Your browser is old and dusty. Try Google Chrome!

Details for slr2082

ORF slr2082
Accession NP_441291.1
Symbol ctaDII
Category Respiratory terminal oxidases
Definition cytochrome c oxidase subunit I
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -127 -113 12.586 0.209
NP_441061.1_2 Forward -60 -46 11.406 0.0519
NP_441061.1_2 Reverse -119 -133 4.52282 0.147
NP_440557.1_1 Reverse -119 -138 19.5673 0.038
NP_440557.1_1 Reverse -152 -171 14.5524 0.0645
NP_440795.1_7 Forward -126 -119 14.6904 0.0123
NP_440795.1_7 Reverse -119 -126 14.6904 0.0123
NP_441418.1_6 Reverse -118 -137 -29.0082 0.215
NP_442291.1_5 Reverse -117 -133 1.04184 0.154
NP_441453.1_4 Reverse -118 -126 16.539 0.00633
NP_441453.1_4 Forward -127 -119 16.539 0.00633
NP_441453.1_4 Forward -160 -152 6.80426 0.121
NP_441453.1_4 Reverse -151 -159 6.11594 0.121
NP_441453.1_8 Forward -167 -150 15.2801 0.205
NP_442151.1_6 Reverse -118 -132 19.7641 0.0045
NP_442151.1_6 Forward -160 -146 14.0609 0.0406
NP_442151.1_6 Forward -127 -113 7.57108 0.194
NP_440561.1_1 Forward -66 -47 9.7334 0.284
NP_441818.1_1 Reverse -119 -130 18.8393 0.00301
NP_441818.1_9 Reverse -184 -203 -9.93197 0.291
NP_440226.1_1 Forward -160 -141 6.4893 0.128
NP_440226.1_1 Reverse -151 -170 5.60432 0.151
NP_440226.1_1 Reverse -118 -137 5.11266 0.166
NP_442623.1_3 Reverse -1 -20 -10.817 0.199
NP_442655.1_2 Reverse -345 -364 5.70265 0.209
NP_442173.1_1 Forward -126 -118 15.4574 0.00633
NP_442173.1_1 Reverse -119 -127 15.4574 0.00633
NP_442173.1_1 Reverse -152 -160 12.0158 0.0316
NP_442173.1_1 Forward -159 -151 4.83764 0.241
NP_442752.1_4 Forward -160 -153 13.8055 0.0199
NP_442752.1_4 Forward -127 -120 13.8055 0.0199
NP_442752.1_4 Reverse -118 -125 13.8055 0.0199
NP_443027.1_4 Forward -129 -119 14.0414 0.0452
NP_443027.1_4 Reverse -116 -126 13.2547 0.0521
NP_441812.1_3 Forward -128 -114 9.83269 0.228
NP_442975.1_10 Forward -131 -117 13.4703 0.0459
NP_442975.1_10 Forward -164 -150 3.34225 0.259
NP_442975.1_10 Reverse -50 -64 2.8506 0.269
NP_440784.1_7 Forward -126 -119 15.9687 0.0123
NP_440784.1_7 Reverse -119 -126 15.9687 0.0123
NP_440784.1_7 Forward -159 -152 6.23397 0.241
NP_440784.1_7 Reverse -152 -159 6.13563 0.241
NP_442909.1_7 Reverse -146 -160 9.04542 0.161
NP_442909.1_7 Reverse -119 -133 6.29216 0.252
NP_440061.1_9 Forward -129 -115 11.1104 0.117
NP_440061.1_9 Reverse -309 -323 9.83206 0.137
NP_442062.1_8 Reverse -118 -128 17.3846 0.00193
NP_442062.1_8 Forward -127 -117 10.3048 0.0493
NP_442062.1_8 Forward -270 -260 5.38824 0.172
NP_442062.1_8 Reverse -192 -202 4.60159 0.206
NP_440761.1_4 Reverse -113 -132 -12.7836 0.257
NP_441900.1_2 Reverse -381 -399 -6.76639 0.297
NP_441802.1_1 Forward -118 -99 15.4374 0.174
NP_440304.1_4 Forward -129 -119 10.8948 0.051
NP_440304.1_4 Reverse -116 -126 10.8948 0.051
NP_442242.1_4 Forward -126 -119 14.3954 0.0124
NP_442242.1_4 Reverse -119 -126 14.3954 0.0124
NP_440044.1_8 Forward -292 -273 4.22769 0.119
NP_440916.1_1 Reverse -143 -157 8.65272 0.267
NP_441200.1_4 Forward -120 -101 9.83255 0.224
NP_441208.1_9 Forward -130 -116 5.1128 0.278
NP_440370.1_10 Forward -136 -117 10.9142 0.195
NP_442110.1_7 Reverse -118 -132 18.9775 0.0138
NP_442110.1_7 Forward -127 -113 2.65453 0.222
NP_440300.1_1 Reverse -145 -164 7.96345 0.255
NP_440856.1_4 Reverse -111 -130 0.196116 0.167
NP_440856.1_7 Forward -305 -286 -7.76869 0.256
NP_441083.1_5 Reverse -118 -128 20.3345 0.00053
NP_441083.1_5 Forward -127 -117 11.2881 0.0159
NP_441083.1_5 Reverse -151 -161 8.82982 0.03
NP_441083.1_5 Forward -160 -150 8.04317 0.046
NP_442827.1_8 Forward -135 -116 1.6703 0.173
NP_442827.1_8 Reverse -116 -135 -0.00131823 0.217
NP_441434.1_7 Reverse -336 -350 1.57289 0.299
NP_441738.1_2 Reverse -153 -160 15.28 0.0102
NP_441738.1_2 Forward -125 -118 15.28 0.0102
NP_441738.1_2 Reverse -120 -127 15.28 0.0102
NP_441558.1_5 Reverse -116 -135 14.7491 0.0474
NP_441558.1_5 Reverse -149 -168 9.63589 0.117
NP_441558.1_5 Forward -129 -110 8.06259 0.162
NP_440209.1_1 Reverse -118 -126 18.1123 0.00295
NP_440209.1_1 Forward -127 -119 18.1123 0.00295
NP_440209.1_1 Forward -160 -152 8.57422 0.0425
NP_440209.1_1 Reverse -151 -159 5.52596 0.0821
NP_440209.1_2 Reverse -347 -363 12.6449 0.182
NP_442889.1_8 Reverse -115 -129 9.6354 0.0952
NP_441713.1_1 Reverse -112 -131 -13.2752 0.255
NP_440178.1_7 Reverse -117 -136 -6.09707 0.0663
NP_441716.1_1 Reverse -118 -132 6.09611 0.207
NP_441716.1_1 Reverse -232 -246 4.12949 0.258
NP_441598.1_8 Forward -266 -251 18.1049 0.132
NP_442111.1_4 Forward -128 -114 13.2743 0.0394
NP_442111.1_4 Reverse -150 -164 10.7177 0.0518
NP_440906.1_5 Forward -126 -119 15.8704 0.0124
NP_440906.1_5 Reverse -119 -126 15.8704 0.0124
NP_440906.1_5 Forward -159 -152 6.23397 0.234
NP_440906.1_5 Reverse -152 -159 6.13563 0.241
NP_440747.1_10 Reverse -115 -127 17.1486 0.000663
NP_440747.1_10 Forward -130 -118 7.51213 0.00286
NP_440747.1_10 Reverse -148 -160 -12.2524 0.254
NP_440747.1_10 Reverse -235 -247 -12.4491 0.282
NP_441130.1_10 Forward -129 -115 7.47274 0.158
NP_441130.1_10 Reverse -149 -163 6.19444 0.197
NP_441130.1_10 Forward -295 -281 5.30946 0.236
NP_441486.1_1 Forward -130 -116 5.89945 0.0344
NP_441486.1_1 Forward -163 -149 -4.52363 0.201
NP_441486.1_1 Reverse -115 -129 -5.11362 0.222
NP_442634.1_4 Reverse -116 -130 7.07942 0.0479
NP_442634.1_4 Forward -129 -115 -1.18038 0.149
NP_441014.1_10 Reverse -117 -136 0.0970122 0.246
NP_442848.1_1 Forward -133 -119 16.5192 0.0143
NP_442848.1_1 Forward -166 -152 -2.75368 0.263
NP_442848.1_9 Forward -27 -8 0.884433 0.265
NP_443018.1_3 Forward -126 -119 14.8871 0.0123
NP_443018.1_3 Reverse -119 -126 14.8871 0.0123
NP_443018.1_3 Reverse -152 -159 11.7405 0.0655
