Your browser is old and dusty. Try Google Chrome!

Details for slr2080

ORF slr2080
Accession NP_441289.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_1 Forward -221 -202 13.5117 0.146
NP_440897.1_6 Forward -92 -73 -0.689632 0.185
NP_441818.1_9 Reverse -77 -96 -10.9153 0.299
NP_442752.1_4 Reverse -378 -385 9.47889 0.109
NP_440061.1_9 Forward -389 -375 5.50552 0.283
NP_442972.1_2 Reverse -301 -315 16.5185 0.136
NP_441434.1_1 Forward -161 -147 13.476 0.233
NP_441025.1_6 Reverse -212 -231 3.64276 0.24
NP_443013.1_9 Reverse -372 -391 8.94757 0.285
NP_440747.1_10 Forward -390 -378 -12.3507 0.27
NP_442973.1_8 Reverse -56 -74 13.5888 0.254
NP_442530.1_2 Reverse -211 -221 11.9764 0.282
NP_441317.1_4 Reverse -96 -110 13.2836 0.181
NP_442816.1_1 Reverse -378 -397 18.0915 0.296
NP_442690.1_1 Reverse -202 -221 -1.27885 0.128
NP_442690.1_1 Reverse -258 -277 -5.31042 0.157
NP_442690.1_1 Reverse -321 -340 -11.7019 0.232
NP_442690.1_1 Reverse -20 -39 -17.2085 0.298
NP_441654.1_5 Reverse -87 -106 14.3296 0.252
NP_442013.1_7 Reverse -181 -200 13.6675 0.274
NP_440147.1_4 Reverse -66 -79 1.88757 0.216
NP_440569.1_10 Forward -222 -203 6.44528 0.234
NP_442941.1_2 Forward -194 -175 12.8432 0.292
NP_441514.1_1 Reverse -277 -287 17.0188 0.274
NP_441264.1_10 Forward -388 -374 18.9775 0.065
NP_441865.1_3 Forward -50 -32 12.7038 0.287
NP_442338.1_3 Reverse -245 -264 16.6585 0.266
NP_441764.1_8 Forward -107 -97 13.6076 0.284
NP_442719.1_2 Forward -365 -347 -0.964891 0.175
NP_443058.1_7 Forward -71 -52 3.73603 0.26
NP_441101.1_10 Forward -391 -372 -7.57203 0.29
NP_441518.1_3 Forward -96 -77 -15.0452 0.286
NP_441036.1_8 Forward -177 -167 5.68323 0.265
NP_441458.1_8 Reverse -253 -272 3.34933 0.273
NP_441799.1_1 Forward -359 -345 4.8172 0.236
NP_441007.1_10 Reverse -196 -209 -1.06236 0.3
NP_441559.1_8 Reverse -373 -387 0.687908 0.163
NP_442860.1_7 Forward -342 -324 9.18982 0.283
NP_440695.1_6 Reverse -153 -167 14.6775 0.213
NP_442386.1_10 Reverse -371 -384 4.64084 0.262
NP_440161.1_3 Forward -79 -60 12.2908 0.185
NP_441027.1_1 Forward -266 -252 12.0937 0.27
NP_442959.1_5 Reverse -30 -49 12.2908 0.222
NP_441877.1_9 Reverse -130 -147 4.6604 0.284
NP_441060.1_4 Forward -88 -70 6.70565 0.222
NP_440297.1_9 Forward -381 -371 -0.0199663 0.282
NP_440937.1_5 Reverse -5 -24 18.289 0.249
NP_442067.1_4 Forward -393 -374 6.09597 0.226
NP_442454.1_2 Forward -276 -257 10.8379 0.259
NP_440792.1_1 Forward -85 -66 6.98095 0.215
NP_443064.1_6 Forward -387 -377 9.94905 0.187
NP_440148.1_1 Forward -103 -84 -5.70374 0.235
NP_442286.1_2 Reverse -246 -264 17.2271 0.0895
NP_443062.1_1 Reverse -77 -95 10.7886 0.11
NP_440519.1_8 Forward -64 -48 2.8118 0.256
NP_442823.1_9 Forward -365 -346 19.1824 0.164
NP_442086.1_6 Forward -77 -58 11.8975 0.255
NP_440296.1_6 Reverse -249 -267 14.1348 0.291
NP_441195.1_1 Forward -88 -69 1.96607 0.168
NP_442622.1_1 Forward -392 -373 -13.0786 0.282
NP_441289.1_1 Forward -77 -63 21.3374 0.0391
NP_442709.1_3 Forward -394 -375 2.94938 0.288
NP_442709.1_4 Forward -251 -232 3.93054 0.285
NP_442689.1_4 Forward -297 -278 11.2092 0.112
NP_442689.1_8 Reverse -325 -342 3.0871 0.18
NP_442689.1_8 Reverse -262 -279 1.61214 0.191
NP_442689.1_8 Reverse -206 -223 -1.53445 0.216
NP_442843.1_1 Forward -85 -66 -8.94866 0.264
NP_442843.1_1 Forward -76 -57 -9.047 0.264
NP_440040.1_8 Forward -113 -94 4.34446 0.264
NP_440943.1_1 Reverse -86 -105 8.75091 0.29
NP_441432.1_2 Forward -214 -200 19.8624 0.251
NP_441057.1_10 Forward -353 -334 12.2908 0.277
NP_440386.1_3 Forward -366 -347 -5.11376 0.241
NP_440335.1_9 Forward -105 -87 8.96727 0.298
NP_440352.1_5 Forward -90 -71 11.001 0.267
NP_443040.1_1 Forward -274 -260 13.9526 0.276
NP_441329.1_1 Reverse -139 -158 10.9334 0.194
NP_441329.1_6 Forward -104 -85 -1.57604 0.293
NP_440912.1_3 Reverse -257 -276 9.83173 0.26
NP_442943.1_1 Forward -231 -216 3.67984 0.26
NP_440772.1_6 Forward -85 -66 9.43923 0.277
NP_441609.1_5 Reverse -85 -104 8.45592 0.279
NP_442028.1_1 Reverse -97 -110 9.61097 0.251
NP_441239.1_9 Forward -384 -372 13.3137 0.037
NP_441769.1_3 Forward -151 -132 -7.27777 0.293
NP_441541.1_1 Reverse -97 -115 -2.00335 0.25
NP_441541.1_1 Reverse -18 -36 -2.38531 0.264
NP_440374.1_3 Reverse -271 -289 19.5778 0.0996
NP_442402.1_2 Forward -40 -26 12.3887 0.271
NP_441848.1_4 Forward -277 -261 8.98304 0.288
NP_441102.1_2 Forward -302 -283 7.57094 0.298
NP_442971.1_3 Reverse -374 -393 15.7324 0.167
NP_442532.1_4 Reverse -85 -103 10.195 0.271
NP_442322.1_2 Reverse -50 -69 13.5683 0.229
NP_440816.1_2 Reverse -275 -294 9.72659 0.218
NP_441527.1_4 Forward -104 -85 -7.68752 0.236
NP_441527.1_4 Forward -108 -89 -8.64244 0.248
NP_441106.1_3 Reverse -129 -148 11.7008 0.217
NP_442674.1_2 Reverse -266 -285 10.4225 0.208
NP_442020.1_1 Forward -102 -83 -0.29631 0.272
NP_441174.1_2 Forward -80 -66 11.996 0.27
NP_440358.1_8 Forward -167 -148 -1.37718 0.274
NP_442090.1_3 Reverse -249 -268 13.3448 0.212
NP_442357.1_8 Forward -105 -86 12.9791 0.241
NP_442324.1_7 Forward -80 -61 5.85867 0.268
NP_441500.1_8 Reverse -181 -195 13.5668 0.297
NP_442930.1_1 Forward -93 -83 10.4026 0.276
NP_441496.1_1 Forward -166 -152 14.3354 0.265
NP_443037.1_7 Forward -82 -63 -10.522 0.276
NP_442862.1_3 Forward -78 -61 7.70866 0.253
NP_441756.1_5 Forward -391 -372 -3.14714 0.288
NP_441173.1_9 Forward -114 -106 11.8187 0.222
NP_441173.1_9 Forward -35 -27 10.6388 0.261
NP_441173.1_9 Forward -217 -209 9.85212 0.275
NP_442638.1_3 Forward -82 -63 12.3658 0.298
NP_441207.1_7 Reverse -358 -372 7.99683 0.293
NP_440258.1_7 Forward -157 -138 12.9387 0.287
NP_440258.1_8 Reverse -110 -129 16.7149 0.129
NP_440804.1_7 Forward -286 -269 7.70792 0.261
NP_440172.1_1 Reverse -68 -78 1.94665 0.29
NP_440305.1_1 Forward -102 -88 15.0993 0.182
NP_440244.1_8 Reverse -213 -232 8.94757 0.158
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGAAGGAAACCCTGTGGCTCCCCTGGCACTATTAGAGTTTTTGGCAGAGTTCACCTCTAGAAATTAAAGAAACAGTCATGTCTGATTTAGCCTTGTTTGATATTGGAAACGTTATAATTTGGCTAATTAAAACAATAATAATTTGCCAAACAAATGCTCGTGAGGTTTTAAATGGTTACAACTTTTAGCAAACCATCTTCTCTAGTTCATGAAATTCATCTAGAAAAGGTCGGTAGCTGGAATTTATTCAAGTTTAATGAATCCTTACAATTACGAATGGAAGATCTTTTACAAAAGAAAAAATCCGACAAAATTACCATCGAAGAAATTGCTGAATTGGATGCTATTGGTGAATTAGACCGTATTTTTACACACATTAACGCAATGCTAGCAGCCCAAG

