 0.16
NP_441751.2_8 Forward -179 -165 7.76774 0.0339
NP_441751.2_8 Reverse -172 -186 5.80112 0.0408
NP_442926.1_3 Forward -191 -172 2.16274 0.295
NP_442554.1_8 Forward -179 -169 16.9913 0.0065
NP_442554.1_8 Reverse -172 -182 13.8447 0.0145
NP_442167.1_6 Reverse -193 -209 19.6256 0.125
NP_441762.1_7 Reverse -170 -182 2.98891 0.0676
NP_441762.1_7 Forward -181 -169 2.20226 0.0676
NP_442142.1_4 Reverse -168 -181 17.4232 0.0264
NP_442142.1_4 Forward -183 -170 8.57349 0.112
NP_442142.1_4 Forward -200 -187 2.96866 0.269
NP_442292.1_1 Forward -179 -170 17.5026 0.00435
NP_442292.1_1 Reverse -172 -181 9.63616 0.0183
NP_442292.1_1 Reverse -221 -230 -0.295266 0.24
NP_442476.1_6 Reverse -172 -186 5.89945 0.131
NP_443009.1_5 Reverse -170 -181 19.626 0.00102
NP_443009.1_5 Forward -181 -170 7.82632 0.118
NP_443009.1_5 Forward -230 -219 3.79477 0.278
NP_441715.1_4 Reverse -172 -182 16.303 0.0117
NP_441715.1_4 Forward -179 -169 14.238 0.0295
NP_440015.1_9 Reverse -171 -189 0.609134 0.248
NP_441198.1_8 Reverse -169 -179 13.2713 0.108
NP_441468.1_1 Forward -179 -172 15.8704 0.0124
NP_441468.1_1 Reverse -172 -179 15.8704 0.0124
NP_441020.2_6 Forward -182 -165 15.3785 0.0411
NP_441020.2_6 Reverse -210 -227 7.217 0.237
NP_441015.1_10 Forward -359 -340 -11.7019 0.3
NP_441673.1_1 Forward -180 -171 20.8459 0.000698
NP_441673.1_1 Reverse -171 -180 20.8459 0.000698
NP_441673.1_1 Reverse -220 -229 -8.06341 0.254
NP_441826.1_2 Forward -186 -172 2.45787 0.127
NP_441826.1_2 Reverse -165 -179 1.96621 0.137
NP_441330.1_1 Reverse -166 -185 -12.4886 0.183
NP_442490.1_9 Forward -192 -173 -4.6221 0.273
NP_442868.1_6 Reverse -169 -179 1.06167 0.205
NP_442868.1_6 Forward -182 -172 0.963343 0.205
NP_441612.1_2 Reverse -109 -119 6.80666 0.277
NP_442427.1_8 Reverse -145 -164 7.37428 0.215
NP_441911.1_10 Reverse -109 -128 9.90869 0.226
NP_441911.1_10 Reverse -115 -134 9.52306 0.231
NP_442808.1_1 Forward -181 -171 18.4657 0.00201
NP_442808.1_1 Reverse -170 -180 8.73102 0.0481
NP_442808.1_1 Forward -222 -212 3.51951 0.238
NP_440031.1_10 Forward -20 -1 0.196116 0.28
NP_441849.1_4 Forward -121 -103 19.882 0.245
NP_440145.1_3 Reverse -161 -180 2.26107 0.12
NP_441906.1_2 Reverse -158 -177 12.9783 0.109
NP_442542.1_2 Reverse -212 -225 6.1158 0.234
NP_442542.1_9 Forward -361 -347 7.3738 0.198
NP_442542.1_9 Forward -187 -173 7.07881 0.211
NP_442050.1_5 Reverse -169 -179 18.0724 0.00365
NP_442050.1_5 Forward -182 -172 9.12434 0.193
NP_440342.1_1 Forward -361 -342 12.3892 0.263
NP_440558.1_2 Reverse -162 -181 -5.80207 0.264
NP_441878.1_6 Reverse -170 -180 10.5014 0.0176
NP_441878.1_6 Forward -181 -171 10.4031 0.0176
NP_441878.1_6 Forward -187 -177 -7.88644 0.278
NP_441878.1_10 Reverse -108 -122 11.2093 0.289
NP_441036.1_8 Forward -181 -171 17.7779 0.000554
NP_441036.1_8 Reverse -170 -180 15.713 0.00724
NP_441036.1_8 Reverse -219 -229 5.68323 0.265
NP_441557.1_5 Forward -180 -171 19.9609 0.000699
NP_441557.1_5 Reverse -171 -180 19.9609 0.000699
NP_441557.1_5 Forward -229 -220 -0.68859 0.229
NP_441445.1_1 Forward -195 -176 0.982764 0.264
NP_441308.1_8 Reverse -169 -179 13.353 0.218
NP_441308.1_8 Forward -182 -172 10.1081 0.22
NP_441564.1_2 Reverse -211 -230 -4.6221 0.24
NP_441564.1_2 Forward -357 -338 -4.81876 0.24
NP_442183.1_1 Reverse -171 -185 18.3875 0.00758
NP_442183.1_1 Forward -180 -166 16.5192 0.0143
NP_442135.1_8 Forward -20 -2 19.882 0.0735
NP_441549.1_9 Forward -184 -166 4.14905 0.0925
NP_442347.1_2 Reverse -172 -181 11.1111 0.056