NP_443018.1_3 Forward -159 -152 5.44732 0.193
NP_441316.1_7 Forward -129 -114 7.84638 0.107
NP_441634.1_8 Reverse -116 -130 -4.4253 0.295
NP_441634.1_9 Reverse -283 -302 9.63507 0.275
NP_440376.1_1 Forward -127 -118 19.4693 0.000692
NP_440376.1_1 Reverse -118 -127 19.4693 0.000692
NP_440376.1_1 Forward -160 -151 5.99792 0.111
NP_440376.1_1 Forward -305 -296 1.08137 0.258
NP_440376.1_1 Reverse -151 -160 -0.196935 0.285
NP_441588.1_4 Reverse -120 -130 8.63316 0.14
NP_441588.1_4 Reverse -153 -163 6.96153 0.178
NP_442687.1_7 Reverse -117 -127 9.02648 0.0994
NP_442687.1_7 Forward -128 -118 8.92815 0.0994
NP_442687.1_7 Forward -161 -151 4.50326 0.245
NP_442191.1_4 Reverse -262 -276 11.187 0.268
NP_442191.1_4 Reverse -152 -166 11.0901 0.271
NP_442485.1_3 Reverse -294 -313 -6.1954 0.299
NP_441846.1_10 Forward -331 -312 -13.7669 0.211
NP_441846.1_10 Forward -336 -317 -15.1435 0.245
NP_442958.1_3 Forward -138 -119 -2.16383 0.293
NP_442530.1_2 Forward -365 -355 17.5813 0.178
NP_440642.1_10 Forward -23 -9 4.62054 0.25
NP_440042.1_2 Forward -203 -184 -0.688862 0.231
NP_440042.1_2 Reverse -326 -345 -4.42544 0.293
NP_441422.1_7 Reverse -302 -319 0.235503 0.147
NP_442658.1_1 Reverse -116 -126 14.2375 0.0237
NP_442658.1_1 Forward -203 -193 10.4026 0.119
NP_442658.1_1 Forward -129 -119 6.76441 0.214
NP_442658.1_1 Forward -162 -152 6.17443 0.235
NP_442782.1_2 Forward -127 -113 1.57289 0.281
NP_442782.1_2 Reverse -284 -298 0.0979218 0.296
NP_442544.1_6 Reverse -111 -130 10.5209 0.0884
NP_441414.1_9 Forward -160 -141 18.879 0.00805
NP_441414.1_9 Reverse -151 -170 -3.63879 0.14
NP_441414.1_9 Reverse -118 -137 -3.83545 0.143
NP_441414.1_9 Forward -127 -108 -5.9004 0.182
NP_442937.1_5 Reverse -279 -298 11.7992 0.13
NP_442937.1_5 Forward -358 -339 5.99764 0.293
NP_441958.1_5 Reverse -117 -127 21.2195 0.000805
NP_441958.1_5 Forward -128 -118 12.2714 0.00183
NP_441958.1_5 Forward -161 -151 0.865012 0.12
NP_442057.1_4 Reverse -165 -184 13.5691 0.259
NP_442836.1_5 Forward -133 -114 3.34271 0.237
NP_439905.1_1 Forward -126 -113 11.0324 0.204
NP_440984.1_7 Reverse -113 -127 19.4691 0.00745
NP_440984.1_7 Reverse -146 -160 11.0127 0.122
NP_439990.1_5 Forward -132 -119 9.95071 0.128
NP_439990.1_5 Reverse -113 -126 7.29578 0.203
NP_442690.1_1 Forward -51 -32 -11.8003 0.233
NP_442911.1_2 Reverse -141 -160 3.34271 0.0442
NP_442911.1_2 Forward -137 -118 2.65439 0.0491
NP_442911.1_2 Forward -170 -151 -7.86702 0.221
NP_440153.1_5 Reverse -119 -133 9.04604 0.127
NP_440153.1_5 Reverse -152 -166 0.491246 0.299
NP_442064.1_1 Reverse -146 -165 -13.4719 0.289
NP_443055.1_6 Forward -69 -51 3.8533 0.192
NP_443055.1_6 Forward -201 -183 -2.73484 0.299
NP_440993.1_3 Reverse -141 -160 6.98015 0.144
NP_440496.1_5 Reverse -74 -93 13.1297 0.224
NP_441913.1_3 Forward -77 -64 14.0036 0.299
NP_441099.1_5 Forward -203 -184 -9.14533 0.214
NP_441099.1_5 Forward -137 -118 -9.93197 0.237
NP_442002.1_1 Forward -330 -312 -8.04399 0.261
NP_442002.1_9 Forward -161 -154 10.7572 0.185
NP_440809.1_9 Reverse -109 -127 -8.33898 0.235
NP_441294.1_7 Forward -131 -117 10.1145 0.207
NP_441646.1_1 Forward -312 -293 -0.0988766 0.259
NP_442438.1_10 Forward -132 -118 14.4542 0.0311
NP_441398.1_7 Forward -178 -159 20.4416 0.284
NP_441292.1_2 Forward -134 -115 -7.17871 0.25
NP_441000.1_6 Reverse -150 -164 -4.13031 0.227
NP_440484.1_3 Reverse -282 -296 10.0294 0.245
NP_440147.1_4 Reverse -116 -129 10.2457 0.0355
NP_440147.1_4 Forward -129 -116 9.16406 0.0428
NP_440147.1_4 Forward -162 -149 1.69091 0.222
NP_441175.1_7 Reverse -118 -137 9.43923 0.183
NP_441550.1_8 Reverse -116 -126 15.8108 0.0132
NP_441550.1_8 Forward -129 -119 12.3692 0.0336
NP_441550.1_8 Reverse -149 -159 12.1726 0.0361
NP_441550.1_8 Forward -162 -152 4.7978 0.283
NP_441916.1_7 Forward -127 -117 18.9579 0.00144
NP_441916.1_7 Reverse -118 -128 10.3048 0.0261
NP_441041.1_4 Reverse -151 -170 0.0977854 0.0907
NP_441041.1_4 Forward -133 -114 -0.787193 0.0974
NP_441041.1_4 Reverse -118 -137 -3.24547 0.12
NP_441041.1_4 Reverse -40 -59 -11.3086 0.244
NP_441041.1_7 Reverse -115 -127 13.3454 0.0485
NP_441041.1_7 Forward -163 -151 6.34865 0.211
NP_442004.1_6 Reverse -118 -132 1.86788 0.276
NP_441725.1_4 Reverse -113 -127 3.93223 0.278
NP_441725.1_5 Reverse -119 -129 11.2881 0.0247
NP_441725.1_5 Forward -126 -116 1.94665 0.115
NP_441725.1_5 Reverse -152 -162 1.455 0.135
NP_439966.1_7 Forward -129 -119 15.8108 0.0124
NP_439966.1_7 Reverse -149 -159 14.5325 0.0203
NP_439966.1_7 Reverse -116 -126 14.3359 0.0203
NP_439966.1_7 Forward -162 -152 8.73102 0.13
NP_439966.1_9 Forward -162 -153 0.983037 0.253
NP_442941.1_3 Reverse -119 -129 19.9412 0.00262
NP_442941.1_3 Forward -126 -116 19.2529 0.00262
NP_442941.1_3 Reverse -152 -162 1.65166 0.147
NP_440289.1_2 Forward -163 -150 10.344 0.027
NP_440289.1_2 Forward -130 -117 6.50913 0.0591
NP_440289.1_2 Reverse -115 -128 3.16588 0.0811
NP_440289.1_2 Reverse -341 -354 -4.11062 0.28
NP_442281.1_1 Forward -132 -118 16.8135 0.00698
NP_442281.1_1 Reverse -113 -127 15.9285 0.00992
NP_442256.1_2 Reverse -116 -134 -7.25734 0.214
NP_442256.1_2 Reverse -149 -167 -8.33898 0.221
NP_442256.1_8 Reverse -344 -363 19.4681 0.149
NP_440437.1_1 Forward -166 -147 -0.000545616 0.173
NP_440437.1_1 Forward -299 -280 -0.4922 0.181
NP_442500.1_2 Forward -324 -305 6.29264 0.283
NP_440723.1_4 Reverse -9 -28 -11.7019 0.298
NP_440498.1_1 Reverse -109 -127 2.67408 0.177
NP_442982.1_5 Forward -137 -118 4.916 0.17
NP_441644.1_6 Forward -127 -117 19.0557 0.000803
NP_441644.1_6 Reverse -118 -128 17.3841 0.00127
NP_441644.1_6 Reverse -151 -161 7.15773 0.133
NP_441644.1_6 Forward -160 -150 4.01116 0.253
NP_441644.1_6 Forward -60 -50 3.32285 0.288
NP_443049.1_6 Forward -161 -151 11.6409 0.24