CDS

ATGCCAATCAGTGAAGATCTCAAACAAGCTATTCGGCAACGGGCAAGATATATCTGTGAATATTGTCATTCCCCAGAACGATTGAGTGCAAACAGATTCACCATTGATCATGTAATTCCGAAATCTTTAGGTGGTTCTGACGCATTTAATAACCTTGCCCTTGCTTGTCGTCGTTGTAACGAGAGGCGCTACAACTTTGTCGCCAGTATAGATCCACAAACTAAGACTATTGTTGCCATTTTTAACCCCCGCCAACAGAATTGGGCAGAACATTTCATTTGGACAAATAGAGGGATAATAATACAAGGAACCACGACAACCGGTCGTGCGACGTGTATCCGACTTGATTTAAATGATACCCGTTATCCAGAGGAAGATTCTATCCAGGAAACACGACGATTTTGGTTGAAAACGGGACTGCATCCCCCCATAGATGATCCTTGCAAAAATTGA

Protein

MPISEDLKQAIRQRARYICEYCHSPERLSANRFTIDHVIPKSLGGSDAFNNLALACRRCNERRYNFVASIDPQTKTIVAIFNPRQQNWAEHFIWTNRGIIIQGTTTTGRATCIRLDLNDTRYPEEDSIQETRRFWLKTGLHPPIDDPCKN