NP_442347.1_2 Forward -179 -170 3.34298 0.284
NP_442645.1_2 Reverse -163 -182 -14.8485 0.183
NP_442645.1_2 Forward -188 -169 -16.0285 0.22
NP_441037.1_4 Reverse -169 -179 7.31769 0.237
NP_441037.1_4 Forward -182 -172 7.02532 0.237
NP_441037.1_4 Forward -188 -178 5.85583 0.296
NP_440690.1_5 Forward -207 -188 13.9625 0.272
NP_441633.1_3 Forward -182 -169 -3.91395 0.177
NP_441633.1_3 Reverse -169 -182 -5.88057 0.236
NP_440136.1_2 Forward -179 -172 15.9687 0.0123
NP_440136.1_2 Reverse -172 -179 15.9687 0.0123
NP_440136.1_2 Reverse -221 -228 4.26735 0.218
NP_442590.1_10 Forward -186 -167 5.80098 0.258
NP_442998.1_10 Forward -178 -171 15.5754 0.0102
NP_442998.1_10 Reverse -173 -180 15.5754 0.0102
NP_440899.1_8 Forward -140 -121 -8.55534 0.257
NP_440899.1_8 Forward -128 -109 -9.83364 0.269
NP_440299.1_1 Forward -184 -171 8.08184 0.098
NP_440299.1_1 Reverse -167 -180 3.55864 0.241
NP_441799.1_1 Forward -184 -170 15.7319 0.0167
NP_441799.1_1 Reverse -167 -181 15.6336 0.0172
NP_441007.1_10 Forward -185 -172 3.95252 0.182
NP_441007.1_10 Reverse -166 -179 1.19926 0.207
NP_440256.1_1 Reverse -168 -187 0.786102 0.0805
NP_440087.1_1 Forward -189 -170 -6.39206 0.252
NP_441559.1_8 Forward -185 -171 -6.98191 0.281
NP_441559.1_8 Forward -346 -332 -7.17857 0.287
NP_440915.1_6 Reverse -306 -320 1.47456 0.138
NP_440915.1_6 Reverse -216 -230 0.88457 0.151
NP_440915.1_6 Forward -184 -170 -2.65535 0.278
NP_442855.1_3 Forward -360 -341 15.4374 0.159
NP_440717.1_3 Forward -226 -212 9.43874 0.25
NP_442785.1_7 Reverse -169 -183 11.0127 0.228
NP_441866.1_3 Reverse -281 -294 18.8988 0.176
NP_441866.1_4 Forward -129 -116 12.6613 0.282
NP_442866.1_1 Forward -185 -166 4.22769 0.151
NP_441464.1_8 Reverse -177 -191 10.0294 0.186
NP_441199.1_6 Reverse -167 -186 -0.688862 0.277
NP_442993.1_1 Reverse -171 -187 17.9548 0.00577
NP_442993.1_1 Forward -180 -164 -9.77456 0.194
NP_442386.1_9 Forward -181 -172 15.7322 0.0144
NP_442386.1_9 Reverse -170 -179 6.39082 0.219
NP_442386.1_9 Reverse -309 -318 5.70251 0.241
NP_440570.1_5 Reverse -202 -221 -3.14714 0.288
NP_441340.1_5 Forward -179 -172 15.6737 0.0124
NP_441340.1_5 Reverse -172 -179 15.6737 0.0124
NP_440768.1_1 Reverse -341 -355 16.5192 0.141
NP_442240.1_1 Reverse -302 -321 9.63507 0.216
NP_442240.1_2 Forward -179 -160 -13.4719 0.169
NP_440161.1_3 Forward -182 -163 14.4541 0.121
NP_440586.1_8 Forward -179 -172 13.2151 0.026
NP_440586.1_8 Reverse -172 -179 13.2151 0.026
NP_440586.1_8 Reverse -198 -205 8.88855 0.205
NP_440586.1_8 Forward -196 -189 7.02027 0.279
NP_442251.1_6 Forward -179 -172 15.2804 0.0124
NP_442251.1_6 Reverse -172 -179 15.2804 0.0124
NP_440684.1_9 Forward -186 -172 15.3392 0.0988
NP_441262.1_3 Reverse -171 -178 14.7888 0.0223
NP_441262.1_3 Forward -180 -173 14.7888 0.0223
NP_440027.1_3 Reverse -161 -179 2.77167 0.286
NP_443051.1_1 Reverse -170 -179 19.5676 0.00335
NP_443051.1_1 Forward -181 -172 10.4228 0.00754
NP_439996.1_6 Forward -94 -75 6.35846 0.296
NP_439937.1_8 Reverse -195 -214 -3.54046 0.27
NP_440439.1_1 Forward -183 -170 17.5222 0.0105
NP_440439.1_1 Reverse -168 -181 16.2439 0.0128
NP_440372.1_2 Forward -179 -172 16.3621 0.0124
NP_440372.1_2 Reverse -172 -179 16.3621 0.0124
NP_441789.1_7 Reverse -179 -198 1.76863 0.245
NP_440991.1_9 Forward -171 -152 15.1424 0.24
NP_441803.1_2 Reverse -166 -185 2.45773 0.212
NP_441803.1_2 Reverse -172 -191 1.17943 0.238
NP_439977.1_5 Forward -227 -208 0.982764 0.197