NP_442215.1_2 Reverse -116 -132 6.64671 0.0702
NP_442215.1_2 Forward -129 -113 -3.48138 0.216
NP_442215.1_2 Reverse -149 -165 -5.05468 0.244
NP_442029.1_6 Forward -342 -323 5.80098 0.248
NP_440253.1_2 Reverse -118 -136 10.0489 0.0419
NP_440253.1_2 Reverse -151 -169 -2.3408 0.265
NP_440929.1_8 Forward -127 -118 19.2726 0.000701
NP_440929.1_8 Reverse -118 -127 19.2726 0.000701
NP_440929.1_8 Reverse -151 -160 7.07956 0.0713
NP_440566.1_6 Reverse -116 -135 13.4708 0.18
NP_441346.1_4 Forward -161 -142 14.0608 0.226
NP_442933.1_10 Forward -127 -118 17.601 0.00325
NP_442933.1_10 Reverse -118 -127 17.601 0.00325
NP_441751.2_8 Forward -126 -112 5.01447 0.0448
NP_441751.2_8 Reverse -119 -133 -3.147 0.134
NP_442554.1_8 Forward -126 -116 17.2863 0.00543
NP_442554.1_8 Reverse -119 -129 15.9097 0.00747
NP_442554.1_8 Forward -159 -149 6.17489 0.125
NP_442554.1_8 Reverse -152 -162 4.0116 0.2
NP_442554.1_8 Reverse -52 -62 3.02829 0.245
NP_442554.1_8 Forward -304 -294 2.43831 0.272
NP_442167.1_6 Reverse -147 -163 10.9726 0.256
NP_441762.1_7 Forward -161 -149 4.16888 0.0533
NP_441762.1_7 Reverse -117 -129 -6.74586 0.284
NP_441762.1_7 Forward -128 -116 -6.84419 0.284
NP_442313.1_5 Reverse -47 -66 4.81767 0.264
NP_442313.1_5 Reverse -13 -32 4.62101 0.271
NP_442142.1_4 Forward -130 -117 14.7683 0.0302
NP_442142.1_4 Reverse -115 -128 12.9 0.0406
NP_442142.1_4 Forward -296 -283 8.96682 0.106
NP_442142.1_4 Reverse -175 -188 5.91857 0.178
NP_442142.1_4 Forward -58 -45 3.36198 0.258
NP_442142.1_4 Forward -163 -150 2.96866 0.269
NP_442292.1_1 Reverse -119 -128 18.486 0.00229
NP_442292.1_1 Forward -126 -117 17.5026 0.00435
NP_442292.1_1 Forward -159 -150 -0.0986038 0.239
NP_442292.1_1 Reverse -152 -161 -0.196935 0.239
NP_442143.1_8 Forward -188 -169 12.29 0.223
NP_442476.1_6 Forward -126 -112 12.9793 0.0454
NP_442476.1_6 Forward -159 -145 1.96621 0.199
NP_441711.1_4 Forward -202 -183 2.16274 0.297
NP_443009.1_5 Forward -128 -117 14.5128 0.02
NP_443009.1_5 Reverse -117 -128 10.1862 0.0792
NP_441726.1_7 Reverse -170 -189 9.24257 0.15
NP_441715.1_4 Forward -126 -116 16.7946 0.0106
NP_441715.1_4 Reverse -119 -129 14.828 0.0268
NP_441715.1_4 Reverse -152 -162 6.46988 0.143
NP_440379.1_5 Forward -64 -45 -9.34199 0.263
NP_440379.1_5 Reverse -234 -253 -11.4069 0.296
NP_441468.1_1 Forward -126 -119 15.8704 0.0124
NP_441468.1_1 Reverse -119 -126 15.8704 0.0124
NP_441468.1_1 Forward -159 -152 6.13563 0.209
NP_441468.1_1 Reverse -152 -159 6.0373 0.223
NP_441015.1_10 Reverse -113 -132 -9.047 0.278
NP_441673.1_1 Forward -127 -118 20.8459 0.000698
NP_441673.1_1 Reverse -118 -127 20.8459 0.000698
NP_441673.1_1 Forward -160 -151 1.37636 0.114
NP_441673.1_1 Reverse -151 -160 1.1797 0.163
NP_441826.1_2 Forward -133 -119 23.2057 0.00229
NP_441826.1_2 Forward -166 -152 11.5043 0.0358
NP_441826.1_2 Reverse -118 -132 -0.492064 0.213
NP_441826.1_2 Forward -276 -262 -0.688726 0.22
NP_441330.1_1 Reverse -113 -132 -12.2919 0.183
NP_442868.1_6 Reverse -116 -126 10.4031 0.038
NP_442868.1_6 Forward -129 -119 9.91146 0.038
NP_442868.1_6 Reverse -149 -159 7.35486 0.0808
NP_441056.1_1 Reverse -118 -137 -5.99873 0.266
NP_441612.1_2 Reverse -118 -128 8.54929 0.21
NP_443058.1_7 Forward -22 -3 4.22769 0.26
NP_443058.1_7 Reverse -150 -169 2.0644 0.294
NP_442361.1_3 Forward -133 -120 15.9489 0.0811
NP_442361.1_3 Forward -166 -153 15.8506 0.0811
NP_442427.1_8 Reverse -142 -161 5.01433 0.284
NP_442808.1_1 Reverse -150 -160 9.616 0.0481
NP_442808.1_1 Reverse -117 -127 8.73102 0.0481
NP_442808.1_1 Forward -128 -118 8.63269 0.0481
NP_442808.1_1 Reverse -334 -344 1.94622 0.281
NP_441101.1_10 Reverse -303 -322 -7.27704 0.29
NP_440031.1_8 Forward -319 -300 15.9291 0.201
NP_440145.1_3 Forward -137 -118 0.0977854 0.138
NP_442542.1_2 Reverse -116 -129 9.85238 0.131
NP_442050.1_5 Forward -129 -119 16.4991 0.00812
NP_442050.1_5 Reverse -116 -126 15.9091 0.0091
NP_442050.1_5 Reverse -149 -159 12.4676 0.0617
NP_442789.1_4 Forward -304 -285 -0.295539 0.199
NP_441518.1_3 Forward -137 -118 -13.8652 0.264
NP_441878.1_6 Reverse -117 -127 10.5014 0.0176
NP_441878.1_6 Forward -128 -118 10.4031 0.0176
NP_441878.1_6 Forward -62 -52 -0.609952 0.178
NP_441036.1_3 Reverse -11 -30 -5.70374 0.296
NP_441036.1_8 Reverse -117 -127 15.713 0.00724
NP_441036.1_8 Forward -128 -118 8.33817 0.174
NP_441036.1_8 Forward -161 -151 6.8632 0.213
NP_441557.1_5 Forward -127 -118 19.9609 0.000699
NP_441557.1_5 Reverse -118 -127 19.9609 0.000699
NP_441557.1_5 Forward -160 -151 1.08137 0.0794
NP_441557.1_5 Reverse -151 -160 0.589713 0.134
NP_441557.1_8 Reverse -297 -307 13.0576 0.225
NP_441445.1_1 Reverse -275 -294 4.62101 0.191
NP_442066.2_4 Forward -127 -108 -8.85033 0.296
NP_442066.2_9 Reverse -147 -160 16.2439 0.0551
NP_442066.2_9 Reverse -114 -127 12.6056 0.154
NP_442777.1_1 Reverse -150 -169 4.81688 0.296
NP_441308.1_8 Forward -162 -152 8.4365 0.254
NP_440101.1_3 Reverse -113 -132 17.109 0.0483
NP_442183.1_1 Reverse -118 -132 9.14437 0.101
NP_442183.1_1 Forward -160 -146 6.3911 0.176
NP_440356.1_1 Reverse -311 -330 19.8614 0.0831
NP_441549.1_9 Reverse -234 -252 3.65739 0.0925
NP_441549.1_9 Forward -131 -113 -6.37237 0.198
NP_441467.1_10 Reverse -356 -370 6.3911 0.281
NP_442347.1_2 Reverse -119 -128 12.4878 0.056
NP_442347.1_2 Reverse -152 -161 8.94785 0.0718
NP_442347.1_2 Forward -126 -117 3.34298 0.284
NP_442645.1_2 Forward -135 -116 -14.5535 0.175
NP_442645.1_2 Reverse -184 -203 -17.7001 0.261
NP_442965.1_2 Forward -397 -378 -6.68705 0.261
NP_442888.1_6 Forward -212 -193 8.25926 0.196
NP_441037.1_4 Reverse -116 -126 7.22024 0.237
NP_441633.1_3 Reverse -116 -129 -3.81562 0.177
NP_441633.1_3 Forward -129 -116 -6.07724 0.236