NP_440267.1_2 Reverse -166 -180 18.6818 0.024
NP_442384.1_10 Reverse -171 -184 15.4572 0.00986
NP_442384.1_10 Forward -180 -167 6.50913 0.0995
NP_442114.1_8 Reverse -122 -136 9.34041 0.234
NP_442114.1_8 Reverse -361 -375 3.63724 0.287
NP_440364.1_6 Forward -181 -168 13.6867 0.275
NP_442790.1_4 Forward -189 -170 -5.31042 0.141
NP_442262.1_10 Forward -179 -172 14.1988 0.0123
NP_442262.1_10 Reverse -172 -179 14.1988 0.0123
NP_441689.1_5 Reverse -169 -179 17.8758 0.0158
NP_441689.1_5 Forward -182 -172 8.53436 0.132
NP_440344.1_10 Forward -326 -309 3.0871 0.0274
NP_440531.1_6 Reverse -345 -364 -0.590531 0.216
NP_441965.1_10 Forward -183 -167 8.61333 0.123
NP_441965.1_10 Reverse -168 -184 6.74504 0.165
NP_441965.1_10 Reverse -217 -233 2.12349 0.289
NP_442750.1_3 Forward -53 -34 -11.8986 0.267
NP_442693.1_8 Reverse -187 -206 13.8633 0.253
NP_440297.1_9 Reverse -172 -182 9.32148 0.0917
NP_440297.1_9 Forward -179 -169 9.22315 0.0917
NP_440350.1_5 Forward -383 -364 -4.91709 0.288
NP_442187.1_3 Reverse -309 -319 13.1564 0.275
NP_442280.1_10 Forward -372 -354 13.8309 0.13
NP_442280.1_10 Forward -122 -104 10.0322 0.227
NP_442280.1_10 Forward -179 -161 8.86344 0.246
NP_441592.1_4 Forward -229 -210 -0.590531 0.244
NP_441896.1_3 Forward -189 -170 10.9142 0.0833
NP_442553.1_7 Reverse -350 -364 19.5675 0.192
NP_442067.1_4 Forward -191 -172 9.0459 0.194
NP_440999.1_1 Reverse -177 -196 1.17865 0.274
NP_440999.1_9 Forward -184 -170 6.58777 0.0964
NP_440999.1_9 Reverse -176 -190 -3.04867 0.283
NP_440888.1_2 Reverse -171 -185 14.1586 0.02
NP_440888.1_2 Forward -180 -166 11.307 0.0705
NP_440888.1_2 Reverse -345 -359 5.70218 0.267
NP_442225.1_10 Reverse -300 -319 14.0599 0.157
NP_442277.1_7 Reverse -123 -139 -0.375166 0.224
NP_440575.1_1 Reverse -39 -58 1.57197 0.267
NP_440575.1_8 Reverse -93 -112 -5.50708 0.271
NP_441543.1_2 Reverse -172 -181 18.486 0.00236
NP_441543.1_2 Forward -179 -170 15.9293 0.00518
NP_442845.1_2 Forward -186 -172 11.111 0.137
NP_442845.1_2 Forward -235 -221 9.43936 0.174
NP_441304.1_10 Forward -309 -300 12.8811 0.276
NP_441551.1_5 Forward -184 -168 20.7073 0.0213
NP_441469.1_8 Forward -181 -172 16.126 0.00797
NP_441469.1_8 Reverse -170 -179 6.5879 0.227
NP_442315.1_1 Forward -191 -173 8.96727 0.206
NP_443064.1_6 Forward -180 -170 10.8217 0.13
NP_443064.1_6 Forward -229 -219 10.4338 0.153
NP_443064.1_6 Forward -319 -309 9.65817 0.205
NP_441306.1_6 Reverse -107 -126 15.5357 0.235
NP_442578.1_7 Forward -179 -172 14.5921 0.026
NP_442578.1_7 Reverse -172 -179 14.5921 0.026
NP_440710.1_1 Reverse -163 -181 -3.42244 0.208
NP_441462.1_2 Forward -180 -170 20.2362 0.000805
NP_441462.1_2 Reverse -171 -181 11.5831 0.00406
NP_441462.1_2 Forward -229 -219 -0.216628 0.192
NP_441621.1_7 Forward -182 -168 4.22782 0.0934
NP_443062.1_1 Forward -180 -162 20.9294 0.0208
NP_440936.1_10 Forward -134 -115 1.67069 0.241
NP_442204.1_1 Reverse -167 -178 9.49844 0.0759
NP_442204.1_2 Reverse -300 -319 10.2259 0.223
NP_442204.1_5 Forward -190 -171 9.3409 0.105
NP_442780.1_3 Forward -305 -286 7.20922 0.269
NP_440454.1_2 Reverse -113 -127 9.84729 0.296
NP_440516.1_6 Reverse -188 -202 11.897 0.197
NP_440516.1_8 Forward -180 -171 16.9127 0.00442
NP_440516.1_8 Reverse -171 -180 16.9127 0.00442
NP_442428.1_4 Forward -343 -324 2.75272 0.248
NP_442428.1_5 Forward -179 -172 15.8704 0.0124
NP_442428.1_5 Reverse -172 -179 15.8704 0.0124
NP_442120.1_10 Forward -186 -167 -5.31042 0.199
NP_440673.1_3 Forward -178 -171 12.4288 0.0426
NP_440673.1_3 Reverse -173 -180 12.4288 0.0426
NP_441052.1_2 Reverse -171 -181 10.5014 0.0285
NP_441052.1_2 Forward -180 -170 10.4031 0.0285
NP_441052.1_2 Forward -319 -309 -0.314959 0.273
NP_442219.1_9 Reverse -172 -181 8.35786 0.0681
NP_442219.1_9 Forward -179 -170 8.25953 0.0681
NP_440436.1_4 Reverse -172 -181 18.1905 0.00233
NP_440436.1_4 Forward -179 -170 9.24241 0.0871
NP_440436.1_4 Forward -228 -219 9.04574 0.092
NP_441884.1_8 Forward -181 -162 0.392778 0.138
NP_442864.1_7 Forward -313 -295 11.8189 0.242
NP_442907.1_9 Reverse -343 -362 2.55606 0.171
NP_441719.1_2 Forward -294 -280 12.8678 0.296
NP_441719.1_4 Forward -179 -172 16.3621 0.0124
NP_441719.1_4 Reverse -172 -179 16.3621 0.0124
NP_441733.1_10 Reverse -168 -181 5.91914 0.203
NP_441004.1_1 Forward -366 -347 -12.0953 0.244
NP_441004.1_1 Reverse -206 -225 -16.4218 0.284
NP_441004.1_1 Forward -324 -305 -16.5201 0.286
NP_441004.1_1 Forward -192 -173 -17.3068 0.29
NP_441004.1_1 Forward -203 -184 -17.5035 0.292
NP_441004.1_5 Reverse -208 -222 8.55439 0.274
NP_442366.1_3 Forward -181 -163 2.67408 0.125
NP_442694.1_7 Reverse -37 -50 17.7278 0.214
NP_442206.1_4 Reverse -172 -191 6.78429 0.259
NP_442206.1_10 Forward -180 -165 6.37141 0.178
NP_442854.1_6 Forward -180 -161 9.43923 0.214
NP_440328.1_4 Forward -186 -167 -0.787193 0.289
NP_443054.1_2 Reverse -169 -183 2.94952 0.24
NP_443054.1_2 Reverse -308 -322 0.982901 0.251
NP_442308.1_4 Reverse -304 -323 1.37609 0.267
NP_441851.1_10 Forward -181 -171 16.008 0.00552
NP_441851.1_10 Reverse -170 -180 8.53483 0.114
NP_441851.1_10 Forward -230 -220 5.5849 0.207
NP_442622.1_8 Forward -180 -162 -19.2537 0.296
NP_441542.1_4 Forward -167 -153 3.04785 0.292
NP_442856.1_7 Forward -189 -170 -0.787193 0.21
NP_442515.1_1 Reverse -170 -184 2.45787 0.135
NP_441396.1_5 Forward -205 -196 8.35786 0.224
NP_440593.1_3 Forward -234 -215 2.55606 0.175
NP_440593.1_3 Reverse -172 -191 -5.11376 0.258
NP_441982.1_6 Reverse -32 -41 11.1485 0.288
NP_442689.1_8 Forward -249 -232 -7.63097 0.292
NP_440940.1_7 Reverse -161 -179 7.88485 0.193
NP_441349.1_10 Reverse -161 -180 16.3224 0.0114
NP_441409.1_6 Forward -186 -167 2.45773 0.0584
NP_440432.1_9 Forward -179 -164 5.48643 0.055
NP_440432.1_9 Reverse -178 -193 -5.62497 0.26
NP_440474.1_8 Reverse -172 -186 15.9285 0.0537
NP_440431.1_4 Reverse -119 -138 -9.02441 0.275
NP_440431.1_4 Reverse -124 -143 -9.69285 0.288
NP_442450.1_5 Reverse -169 -179 9.41981 0.115
NP_442450.1_5 Forward -182 -172 9.32148 0.115
NP_440588.1_2 Forward -189 -170 1.0811 0.139
NP_440588.1_2 Forward -206 -187 -6.58872 0.285
NP_442006.1_2 Forward -363 -346 -13.5308 0.197
NP_443047.1_7 Forward -179 -160 4.03102 0.271
NP_442243.1_1 Reverse -103 -121 -2.43985 0.292
NP_441570.1_1 Forward -180 -162 19.7837 0.00322
NP_441570.1_1 Reverse -197 -215 -11.0923 0.187
NP_441078.1_4 Forward -180 -171 19.6659 0.0007
NP_441078.1_4 Reverse -171 -180 19.6659 0.0007
NP_442729.1_8 Forward -184 -171 9.45906 0.125
NP_442729.1_8 Reverse -216 -229 7.78743 0.136
NP_442348.1_2 Forward -381 -372 11.9961 0.225
NP_440707.1_9 Forward -20 -1 1.86774 0.286
NP_442443.1_1 Forward -359 -340 -5.01543 0.28
NP_440526.1_3 Reverse -178 -189 2.31981 0.267
NP_441432.1_8 Reverse -170 -179 16.8143 0.00595
NP_441432.1_8 Forward -181 -172 8.25953 0.0755
NP_442320.1_8 Forward -186 -172 -1.77037 0.0829
NP_442320.1_8 Reverse -165 -179 -4.7203 0.185
NP_441732.1_2 Reverse -167 -183 2.02515 0.0253
NP_441732.1_2 Forward -184 -168 -17.4444 0.258