NP_440136.1_2 Forward -126 -119 15.9687 0.0123
NP_440136.1_2 Reverse -119 -126 15.9687 0.0123
NP_440136.1_2 Forward -159 -152 6.23397 0.171
NP_440136.1_2 Reverse -152 -159 6.13563 0.193
NP_442590.1_10 Reverse -151 -170 10.4225 0.181
NP_442590.1_10 Reverse -145 -164 4.32602 0.276
NP_442998.1_5 Reverse -349 -359 11.8781 0.176
NP_442998.1_10 Reverse -153 -160 15.5754 0.0102
NP_442998.1_10 Forward -125 -118 15.5754 0.0102
NP_442998.1_10 Reverse -120 -127 15.5754 0.0102
NP_440299.1_1 Forward -131 -118 14.08 0.0259
NP_441799.1_1 Reverse -114 -128 16.6169 0.0138
NP_441799.1_1 Reverse -147 -161 8.16044 0.122
NP_441799.1_1 Forward -131 -117 4.42388 0.25
NP_441007.1_10 Reverse -113 -126 10.8357 0.0646
NP_441007.1_10 Reverse -146 -159 7.00078 0.152
NP_441007.1_10 Forward -132 -119 0.707601 0.219
NP_442333.2_1 Reverse -308 -327 -6.39206 0.255
NP_440256.1_1 Reverse -115 -134 13.2741 0.0103
NP_440256.1_1 Forward -130 -111 5.30933 0.0372
NP_440256.1_1 Forward -170 -151 -6.29373 0.207
NP_441559.1_8 Reverse -113 -127 1.37622 0.156
NP_440915.1_6 Forward -131 -117 13.5693 0.0187
NP_440915.1_6 Forward -164 -150 4.81781 0.0953
NP_440915.1_6 Reverse -114 -128 0.982901 0.148
NP_442785.1_7 Forward -249 -235 9.63603 0.247
NP_441866.1_6 Reverse -246 -265 6.39016 0.29
NP_441704.1_8 Forward -138 -119 5.2102 0.3
NP_442967.1_10 Forward -167 -153 15.609 0.237
NP_442866.1_1 Reverse -113 -132 -0.0988766 0.191
NP_442866.1_1 Reverse -146 -165 -4.81876 0.234
NP_441464.1_8 Reverse -310 -324 5.70279 0.253
NP_440695.1_5 Forward -127 -108 -0.295539 0.284
NP_441939.1_3 Reverse -119 -138 13.0775 0.0928
NP_441939.1_3 Forward -159 -140 9.83255 0.133
NP_441939.1_3 Reverse -152 -171 5.40766 0.276
NP_441494.1_6 Reverse -113 -126 5.72248 0.294
NP_442386.1_9 Forward -128 -119 13.8639 0.0289
NP_442386.1_9 Reverse -150 -159 11.9957 0.0754
NP_442386.1_9 Reverse -117 -126 6.39082 0.219
NP_442386.1_9 Forward -161 -152 5.9975 0.23
NP_441291.1_3 Forward -324 -305 15.2408 0.222
NP_441291.1_4 Forward -294 -275 16.4207 0.2
NP_441291.1_5 Forward -169 -150 17.3057 0.294
NP_441340.1_5 Forward -126 -119 15.6737 0.0124
NP_441340.1_5 Reverse -119 -126 15.6737 0.0124
NP_441340.1_5 Forward -159 -152 13.5105 0.0314
NP_441340.1_5 Reverse -152 -159 5.84064 0.208
NP_442484.1_2 Reverse -380 -399 -1.86883 0.3
NP_442240.1_2 Reverse -119 -138 -3.3438 0.0766
NP_442240.1_2 Reverse -152 -171 -14.4552 0.18
NP_442240.1_2 Forward -126 -107 -20.1584 0.295
NP_440586.1_8 Forward -126 -119 13.2151 0.026
NP_440586.1_8 Reverse -119 -126 13.2151 0.026
NP_440586.1_8 Reverse -152 -159 9.47853 0.146
NP_440586.1_8 Reverse -285 -292 7.51192 0.239
NP_440586.1_8 Forward -159 -152 5.74197 0.283
NP_442874.1_2 Reverse -295 -313 12.2122 0.216
NP_442251.1_6 Forward -126 -119 15.2804 0.0124
NP_442251.1_6 Reverse -119 -126 15.2804 0.0124
NP_441262.1_3 Reverse -118 -125 14.7888 0.0223
NP_441262.1_3 Forward -160 -153 14.7888 0.0223
NP_441262.1_3 Forward -127 -120 14.7888 0.0223
NP_440027.1_8 Forward -130 -111 7.86512 0.254
NP_443051.1_1 Reverse -117 -126 19.5676 0.00335
NP_443051.1_1 Forward -128 -119 10.4228 0.00754
NP_443051.1_1 Forward -161 -152 7.47288 0.0571
NP_443051.1_5 Forward -390 -371 13.7658 0.191
NP_441657.1_5 Reverse -114 -133 3.14605 0.142
NP_440408.1_7 Forward -127 -108 11.4058 0.224
NP_440439.1_1 Reverse -115 -128 10.934 0.0339
NP_440439.1_1 Forward -130 -117 -0.177378 0.209
NP_440372.1_2 Forward -126 -119 16.3621 0.0124
NP_440372.1_2 Reverse -119 -126 16.3621 0.0124
NP_440372.1_2 Forward -159 -152 13.8055 0.0214
NP_440372.1_2 Reverse -152 -159 6.52896 0.188
NP_440574.1_3 Reverse -113 -132 1.76941 0.179
NP_440316.1_10 Forward -161 -151 11.1898 0.214
NP_441803.1_2 Reverse -113 -132 6.4893 0.152
NP_439977.1_5 Reverse -112 -131 10.8159 0.0781
NP_441572.1_7 Reverse -112 -131 1.86774 0.142
NP_441572.1_7 Forward -133 -114 -2.36049 0.193
NP_440267.1_2 Reverse -113 -127 11.5037 0.125
NP_442384.1_10 Forward -127 -114 17.0305 0.0065
NP_442384.1_10 Reverse -118 -131 10.049 0.047
NP_442384.1_10 Forward -201 -188 2.87088 0.21
NP_442572.1_6 Reverse -223 -242 13.7658 0.229
NP_441018.1_7 Reverse -114 -133 14.0608 0.13
NP_441018.1_7 Reverse -280 -299 6.29264 0.294
NP_442262.1_10 Forward -126 -119 14.1988 0.0123
NP_442262.1_10 Reverse -119 -126 14.1988 0.0123
NP_442262.1_10 Reverse -152 -159 13.2155 0.0213
NP_441689.1_5 Forward -129 -119 15.3192 0.0403
NP_441689.1_5 Reverse -116 -126 8.3377 0.132
NP_441689.1_5 Forward -162 -152 5.97777 0.197
NP_441689.1_5 Forward -135 -125 5.28945 0.273
NP_440163.1_10 Forward -163 -153 15.2213 0.0762
NP_440163.1_10 Forward -130 -120 11.3864 0.169
NP_440531.1_6 Reverse -110 -129 -5.01543 0.291
NP_442910.1_6 Forward -20 -6 7.66941 0.24
NP_440562.1_3 Reverse -119 -136 7.11867 0.15
NP_440562.1_3 Forward -126 -109 3.87375 0.211
NP_441965.1_10 Forward -130 -114 16.5781 0.0438
NP_440297.1_9 Reverse -119 -129 9.32148 0.0917
NP_440297.1_9 Forward -126 -116 -0.216628 0.282
NP_440297.1_9 Reverse -152 -162 -0.511621 0.289
NP_440894.1_10 Reverse -146 -165 8.65258 0.175
NP_440894.1_10 Reverse -113 -132 4.22769 0.257
NP_440999.1_9 Reverse -114 -128 7.17775 0.0896
NP_440999.1_9 Forward -131 -117 1.76955 0.158
NP_440888.1_2 Reverse -118 -132 20.7467 0.000502
NP_440888.1_2 Reverse -151 -165 15.9285 0.00837
NP_440888.1_2 Forward -127 -113 12.2903 0.0476
NP_440888.1_2 Forward -21 -7 10.9137 0.0815
NP_440491.1_1 Forward -163 -144 7.50176 0.265
NP_441917.1_2 Forward -334 -316 5.52568 0.288
NP_441543.1_2 Reverse -119 -128 16.9127 0.00359
NP_441543.1_2 Forward -126 -117 15.9293 0.00518
NP_441543.1_2 Reverse -152 -161 8.65285 0.0968
NP_442845.1_2 Reverse -118 -132 7.9644 0.195
NP_442845.1_2 Forward -133 -119 6.3911 0.21
NP_442845.1_2 Forward -343 -329 6.09611 0.217
NP_442845.1_2 Reverse -112 -126 5.89945 0.22
NP_442845.1_2 Forward -61 -47 5.50613 0.231
NP_441469.1_8 Reverse -117 -126 6.5879 0.227
NP_441469.1_8 Forward -128 -119 6.48957 0.227
NP_441469.1_8 Forward -161 -152 6.39124 0.227
NP_443064.1_6 Reverse -118 -128 12.5669 0.0796
NP_443064.1_6 Forward -127 -117 10.8217 0.13
NP_443064.1_6 Forward -232 -222 9.3673 0.226
NP_442578.1_7 Forward -126 -119 14.5921 0.026
NP_442578.1_7 Reverse -119 -126 14.5921 0.026
NP_442578.1_7 Forward -159 -152 6.0373 0.18
NP_440220.1_4 Forward -366 -347 -2.95123 0.285
NP_441462.1_2 Forward -127 -117 20.2362 0.000805
NP_441462.1_2 Reverse -118 -128 11.5831 0.00406
NP_441462.1_2 Forward -160 -150 7.55152 0.0543
NP_441621.1_7 Forward -129 -115 -5.11362 0.248
NP_443062.1_1 Reverse -151 -169 16.7365 0.0296
NP_443062.1_1 Forward -187 -169 11.0811 0.105
NP_443062.1_1 Forward -127 -109 8.05839 0.16
NP_443062.1_1 Reverse -118 -136 5.13317 0.238
NP_443062.1_6 Forward -135 -116 3.83436 0.228
NP_441601.1_4 Reverse -296 -315 -5.70374 0.294
NP_441601.1_6 Reverse -294 -313 20.2556 0.0586
NP_442204.1_1 Reverse -114 -125 11.2684 0.0565
NP_442204.1_1 Forward -164 -153 0.353664 0.281
NP_442204.1_1 Forward -131 -120 0.353664 0.281
NP_440516.1_8 Forward -160 -151 18.9776 0.00442
NP_440516.1_8 Forward -127 -118 16.9127 0.00442
NP_440516.1_8 Reverse -118 -127 16.9127 0.00442
NP_440516.1_8 Reverse -151 -160 5.01461 0.118
NP_442428.1_4 Reverse -117 -136 3.73603 0.24
NP_442428.1_5 Forward -126 -119 15.8704 0.0124
NP_442428.1_5 Reverse -119 -126 15.8704 0.0124
NP_442428.1_5 Forward -159 -152 6.13563 0.209
NP_442428.1_5 Reverse -152 -159 6.0373 0.212
NP_440783.1_3 Forward -286 -267 2.75272 0.264
NP_440673.1_3 Forward -125 -118 12.4288 0.0426
NP_440673.1_3 Reverse -153 -160 12.4288 0.0426
NP_440673.1_3 Reverse -120 -127 12.4288 0.0426
NP_441052.1_2 Reverse -118 -128 19.9412 0.00106
NP_441052.1_2 Forward -127 -117 10.4031 0.0285
NP_441052.1_2 Forward -293 -283 5.38824 0.12
NP_441052.1_2 Reverse -151 -161 1.25834 0.249
NP_441052.1_2 Forward -160 -150 0.668351 0.256
NP_442219.1_9 Reverse -119 -128 17.7976 0.00718
NP_442219.1_9 Forward -159 -150 8.65285 0.0681
NP_442219.1_9 Forward -126 -117 8.25953 0.0681
NP_440436.1_4 Reverse -119 -128 17.2072 0.00233
NP_440436.1_4 Forward -126 -117 9.24241 0.0871
NP_440436.1_4 Reverse -152 -161 8.55409 0.0997
NP_440436.1_4 Reverse -193 -202 7.47246 0.129
NP_441884.1_9 Forward -163 -144 -13.8652 0.138
NP_441719.1_4 Forward -126 -119 16.3621 0.0124
NP_441719.1_4 Reverse -119 -126 16.3621 0.0124
NP_441719.1_4 Forward -159 -152 6.82395 0.0855
NP_441719.1_4 Reverse -152 -159 6.52896 0.188
NP_441733.1_10 Reverse -148 -161 5.52582 0.213
NP_441004.1_1 Forward -331 -312 -15.7335 0.277
NP_441004.1_1 Reverse -145 -164 -15.7335 0.277
NP_442813.1_4 Reverse -377 -396 -4.52377 0.299
NP_442366.1_3 Reverse -191 -209 0.412472 0.172
NP_442366.1_3 Forward -188 -170 -0.570838 0.194
NP_442366.1_3 Reverse -117 -135 -5.19239 0.284
NP_442366.1_5 Forward -302 -292 10.0093 0.292
NP_441115.1_4 Reverse -117 -135 15.8496 0.0339
NP_441115.1_4 Forward -128 -110 8.86816 0.234
NP_442206.1_10 Forward -127 -112 5.28977 0.178
NP_440328.1_4 Forward -133 -114 14.3558 0.0367
NP_443054.1_2 Reverse -116 -130 1.08123 0.251
NP_441851.1_9 Reverse -48 -67 7.86593 0.279
NP_441851.1_10 Forward -128 -118 15.8113 0.00552
NP_441851.1_10 Reverse -117 -127 8.53483 0.114
NP_442515.1_1 Forward -128 -114 4.32615 0.107
NP_440463.1_8 Reverse -304 -323 10.1138 0.23
NP_442709.1_3 Forward -134 -115 8.35759 0.121
NP_442689.1_8 Forward -269 -252 -7.04099 0.292
NP_441349.1_10 Reverse -108 -127 0.392778 0.0889
NP_441349.1_10 Forward -137 -118 -9.14533 0.284
NP_441409.1_6 Reverse -112 -131 1.67108 0.0586
NP_441409.1_6 Forward -133 -114 -8.65367 0.172
NP_440432.1_9 Reverse -119 -134 -4.05167 0.196
NP_440432.1_9 Forward -126 -111 -5.23164 0.241
NP_442843.1_1 Reverse -345 -364 -2.16383 0.203
NP_441477.1_10 Forward -134 -116 13.4905 0.181
NP_441124.1_5 Reverse -68 -78 12.6262 0.216
NP_441124.1_5 Reverse -248 -258 11.7668 0.245
NP_442450.1_5 Forward -129 -119 9.32148 0.115
NP_440588.1_2 Reverse -109 -128 5.01433 0.0729
NP_440195.1_4 Forward -172 -153 12.8808 0.127
NP_440195.1_4 Forward -139 -120 6.88262 0.269
NP_442335.1_7 Forward -200 -186 12.9786 0.261
NP_442006.1_2 Forward -314 -297 -17.4641 0.276
NP_443047.1_7 Forward -312 -293 4.03102 0.271
NP_442243.1_1 Reverse -112 -130 8.08151 0.176
NP_441570.1_1 Reverse -118 -136 -0.0791831 0.0433
NP_441078.1_4 Forward -127 -118 19.6659 0.0007
NP_441078.1_4 Reverse -118 -127 19.6659 0.0007
NP_441078.1_4 Forward -160 -151 0.196389 0.205
NP_441078.1_4 Reverse -151 -160 -0.000272808 0.205
NP_441078.1_4 Forward -247 -238 -1.47524 0.266
NP_442729.1_8 Forward -131 -118 8.47575 0.125
NP_440539.1_9 Forward -203 -184 -1.86883 0.286
NP_441663.1_8 Reverse -112 -131 -2.95047 0.276
NP_442348.1_2 Forward -271 -262 8.94785 0.28
NP_440707.1_6 Reverse -110 -129 10.7167 0.28
NP_440526.1_3 Reverse -119 -130 10.1862 0.0646
NP_441432.1_8 Reverse -117 -126 16.8143 0.00595
NP_441432.1_8 Forward -128 -119 16.8143 0.00595
NP_441432.1_8 Forward -161 -152 5.50626 0.151
NP_441432.1_9 Reverse -188 -201 8.11358 0.294
NP_441333.1_1 Reverse -28 -38 14.5451 0.217
NP_441333.1_1 Reverse -27 -37 13.3058 0.217
NP_442320.1_8 Forward -133 -119 12.291 0.0175
NP_442320.1_8 Forward -166 -152 3.8345 0.0578
NP_441732.1_2 Reverse -114 -130 -7.0213 0.0614
NP_441732.1_2 Forward -131 -115 -16.2644 0.165
NP_441732.1_2 Forward -164 -148 -16.4611 0.167
NP_440760.1_1 Reverse -118 -137 -12.6852 0.0945
NP_440760.1_1 Forward -160 -141 -14.2585 0.128
NP_440760.1_1 Forward -247 -228 -23.4033 0.297