NP_440629.1_6 Reverse -165 -184 24.7043 0.000417
NP_440760.1_1 Reverse -171 -190 -9.93197 0.084
NP_440760.1_1 Forward -229 -210 -22.42 0.257
NP_442797.1_7 Reverse -170 -188 0.805796 0.271
NP_440199.1_10 Forward -183 -173 13.2547 0.108
NP_441945.1_10 Forward -204 -185 8.45592 0.273
NP_441057.1_4 Reverse -377 -395 2.57575 0.253
NP_442353.1_8 Reverse -89 -108 18.7798 0.15
NP_442751.1_2 Forward -213 -194 3.34192 0.268
NP_442489.1_7 Forward -180 -171 20.1576 0.000695
NP_442489.1_7 Reverse -171 -180 20.1576 0.000695
NP_442079.1_7 Forward -179 -160 0.294447 0.286
NP_440559.1_1 Reverse -172 -181 8.75118 0.0586
NP_440559.1_1 Forward -179 -170 8.65285 0.0586
NP_441659.2_8 Forward -180 -170 20.9245 0.000805
NP_441659.2_8 Reverse -171 -181 11.9764 0.0147
NP_442008.1_2 Forward -322 -303 4.71934 0.232
NP_441800.1_3 Forward -335 -317 3.06741 0.298
NP_442346.1_5 Reverse -170 -180 16.303 0.00248
NP_442346.1_5 Forward -181 -171 9.02648 0.118
NP_442346.1_5 Forward -397 -387 4.79825 0.272
NP_440545.1_3 Reverse -167 -184 12.0352 0.0222
NP_441856.1_3 Forward -183 -164 2.65439 0.194
NP_440831.1_3 Forward -189 -170 5.90175 0.28
NP_440010.1_4 Reverse -167 -186 14.2566 0.157
NP_442603.1_7 Forward -319 -305 7.27547 0.211
NP_441948.1_4 Reverse -61 -79 -4.40575 0.228
NP_441833.1_4 Forward -179 -172 15.9687 0.0124
NP_441833.1_4 Reverse -172 -179 15.9687 0.0124
NP_441329.1_6 Reverse -110 -129 3.77151 0.212
NP_442498.1_5 Reverse -340 -359 12.1925 0.284
NP_442498.1_7 Forward -367 -350 21.9043 0.0476
NP_441895.1_2 Reverse -196 -215 -17.4051 0.224
NP_442060.1_3 Forward -260 -241 14.3549 0.233
NP_442699.1_3 Reverse -185 -204 -0.983855 0.273
NP_442162.1_9 Forward -179 -172 16.2637 0.0124
NP_442162.1_9 Reverse -172 -179 16.2637 0.0124
NP_440671.1_4 Reverse -165 -179 16.0275 0.0339
NP_442140.1_3 Reverse -172 -182 8.33817 0.119
NP_442140.1_3 Reverse -385 -395 4.89658 0.238
NP_442021.1_3 Forward -186 -167 -7.08038 0.261
NP_441696.1_6 Reverse -172 -191 1.27776 0.294
NP_440875.1_9 Forward -178 -168 8.27469 0.233
NP_441813.1_3 Forward -320 -301 14.916 0.238
NP_441813.1_5 Forward -182 -172 17.188 0.00979
NP_441813.1_5 Reverse -169 -179 15.9097 0.01
NP_440590.1_4 Reverse -172 -185 3.65753 0.0702
NP_440590.1_4 Forward -318 -305 1.29759 0.127
NP_440590.1_4 Reverse -221 -234 -1.25902 0.215
NP_440567.1_1 Reverse -172 -186 15.5359 0.017
NP_442497.1_10 Forward -179 -170 17.601 0.00813
NP_442497.1_10 Reverse -172 -181 10.4228 0.0087
NP_440821.1_4 Forward -182 -172 19.0562 0.00399
NP_440821.1_4 Reverse -169 -179 11.0914 0.0146
NP_441239.1_9 Reverse -169 -181 14.6903 0.0258
NP_441239.1_9 Forward -182 -170 13.3137 0.037
NP_441239.1_9 Reverse -351 -363 6.33216 0.193
NP_442691.1_2 Reverse -313 -332 4.42435 0.275
NP_442568.1_8 Reverse -155 -169 15.7325 0.192
NP_441892.1_1 Reverse -162 -179 4.6604 0.108
NP_440604.1_6 Forward -180 -161 9.24257 0.0797
NP_440219.1_1 Forward -132 -113 14.6558 0.199
NP_440219.1_1 Forward -151 -132 13.9873 0.218
NP_442083.1_9 Reverse -316 -335 12.8808 0.163
NP_441617.1_6 Forward -162 -143 -2.75381 0.258
NP_440546.1_4 Forward -180 -170 13.5365 0.0459
NP_440546.1_4 Reverse -171 -181 11.8882 0.0679
NP_440546.1_6 Forward -361 -342 7.07928 0.278
NP_440462.1_6 Reverse -169 -179 16.893 0.00853
NP_440462.1_6 Forward -182 -172 15.418 0.0142
NP_440868.1_4 Forward -184 -172 20.2952 0.00865
NP_440868.1_4 Reverse -167 -179 12.9203 0.0231
NP_441474.1_1 Reverse -178 -197 0.392004 0.255
NP_442402.1_4 Reverse -302 -321 -6.98278 0.268