NP_440199.1_10 Forward -130 -120 16.7946 0.0381
NP_440199.1_10 Forward -163 -153 14.533 0.0861
NP_442353.1_4 Forward -133 -114 1.86696 0.24
NP_440913.1_1 Reverse -116 -134 16.5388 0.0951
NP_442400.1_10 Forward -370 -357 13.0487 0.194
NP_442400.1_10 Forward -78 -65 9.51548 0.271
NP_440713.1_4 Reverse -42 -61 4.32602 0.231
NP_442489.1_7 Forward -127 -118 20.1576 0.000695
NP_442489.1_7 Reverse -118 -127 20.1576 0.000695
NP_442489.1_7 Forward -160 -151 0.688044 0.152
NP_442489.1_7 Reverse -151 -160 0.688044 0.152
NP_440559.1_1 Reverse -119 -128 17.4043 0.00658
NP_440559.1_1 Forward -126 -117 8.65285 0.0586
NP_440559.1_1 Forward -159 -150 6.48957 0.134
NP_441659.2_8 Forward -127 -117 20.9245 0.000805
NP_441659.2_8 Reverse -118 -128 18.1713 0.00133
NP_441659.2_8 Forward -60 -50 -0.314959 0.298
NP_440786.1_9 Forward -40 -21 13.8641 0.283
NP_442749.1_5 Reverse -184 -201 9.6698 0.198
NP_442913.1_9 Forward -20 -1 7.66927 0.281
NP_442913.1_10 Forward -136 -117 0.294447 0.155
NP_440336.1_4 Forward -171 -152 10.815 0.296
NP_441040.1_2 Reverse -149 -168 -15.2418 0.286
NP_442346.1_5 Forward -128 -118 16.6963 0.00248
NP_442346.1_5 Reverse -117 -127 16.303 0.00248
NP_440352.1_5 Forward -125 -106 11.9744 0.249
NP_440545.1_3 Forward -131 -114 4.3654 0.0717
NP_440545.1_3 Forward -320 -303 1.71047 0.114
NP_440545.1_3 Forward -64 -47 -1.63279 0.171
NP_441856.1_3 Forward -130 -111 18.4857 0.0269
NP_440459.1_2 Reverse -116 -133 13.3135 0.131
NP_440459.1_2 Forward -136 -119 9.28195 0.23
NP_440459.1_2 Reverse -149 -166 8.49531 0.259
NP_440459.1_2 Forward -162 -145 8.20031 0.267
NP_440459.1_2 Reverse -4 -21 8.10198 0.27
NP_441653.1_2 Forward -171 -152 13.193 0.0959
NP_441653.1_2 Forward -138 -119 5.46229 0.245
NP_440010.1_3 Reverse -146 -165 -6.88371 0.26
NP_440010.1_4 Reverse -280 -299 9.7334 0.169
NP_440010.1_10 Reverse -281 -300 5.11266 0.238
NP_440010.1_10 Reverse -223 -242 4.22769 0.246
NP_441943.1_5 Reverse -241 -260 15.0305 0.265
NP_442603.1_7 Forward -160 -146 19.1735 0.0119
NP_442603.1_7 Reverse -118 -132 13.6669 0.0819
NP_442603.1_7 Forward -127 -113 7.66879 0.198
NP_440170.1_6 Reverse -113 -132 17.7974 0.103
NP_441833.1_4 Forward -126 -119 15.9687 0.0124
NP_441833.1_4 Reverse -119 -126 15.9687 0.0124
NP_441833.1_4 Reverse -152 -159 6.52896 0.0924
NP_441833.1_4 Forward -159 -152 6.23397 0.163
NP_442699.1_3 Reverse -139 -158 6.4893 0.136
NP_442162.1_9 Forward -126 -119 16.2637 0.0124
NP_442162.1_9 Reverse -119 -126 16.2637 0.0124
NP_442162.1_9 Forward -159 -152 12.9205 0.0282
NP_442162.1_9 Reverse -152 -159 12.9205 0.0282
NP_440671.1_4 Forward -166 -152 17.1092 0.0237
NP_440671.1_4 Forward -133 -119 16.4209 0.0288
NP_440224.1_1 Forward -138 -119 0.884433 0.132
NP_440224.1_1 Reverse -107 -126 -0.39387 0.141
NP_442558.1_9 Reverse -347 -366 19.469 0.0782
NP_442199.1_5 Reverse -110 -129 -1.57384 0.181
NP_442199.1_7 Forward -87 -68 1.96529 0.269
NP_442140.1_3 Reverse -152 -162 6.27322 0.176
NP_442140.1_3 Forward -159 -149 6.07655 0.184
NP_442140.1_3 Forward -126 -116 4.69992 0.238
NP_442140.1_3 Reverse -119 -129 4.40493 0.243
NP_441609.1_1 Reverse -355 -374 -2.16383 0.282
NP_441696.1_6 Forward -246 -227 -0.000545616 0.294
NP_440875.1_9 Forward -125 -115 16.5483 0.0145
NP_440875.1_9 Reverse -153 -163 8.37203 0.233
NP_441813.1_5 Reverse -116 -126 18.1713 0.00743
NP_441813.1_5 Forward -129 -119 15.9097 0.01
NP_441813.1_5 Forward -162 -152 7.45319 0.0746
NP_441813.1_5 Reverse -149 -159 5.5849 0.118
NP_440594.1_3 Reverse -151 -169 14.2771 0.236
NP_442886.1_1 Reverse -330 -344 17.9942 0.259
NP_440590.1_4 Reverse -119 -132 12.409 0.0141
NP_440590.1_4 Reverse -152 -165 3.46087 0.0735
NP_440590.1_4 Forward -159 -146 -0.37404 0.186
NP_440590.1_4 Forward -126 -113 -5.29059 0.277
NP_440567.1_1 Forward -126 -112 8.16106 0.0609
NP_440567.1_1 Reverse -119 -133 5.30946 0.104
NP_442497.1_10 Forward -126 -117 17.601 0.00813
NP_442497.1_10 Reverse -119 -128 10.4228 0.0087
NP_442497.1_10 Reverse -152 -161 0.589713 0.153
NP_440821.1_4 Forward -129 -119 18.2696 0.00448
NP_440821.1_4 Forward -162 -152 9.32148 0.03
NP_440821.1_4 Reverse -149 -159 5.78156 0.106
NP_440821.1_4 Reverse -116 -126 2.24165 0.131
NP_441239.1_9 Reverse -116 -128 13.0187 0.0389
NP_441239.1_9 Reverse -149 -161 8.10212 0.142
NP_441239.1_9 Reverse -342 -354 6.43049 0.189
NP_441239.1_9 Forward -57 -45 4.8572 0.239
NP_441239.1_9 Forward -129 -117 4.36554 0.253
NP_440542.1_8 Reverse -68 -81 16.3422 0.288
NP_440604.1_6 Forward -127 -108 -4.13045 0.24
NP_440833.1_6 Forward -373 -359 12.782 0.18
NP_440354.1_7 Reverse -186 -204 14.1788 0.171
NP_442138.1_9 Forward -173 -154 11.6017 0.202
NP_440546.1_4 Forward -127 -117 13.5365 0.0459
NP_440546.1_4 Forward -160 -150 12.1791 0.0679
NP_440546.1_4 Reverse -118 -128 10.046 0.109
NP_440546.1_4 Forward -55 -45 6.94336 0.269
NP_440546.1_4 Reverse -151 -161 6.55553 0.291
NP_440462.1_6 Reverse -116 -126 18.7612 0.00454
NP_440462.1_6 Forward -129 -119 7.74818 0.0699
NP_440462.1_6 Reverse -149 -159 6.37155 0.118
NP_440462.1_6 Forward -162 -152 5.87989 0.135
NP_440868.1_4 Reverse -114 -126 17.0502 0.0124
NP_440868.1_4 Reverse -147 -159 1.31728 0.186
NP_440868.1_4 Forward -164 -152 -0.846001 0.282
NP_440868.1_4 Forward -131 -119 -0.846001 0.282
NP_441204.1_1 Forward -70 -51 7.86593 0.25
NP_441249.1_3 Reverse -149 -168 0.687771 0.285
NP_442402.1_4 Reverse -377 -396 0.588665 0.182
NP_442402.1_4 Reverse -376 -395 -4.81951 0.231
NP_442402.1_4 Reverse -122 -141 -5.99948 0.249
NP_441084.1_6 Forward -169 -155 12.8346 0.152
NP_441084.1_6 Reverse -116 -130 11.0893 0.218
NP_440653.1_10 Reverse -172 -191 5.01433 0.236
NP_440696.1_3 Reverse -147 -165 -3.22577 0.284
NP_441843.2_9 Forward -125 -107 9.22762 0.297
NP_442039.1_4 Forward -126 -119 15.1821 0.0124
NP_442039.1_4 Reverse -119 -126 15.1821 0.0124
NP_442039.1_4 Forward -159 -152 11.6422 0.0747
NP_442837.1_3 Forward -126 -119 15.7721 0.0124
NP_442837.1_3 Reverse -119 -126 15.7721 0.0124
NP_442837.1_3 Forward -159 -152 6.0373 0.25
NP_442837.1_3 Reverse -152 -159 6.0373 0.25
NP_440160.1_9 Forward -127 -108 9.73422 0.235
NP_439994.1_3 Reverse -117 -136 9.41407 0.253
NP_442053.1_1 Forward -127 -118 18.3876 0.0007
NP_442053.1_1 Reverse -118 -127 18.3876 0.0007
NP_442053.1_1 Reverse -151 -160 14.4544 0.0114
NP_442053.1_1 Forward -160 -151 7.86621 0.0863
NP_440505.1_3 Reverse -116 -126 17.188 0.00332
NP_440505.1_3 Forward -129 -119 16.303 0.00696
NP_440505.1_3 Forward -162 -152 12.2714 0.0543
NP_440505.1_3 Reverse -236 -246 5.87989 0.206
NP_441959.1_1 Forward -371 -353 18.1112 0.17
NP_441102.1_2 Forward -388 -369 6.39097 0.298
NP_440914.1_1 Reverse -118 -128 17.5935 0.000537
NP_440914.1_1 Forward -127 -117 16.3248 0.00196
NP_440914.1_1 Forward -160 -150 12.1284 0.0654
NP_440914.1_1 Forward -201 -191 10.3717 0.142
NP_440914.1_1 Forward -133 -123 9.98138 0.164
NP_441011.1_8 Forward -126 -117 16.6177 0.00602
NP_441011.1_8 Reverse -119 -128 8.25953 0.144
NP_441011.1_8 Reverse -152 -161 7.07956 0.179
NP_442101.1_10 Reverse -110 -129 -13.2752 0.288
NP_442533.1_6 Forward -127 -118 17.2076 0.00137
NP_442533.1_6 Reverse -118 -127 17.2076 0.00137
NP_442533.1_6 Reverse -151 -160 4.42462 0.179
NP_442541.1_10 Forward -22 -8 19.1735 0.182
NP_440263.1_5 Reverse -356 -370 7.76774 0.294
NP_441482.1_7 Forward -133 -119 0.786239 0.0554
NP_441482.1_7 Reverse -112 -126 -2.95034 0.103
NP_441482.1_7 Forward -166 -152 -8.94853 0.193
NP_441482.1_7 Reverse -46 -60 -10.7185 0.213
NP_439944.1_9 Reverse -119 -129 19.0562 0.00329
NP_439944.1_9 Forward -126 -116 9.12481 0.1
NP_440116.1_8 Forward -159 -140 -5.01543 0.186
NP_440116.1_8 Reverse -119 -138 -9.44032 0.278
NP_440115.1_6 Reverse -115 -125 14.0414 0.0615
NP_440115.1_6 Reverse -281 -291 5.68323 0.227
NP_440007.1_9 Forward -131 -117 10.9143 0.163
NP_440007.1_9 Forward -164 -150 9.43936 0.171
NP_440007.1_9 Reverse -114 -128 6.98109 0.213
NP_441347.1_5 Reverse -112 -126 10.422 0.269
NP_442492.1_2 Reverse -158 -177 0.196116 0.241
NP_441106.1_1 Reverse -117 -126 18.486 0.0028
NP_441106.1_1 Forward -128 -119 9.63616 0.0311
NP_441106.1_1 Forward -161 -152 8.45619 0.0548
NP_441106.1_1 Reverse -177 -186 2.26134 0.293
NP_441825.1_4 Forward -271 -261 13.353 0.249
NP_441869.1_2 Reverse -111 -130 9.24257 0.284
NP_439903.1_6 Reverse -115 -134 10.2251 0.111
NP_441286.1_1 Reverse -117 -129 11.937 0.0108
NP_441286.1_1 Forward -128 -116 5.93884 0.0258
NP_441286.1_1 Forward -161 -149 1.7106 0.0803
NP_441286.1_1 Reverse -150 -162 -4.58258 0.165
NP_440670.1_8 Forward -127 -118 18.3876 0.000699
NP_440670.1_8 Reverse -118 -127 18.3876 0.000699
NP_440670.1_8 Forward -160 -151 8.75118 0.0606
NP_440670.1_8 Reverse -151 -160 6.19458 0.124
NP_440886.1_7 Reverse -117 -127 8.04271 0.0805
NP_440886.1_7 Forward -128 -118 7.94438 0.0805
NP_440886.1_7 Forward -161 -151 6.86274 0.113
NP_440886.1_7 Reverse -150 -160 6.66608 0.115
NP_440886.1_7 Reverse -313 -323 4.7978 0.218
NP_442614.1_2 Forward -316 -302 11.2093 0.206
NP_442614.1_2 Forward -127 -113 10.1277 0.234
NP_442614.1_2 Forward -160 -146 9.34103 0.242
NP_442614.1_2 Reverse -118 -132 5.89945 0.296
NP_442717.1_2 Reverse -345 -364 5.11266 0.151
NP_442072.1_9 Reverse -117 -135 5.32902 0.0167
NP_442072.1_9 Reverse -150 -168 -6.27403 0.0747
NP_442072.1_9 Forward -128 -110 -20.7287 0.204
NP_442072.1_9 Forward -161 -143 -22.6953 0.253
NP_441753.1_10 Forward -169 -150 2.75272 0.227
NP_440907.2_8 Forward -126 -116 9.616 0.103
NP_440907.2_8 Reverse -152 -162 6.0761 0.179
NP_441463.1_3 Reverse -108 -127 -10.3253 0.293
NP_441626.1_2 Forward -126 -119 15.7721 0.0124
NP_441626.1_2 Reverse -119 -126 15.7721 0.0124
NP_441626.1_2 Forward -159 -152 12.2322 0.0511
NP_441626.1_2 Reverse -152 -159 5.93897 0.231
NP_442238.1_7 Reverse -62 -81 18.0915 0.139
NP_442794.1_1 Forward -131 -119 10.1671 0.0721
NP_442615.1_1 Reverse -109 -127 13.8838 0.0109
NP_442615.1_1 Forward -136 -118 -5.58572 0.217
NP_440387.1_1 Reverse -118 -134 4.28677 0.0441
NP_441431.1_2 Reverse -115 -129 6.58715 0.266
NP_441993.1_1 Reverse -118 -137 5.84498 0.194
NP_441993.1_1 Forward -133 -114 3.40855 0.235
NP_440467.1_3 Reverse -107 -126 12.8188 0.214
NP_440114.1_10 Forward -201 -187 10.521 0.146
NP_440114.1_10 Forward -127 -113 9.73436 0.164
NP_440114.1_10 Forward -69 -55 7.76774 0.227
NP_440114.1_10 Forward -55 -41 6.58777 0.263
NP_442323.1_7 Reverse -113 -132 8.4551 0.163
NP_442323.1_7 Forward -132 -113 2.06362 0.273
NP_441510.2_7 Forward -166 -152 16.5185 0.226
NP_441510.2_7 Forward -133 -119 11.2087 0.28
NP_440287.1_6 Forward -136 -117 4.42435 0.204
NP_440293.1_3 Forward -312 -293 -1.86883 0.239
NP_440293.1_3 Reverse -44 -63 -6.78538 0.293
NP_440766.1_4 Forward -164 -150 12.6843 0.047
NP_440766.1_4 Forward -131 -117 8.16106 0.0871
NP_439988.1_3 Reverse -47 -61 7.37441 0.277
NP_441237.1_9 Forward -159 -149 11.7798 0.156
NP_439910.1_2 Forward -135 -118 -4.28772 0.0697
NP_439910.1_2 Forward -168 -151 -13.9242 0.171
NP_439910.1_2 Forward -36 -19 -14.6125 0.183
NP_439910.1_2 Forward -209 -192 -22.0856 0.207
NP_442867.1_8 Forward -20 -1 3.73603 0.297
NP_440457.1_1 Forward -164 -152 9.28209 0.0929
NP_440457.1_1 Forward -131 -119 7.02048 0.105
NP_440457.1_1 Reverse -114 -126 0.628964 0.25
NP_440457.1_1 Forward -330 -318 0.333971 0.25
NP_440798.1_6 Forward -126 -113 2.08423 0.186
NP_441984.1_3 Reverse -114 -132 13.4905 0.153
NP_441984.1_3 Forward -65 -47 6.41066 0.269
NP_441984.1_6 Forward -158 -146 14.297 0.258