NP_439948.1_2 Forward -61 -43 13.1799 0.283
NP_441084.1_6 Reverse -169 -183 9.24716 0.29
NP_440696.1_3 Forward -346 -328 -2.93078 0.28
NP_440696.1_3 Forward -180 -162 -2.93078 0.28
NP_442039.1_4 Forward -179 -172 15.1821 0.0124
NP_442039.1_4 Reverse -172 -179 15.1821 0.0124
NP_442039.1_4 Forward -228 -221 9.47889 0.145
NP_441811.1_1 Forward -230 -211 4.71934 0.282
NP_441811.1_8 Forward -186 -172 10.0294 0.22
NP_441926.1_3 Forward -180 -164 7.33503 0.17
NP_441053.1_8 Forward -95 -76 13.3725 0.21
NP_442837.1_3 Forward -179 -172 15.7721 0.0124
NP_442837.1_3 Reverse -172 -179 15.7721 0.0124
NP_442837.1_3 Forward -228 -221 9.38056 0.132
NP_442053.1_1 Forward -180 -171 18.3876 0.0007
NP_442053.1_1 Reverse -171 -180 18.3876 0.0007
NP_442053.1_1 Reverse -220 -229 4.52295 0.242
NP_440505.1_3 Reverse -169 -179 15.123 0.014
NP_440505.1_3 Forward -182 -172 13.8447 0.0247
NP_440505.1_3 Reverse -308 -318 4.40493 0.292
NP_441252.1_6 Forward -38 -31 14.3954 0.168
NP_441203.1_1 Reverse -172 -191 -20.3551 0.297
NP_442532.1_1 Reverse -125 -139 11.96 0.215
NP_442532.1_7 Reverse -171 -185 5.99778 0.171
NP_441408.2_7 Reverse -107 -126 1.17943 0.215
NP_440914.1_1 Forward -180 -170 16.3248 0.00196
NP_440914.1_1 Reverse -372 -382 9.7862 0.172
NP_440914.1_1 Reverse -84 -94 8.81029 0.186
NP_440914.1_1 Reverse -171 -181 8.6151 0.186
NP_440914.1_1 Forward -319 -309 6.07773 0.297
NP_441011.1_8 Reverse -172 -181 16.9127 0.00602
NP_441011.1_8 Forward -179 -170 16.6177 0.00602
NP_442101.1_10 Reverse -163 -182 3.04771 0.0714
NP_442533.1_1 Reverse -206 -225 -13.6686 0.237
NP_442533.1_1 Reverse -203 -222 -16.9135 0.277
NP_442533.1_6 Forward -180 -171 17.2076 0.00137
NP_442533.1_6 Reverse -171 -180 17.2076 0.00137
NP_442533.1_6 Forward -229 -220 5.11294 0.155
NP_442533.1_6 Reverse -177 -186 2.458 0.255
NP_442232.1_3 Forward -205 -186 -1.08219 0.153
NP_442322.1_4 Reverse -340 -357 -8.71327 0.286
NP_441482.1_7 Reverse -165 -179 15.5359 0.00993
NP_441482.1_7 Forward -186 -172 -9.04686 0.193
NP_439944.1_9 Forward -179 -169 17.6796 0.00347
NP_439944.1_9 Reverse -172 -182 10.3048 0.0887
NP_440816.1_2 Forward -38 -19 5.56364 0.297
NP_440116.1_5 Forward -183 -166 2.59545 0.262
NP_441527.1_4 Reverse -114 -133 -1.95801 0.152
NP_441527.1_4 Reverse -280 -299 -4.24981 0.182
NP_441527.1_4 Reverse -117 -136 -5.68219 0.206
NP_441527.1_4 Reverse -115 -134 -11.4117 0.282
NP_441527.1_4 Reverse -120 -139 -11.6982 0.284
NP_441527.1_4 Reverse -119 -138 -11.8892 0.284
NP_441527.1_4 Reverse -110 -129 -11.8892 0.284
NP_441527.1_4 Reverse -129 -148 -11.9847 0.285
NP_441527.1_4 Reverse -124 -143 -12.0802 0.285
NP_441527.1_4 Reverse -279 -298 -12.1756 0.285
NP_441527.1_5 Reverse -158 -177 11.8235 0.297
NP_440115.1_6 Reverse -168 -178 7.45319 0.147
NP_441680.1_4 Reverse -344 -363 0.196116 0.246
NP_440572.1_4 Forward -208 -189 16.4576 0.124
NP_441602.1_3 Forward -234 -215 -1.96717 0.231
NP_441602.1_3 Forward -185 -166 -4.6221 0.269
NP_442673.1_7 Forward -169 -150 11.9838 0.267
NP_441972.1_5 Reverse -104 -123 -3.04881 0.196
NP_441106.1_1 Reverse -170 -179 18.486 0.0028
NP_441106.1_1 Forward -181 -172 18.191 0.0028
NP_441420.1_1 Forward -230 -211 -4.32711 0.292
NP_439903.1_6 Reverse -168 -187 16.1249 0.0621
NP_441286.1_1 Reverse -170 -182 5.05386 0.0259
NP_441286.1_1 Forward -181 -169 4.8572 0.0272
NP_441286.1_1 Forward -230 -218 -4.38592 0.156
NP_440670.1_8 Forward -180 -171 18.3876 0.000699
NP_440670.1_8 Reverse -171 -180 18.3876 0.000699
NP_440886.1_7 Forward -181 -171 17.7774 0.0011
NP_440886.1_7 Reverse -170 -180 8.04271 0.0805
NP_440828.1_1 Reverse -179 -198 4.22689 0.219
NP_440828.1_4 Reverse -170 -189 -8.26108 0.296
NP_442614.1_2 Reverse -326 -340 9.14437 0.242
NP_442614.1_2 Reverse -171 -185 7.37441 0.275
NP_442717.1_8 Reverse -239 -258 13.175 0.25
NP_442072.1_9 Forward -181 -163 -22.892 0.266
NP_442072.1_9 Forward -188 -170 -23.3836 0.292
NP_441753.1_10 Reverse -363 -382 2.75272 0.227
NP_441753.1_10 Reverse -162 -181 2.75272 0.227
NP_440907.2_8 Forward -179 -169 9.51767 0.103
NP_440907.2_8 Reverse -172 -182 7.84605 0.117
NP_440907.2_8 Forward -228 -218 6.0761 0.179
NP_442264.1_2 Forward -190 -173 11.2486 0.185
NP_441021.1_8 Reverse -166 -184 3.65739 0.226
NP_442459.1_8 Forward -185 -166 14.9458 0.089
NP_441463.1_3 Reverse -161 -180 -2.45882 0.154
NP_441463.1_3 Forward -391 -372 -6.78538 0.249
NP_441463.1_6 Reverse -169 -183 11.2476 0.224
NP_441626.1_2 Forward -179 -172 15.7721 0.0124
NP_441626.1_2 Reverse -172 -179 15.7721 0.0124
NP_442365.1_7 Forward -184 -165 -3.14714 0.212
NP_441962.1_4 Reverse -215 -234 -14.1602 0.284
NP_441796.1_8 Forward -204 -186 16.0471 0.127
NP_440387.1_1 Reverse -171 -187 22.6747 0.00191
NP_440387.1_1 Forward -180 -164 13.6282 0.00825
NP_441431.1_2 Reverse -323 -337 6.39049 0.272
NP_441836.1_1 Forward -368 -349 11.8889 0.283
NP_441993.1_1 Forward -180 -161 3.31109 0.237
NP_441993.1_1 Reverse -171 -190 1.94669 0.267
NP_442352.1_1 Forward -399 -386 14.5851 0.251
NP_440467.1_8 Forward -393 -374 11.0125 0.249
NP_440114.1_10 Reverse -171 -185 15.4376 0.0252
NP_440114.1_10 Forward -180 -166 10.0294 0.155
NP_440114.1_10 Forward -277 -263 6.29277 0.276
NP_440311.1_2 Reverse -104 -123 10.4225 0.299
NP_441510.2_6 Reverse -342 -361 12.3883 0.282
NP_440766.1_4 Forward -210 -196 11.701 0.0628
NP_440766.1_4 Reverse -167 -181 6.78443 0.0973
NP_439988.1_3 Forward -340 -326 3.73617 0.298
NP_440422.1_10 Forward -142 -123 10.1138 0.2
NP_442743.1_5 Reverse -166 -185 4.62101 0.215
NP_439910.1_2 Reverse -163 -180 -13.6292 0.162
NP_442867.1_8 Reverse -346 -365 5.50599 0.276
NP_440457.1_1 Forward -184 -172 1.80894 0.223
NP_440457.1_1 Reverse -167 -179 1.41561 0.239
NP_440798.1_6 Forward -179 -166 0.60927 0.254
NP_442509.1_9 Reverse -171 -181 16.2041 0.00739
NP_442509.1_9 Reverse -310 -320 10.8943 0.152
NP_442509.1_9 Forward -180 -170 8.04271 0.192
NP_442936.1_10 Reverse -92 -106 7.06267 0.297
NP_440734.1_9 Reverse -342 -361 18.6823 0.0967
NP_441159.1_1 Forward -138 -119 -2.85214 0.282
NP_440554.1_4 Forward -179 -169 16.1063 0.0189
NP_440554.1_4 Reverse -172 -182 14.6313 0.02
NP_441885.1_5 Reverse -171 -181 11.4848 0.00668
NP_441885.1_5 Forward -180 -170 11.3864 0.00668
NP_441885.1_5 Forward -229 -219 -1.69159 0.277
NP_440420.1_1 Forward -41 -22 27.0691 0.00137
NP_440420.1_4 Forward -127 -108 22.4406 0.0803
NP_441428.1_8 Forward -188 -169 4.52268 0.241
NP_442703.1_9 Reverse -113 -131 3.16574 0.299
NP_442341.1_7 Reverse -170 -184 7.17775 0.11
NP_442341.1_9 Forward -182 -168 13.8636 0.0744
NP_442341.1_9 Reverse -324 -338 8.16044 0.178
NP_442341.1_9 Reverse -169 -183 7.07881 0.204
NP_443000.1_7 Reverse -169 -179 17.4829 0.00719
NP_443000.1_7 Forward -182 -172 8.73149 0.0437
NP_443000.1_7 Forward -286 -276 1.84832 0.228
NP_440727.1_2 Forward -188 -169 -0.0988766 0.288
NP_441842.1_10 Forward -187 -173 6.78443 0.272
NP_440275.1_3 Reverse -169 -179 9.12481 0.055
NP_440275.1_3 Forward -182 -172 8.4365 0.0602