NP_441436.1_8 Forward -128 -109 7.57094 0.293
NP_442509.1_9 Reverse -151 -161 9.71433 0.192
NP_442509.1_9 Reverse -118 -128 8.14104 0.192
NP_442509.1_9 Forward -127 -117 8.04271 0.192
NP_441489.1_3 Forward -267 -253 10.1338 0.232
NP_443037.1_9 Reverse -134 -153 15.0315 0.166
NP_440554.1_4 Forward -126 -116 17.9746 0.0131
NP_440554.1_4 Reverse -152 -162 11.6814 0.0377
NP_440554.1_4 Reverse -119 -129 7.05986 0.106
NP_442862.1_3 Reverse -355 -372 5.9387 0.267
NP_441885.1_5 Reverse -118 -128 20.9245 0.000538
NP_441885.1_5 Forward -127 -117 11.3864 0.00668
NP_441885.1_5 Forward -160 -150 9.51814 0.0206
NP_441885.1_5 Forward -247 -237 0.373358 0.164
NP_442341.1_7 Reverse -150 -164 9.93102 0.0692
NP_442341.1_7 Reverse -117 -131 9.63603 0.0726
NP_442341.1_7 Forward -161 -147 2.75286 0.247
NP_442341.1_9 Reverse -116 -130 19.8618 0.00907
NP_441173.1_9 Reverse -258 -266 9.85212 0.275
NP_443000.1_7 Reverse -116 -126 20.3345 0.00223
NP_443000.1_7 Forward -129 -119 17.0896 0.00865
NP_440275.1_3 Reverse -116 -126 16.1063 0.0155
NP_440275.1_3 Forward -129 -119 8.1415 0.0602
NP_440275.1_3 Forward -162 -152 5.87989 0.13
NP_440091.1_1 Forward -131 -119 8.88877 0.0567
NP_440091.1_1 Forward -164 -152 1.02229 0.218
NP_442354.1_2 Reverse -279 -298 1.27776 0.299
NP_440679.1_10 Reverse -280 -299 -11.2103 0.182
NP_439962.1_4 Forward -22 -3 -8.45701 0.294
NP_442495.1_4 Forward -123 -113 12.3697 0.229
NP_440149.1_8 Reverse -118 -137 -1.7705 0.162
NP_440149.1_8 Reverse -278 -297 -4.03212 0.201
NP_441105.1_3 Forward -138 -119 -6.39206 0.234
NP_441105.1_3 Reverse -107 -126 -6.49039 0.236
NP_441105.1_3 Reverse -113 -132 -7.96535 0.263
NP_440216.1_1 Forward -127 -113 17.1092 0.00188
NP_440216.1_1 Reverse -118 -132 0.0979218 0.0284
NP_440216.1_1 Reverse -151 -165 -3.83532 0.09
NP_440172.1_1 Forward -127 -117 17.5813 0.00421
NP_440172.1_1 Reverse -118 -128 15.0247 0.00945
NP_440172.1_1 Forward -160 -150 6.27322 0.107
NP_442015.1_10 Forward -131 -118 10.344 0.0391
NP_442015.1_10 Reverse -114 -127 3.65753 0.178
NP_441226.1_7 Forward -126 -119 14.4934 0.0123
NP_441226.1_7 Reverse -119 -126 14.4934 0.0123
NP_441226.1_7 Forward -159 -152 12.7234 0.0312
NP_441226.1_7 Reverse -152 -159 11.5435 0.0757
NP_441111.1_7 Forward -126 -118 18.7023 0.00294
NP_441111.1_7 Reverse -119 -127 18.7023 0.00294
NP_441111.1_7 Reverse -152 -160 8.86921 0.0589
NP_442379.1_10 Forward -134 -117 5.64371 0.128
NP_441766.1_2 Forward -127 -118 17.5026 0.00297
NP_441766.1_2 Reverse -118 -127 17.5026 0.00297
NP_441766.1_2 Reverse -151 -160 14.7494 0.00772
NP_442417.1_5 Reverse -151 -165 10.6193 0.11
NP_442417.1_5 Forward -127 -113 4.62115 0.292
NP_440416.1_9 Forward -134 -115 -8.16202 0.111
NP_443052.1_9 Reverse -312 -331 -2.26216 0.235
NP_442116.1_2 Forward -203 -184 20.8447 0.0996
NP_440261.1_5 Forward -126 -113 16.1456 0.0132
NP_440261.1_5 Reverse -119 -132 -10.5021 0.201
NP_440261.1_5 Forward -159 -146 -10.9938 0.23
NP_440261.1_5 Forward -315 -302 -12.0754 0.27
NP_440988.1_10 Forward -129 -115 5.38289 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGTGCCGGTGAAAAAGATGGGGATATTCTCAAACTAGCCCAAAATTTGGCCAGTTCGGGTTTTCGGGATACCAGTCGGGTGGGAGGCGGCAACCCGGAGTTGGGCACCATGATGGCCACCTATAACCAACGGGCTTTGCTAAAAAGTTTGCAAGACTATCGTCAGCACCTGGATCAGCTAATTACCCTAATTAGTAACCAACAATGGCCTGAACTCCATCGTCTTTTACAACAAACCAACGGCGATCGGGACAAGTATGTTGAATAAACCAATGGCGATCGCCTGGAGAATAAATTTAGGAGACTAGACATTGATCCAGAACAAATTTAGGAACAATGGGGCCCACGGCATGGCTTTCTGTTAAAAATAAACAAGCACTGCCCTTTCCCGCTCAGAGCGC

CDS

ATGACTAACCAGCCCACCGCATCGGTTCCCTTTCAACGCCCCTGGCACGACTATCTCAAATTCAGCACCGATCACAAAGTCATTGGCATTCAATATTTACTGATGTCCTTCTGCTTCTTCTTAGTGGCGGGATTATTGGCCATGATTATCCGGGCAGAATTACTCACCCCCCAATTGGACGTGGTGGACCGTAGCCTCTACAACGGTCTATTTACCCTCCACGGCACCATCATGATTTTCCTCTGGATTTTTCCAGCCAATGTGGGGTTAGCCAATTACTTAATTCCCCTGATGATTGGTGCCAGGGACGTAGCCTTTCCGGTATTGAATGCGATCGCCTTTTGGCTAATGCCAGTGGTGGGAGTGTTATTGATTGGTAGCTTTTTTCTACCCACAGGGACGGCCCAGGCGGGCTGGTGGTCCTATCCTCCAGTAAGCATTCAAAATCCGTCGGGTAATTTCATCAATGGCGAATTTCTTTGGCTTTTGGCAGTGGCCACTTCCGGCATTTCTTCCATTATGGGGGGGGTTAACTTTGTCACCACCGTTTGGAAATTGCGGGCACCGGGGCTAACCCTGTTAAAAATGCCCGTTTACGTCTGGACAATTTTAAGCGCCCAAATTTTGCAACTCTTTTGTCTGCCAGCGTTGACCGGCGGGGCGGTGATGTTGCTGTTTGACCTTTCCTTTGGCACCACCTTTTTTGACCCCTTTAATCAGGGCAACCCAATTATTTACCAACATTTATTTTGGTTCTATTCCCACCCGGCCGTCTACGTCATGGCTTTGCCTGCCTTTGGCGTATTTTCGGAAATATTGCCGGTTTTTGCCCGTAAACCGCTTTTTGGCTACAAAACTGTCGCTATTTCTTCTTTTCTCATTGCTATCCAAGGCACCTTCGTCTGGGTACACCATATGTTTACCAGTGCTACCCCCAACTGGATGCGAATGTTTTTCATGGCTAGCACCATGCTCATCGCTGTGCCTACGGGCATCAAAGTTTTAGCCTGGACAGCAACGGTGTGGCGGGGTAGTTTGCGACTGAAAACCCCCATGTTGTTTTGCCTGGGGGGAATTTTAATGTTTCTATTTGCCGGCATCACGGGCATTATGTTAGCTTCTGCCCCCTTCGATTTGCACGTCAATAACACCTATTTTGTGGTGGGGCATTTCCATTACGTGGTCTTTGGCACCGTGACCATGGCCATTTACGGGGCAATTTATTTCTGGTTTCCGAAAATGACTGGGCGCATGTATAACGAAGCCTGGGGCAAACTCCATTTTGCGTTGACTTTTATTGGCGCTAATTTAAACTTTTTCCCCATGCATCCCATTGGGCTACAGGGCATGTTGCGGCGCATTTCTTCCTACGACCCGGAATACACGGCCTGGAATGTGGTGGCCAGTTTGGGGGCGTTCCTGCTGGGCATGTCTACTTTACCGTTCATTGCCAATATGGTGGCCTCGGCTTTCCAAGGCCGTCGGGTGGGTAATAATCCCTGGAATTCTTTGGGCTTGGAGTGGACCACACCTTCACCGCCACCGGAGGAAAATTTTGAAGTTATTCCTACCATTACAGTGGAACCCTATGGCTATGATCGCCCGGTGGATTTGACCACCGAAGTAACCACATAG

Protein

MTNQPTASVPFQRPWHDYLKFSTDHKVIGIQYLLMSFCFFLVAGLLAMIIRAELLTPQLDVVDRSLYNGLFTLHGTIMIFLWIFPANVGLANYLIPLMIGARDVAFPVLNAIAFWLMPVVGVLLIGSFFLPTGTAQAGWWSYPPVSIQNPSGNFINGEFLWLLAVATSGISSIMGGVNFVTTVWKLRAPGLTLLKMPVYVWTILSAQILQLFCLPALTGGAVMLLFDLSFGTTFFDPFNQGNPIIYQHLFWFYSHPAVYVMALPAFGVFSEILPVFARKPLFGYKTVAISSFLIAIQGTFVWVHHMFTSATPNWMRMFFMASTMLIAVPTGIKVLAWTATVWRGSLRLKTPMLFCLGGILMFLFAGITGIMLASAPFDLHVNNTYFVVGHFHYVVFGTVTMAIYGAIYFWFPKMTGRMYNEAWGKLHFALTFIGANLNFFPMHPIGLQGMLRRISSYDPEYTAWNVVASLGAFLLGMSTLPFIANMVASAFQGRRVGNNPWNSLGLEWTTPSPPPEENFEVIPTITVEPYGYDRPVDLTTEVTT