NP_440091.1_1 Forward -184 -172 8.29878 0.0653
NP_440091.1_1 Reverse -167 -179 -0.354346 0.273
NP_442275.1_1 Reverse -317 -336 1.0811 0.284
NP_440679.1_10 Reverse -173 -192 -18.2901 0.278
NP_440679.1_10 Forward -187 -168 -20.7484 0.286
NP_442451.1_2 Forward -188 -169 -0.983855 0.166
NP_441122.1_1 Forward -97 -82 3.32315 0.281
NP_440175.1_4 Forward -188 -169 -13.0786 0.239
NP_442495.1_5 Forward -329 -310 6.4893 0.291
NP_440149.1_8 Reverse -171 -190 -0.983855 0.154
NP_440149.1_8 Forward -180 -161 -1.86883 0.162
NP_441804.1_5 Forward -132 -113 23.6338 0.046
NP_440216.1_1 Forward -180 -166 5.30946 0.0215
NP_440216.1_1 Reverse -171 -185 -1.27871 0.0303
NP_440216.1_9 Reverse -256 -265 5.40793 0.294
NP_440172.1_1 Forward -180 -170 17.5813 0.00421
NP_440172.1_1 Reverse -171 -181 8.73149 0.0586
NP_440249.1_2 Reverse -201 -211 14.8275 0.273
NP_442015.1_3 Reverse -178 -197 9.7334 0.296
NP_442015.1_10 Forward -184 -171 9.75405 0.0449
NP_442015.1_10 Reverse -167 -180 1.49425 0.204
NP_441226.1_7 Forward -179 -172 14.4934 0.0123
NP_441226.1_7 Reverse -172 -179 14.4934 0.0123
NP_442446.1_7 Reverse -351 -370 -1.7705 0.294
NP_441111.1_7 Forward -179 -171 18.7023 0.00294
NP_441111.1_7 Reverse -172 -180 18.7023 0.00294
NP_441111.1_7 Reverse -221 -229 -0.472234 0.131
NP_442379.1_10 Reverse -164 -181 -2.02611 0.224
NP_441766.1_2 Forward -180 -171 17.5026 0.00297
NP_441766.1_2 Reverse -171 -180 17.5026 0.00297
NP_442417.1_5 Forward -180 -166 9.04604 0.138
NP_440416.1_9 Reverse -303 -322 -18.5851 0.26
NP_443052.1_8 Forward -190 -171 -11.0136 0.221
NP_443052.1_8 Reverse -161 -180 -12.8819 0.267
NP_443052.1_9 Reverse -2 -21 -1.86883 0.231
NP_443052.1_9 Reverse -304 -323 -3.93378 0.253
NP_443052.1_9 Reverse -341 -360 -5.70374 0.273
NP_440072.1_5 Forward -195 -177 -1.94747 0.267
NP_440591.1_9 Forward -187 -169 4.24738 0.285
NP_442154.1_1 Reverse -204 -222 -15.3205 0.218
NP_442154.1_1 Forward -371 -353 -18.7621 0.285
NP_440896.1_8 Reverse -148 -167 11.9958 0.274
NP_440261.1_5 Reverse -172 -185 -2.63565 0.0924
NP_440261.1_5 Forward -179 -166 -10.6988 0.203
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTTAGCCACCATCAGTCTCGGCATTGTTTTCTTGTTTGGCCAGGCGGCGGAGTGGGCCGGTATGCCCTTTGGCCTGGATGCGGGATCCGCAGGGGGAACTTTCTTTTTACTAACTGGTTTTCACGGATTGCACGTTTTCACTGGGGTCTGTCTTTTGCTTTATATGTATTGGCGCTCCCTCCAGCCCCACAATTTTGATCGGGGCCATGAAGGGGTGACGGCGATCGCCTTGTTTTGGCATTTTGTCGATGTAATTTGGATTATTTTATTTATTTTGCTTTATCTTTGGCCAGCGAATTAAATCTTTGGCATTGTTGAGACCGAGTATCCCAAAGTATGATCTAGGTAGAAAGATAACTTTTTGGGCAAGATATAGAATCTCCAGGGAGAGGTGATGCA

CDS

ATGGCCGTTAATCTAGAAACTCGCAAACAGGAAAGTGTAACTAAACCCAAAGCAGAGCATCTGATTTTGCTCAATCCAGTTAGTTGGAATACGTTCAATCAGTTACTAGAAGAATTAGGAGAAAAACGAGGTCAAAGATTTGCCTATGACTGTGGAATTCTAGAAATTATGAGTCCTTTGGGTGTTCACGAAAACAACAATCGCTTTATTGATGACCTCATTCGAGCAATCACCGACGAATTGGGATTAAATCTTAAAAAATTTGGTTCATTAACGTTAAGAATTGATCGAACTAAACAGGGAGTGGAGCCAGATTCCTGCTATTACATAGCAAACGAACCCCAGGTGCGGGGCAAGCAACACATTGACCTCACGGTGGATCCTCCCCCCGATTTGGTATTAGAGATTGATATTACCAGTGGCTCCTTGAACAAGTTCCCAATCTACAGCAATTTAGGCATACCGGAGATTTGGTGCTATGACGGCGATCGCCTGGCAGTATTTGTGCTCCAACCGGAGTCGGGGCAGTATGAACCTGTTGACCAAAGTCCCACTTTTCCATTTTTATCTCTAGAACAGGTGCCCTTGGTAATTGAACGCAGTTTGGCGATCGGGGAGACGGCGGCCCTGAAGGAGTTTCGCCAATGGCTAAAGGCCAACCGTTGA

Protein

MAVNLETRKQESVTKPKAEHLILLNPVSWNTFNQLLEELGEKRGQRFAYDCGILEIMSPLGVHENNNRFIDDLIRAITDELGLNLKKFGSLTLRIDRTKQGVEPDSCYYIANEPQVRGKQHIDLTVDPPPDLVLEIDITSGSLNKFPIYSNLGIPEIWCYDGDRLAVFVLQPESGQYEPVDQSPTFPFLSLEQVPLVIERSLAIGETAALKEFRQWLKANR