Your browser is old and dusty. Try Google Chrome!

Details for slr2079

ORF slr2079
Accession NP_441287.1
Symbol
Category Glutamate family / Nitrogen assimilation
Definition putative glutaminase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -179 -193 1.47456 0.188
NP_440795.1_7 Forward -186 -179 14.6904 0.0123
NP_440795.1_7 Reverse -179 -186 14.6904 0.0123
NP_441418.1_6 Forward -362 -343 -28.5165 0.205
NP_441418.1_6 Reverse -166 -185 -29.7948 0.238
NP_441418.1_6 Reverse -178 -197 -30.7781 0.296
NP_440815.1_5 Forward -187 -168 7.86593 0.24
NP_442291.1_5 Forward -188 -172 0.943514 0.155
NP_442291.1_5 Reverse -177 -193 -1.61309 0.201
NP_440897.1_6 Forward -187 -168 -4.32786 0.273
NP_441453.1_4 Reverse -178 -186 16.539 0.00633
NP_441453.1_4 Forward -187 -179 16.539 0.00633
NP_442151.1_6 Reverse -178 -192 16.3225 0.0158
NP_442151.1_6 Forward -187 -173 9.73436 0.141
NP_442151.1_6 Reverse -271 -285 6.29277 0.24
NP_441818.1_1 Forward -186 -175 15.6928 0.0257
NP_441818.1_1 Reverse -179 -190 15.6928 0.0257
NP_441818.1_9 Forward -253 -234 -9.63698 0.291
NP_440226.1_1 Forward -187 -168 17.0107 0.0205
NP_440226.1_1 Reverse -178 -197 6.78429 0.119
NP_442623.1_1 Reverse -314 -333 -9.34199 0.241
NP_440150.1_6 Reverse -175 -194 0.982764 0.295
NP_440996.1_3 Reverse -165 -183 9.85225 0.269
NP_442287.1_5 Reverse -313 -323 14.828 0.218
NP_442173.1_1 Forward -186 -178 15.4574 0.00633
NP_442173.1_1 Reverse -179 -187 15.4574 0.00633
NP_442752.1_4 Forward -187 -180 13.8055 0.0199
NP_442752.1_4 Reverse -178 -185 13.8055 0.0199
NP_443027.1_4 Forward -189 -179 13.1564 0.0521
NP_443027.1_4 Reverse -176 -186 13.1564 0.0521
NP_441812.1_1 Reverse -76 -90 15.6336 0.201
NP_441812.1_3 Reverse -177 -191 6.88276 0.287
NP_442975.1_10 Reverse -174 -188 3.04726 0.263
NP_442975.1_10 Forward -191 -177 2.94893 0.266
NP_440784.1_7 Forward -186 -179 15.9687 0.0123
NP_440784.1_7 Reverse -179 -186 15.9687 0.0123
NP_442909.1_7 Reverse -179 -193 13.2736 0.128
NP_441250.1_2 Reverse -134 -153 14.2574 0.236
NP_441250.1_8 Forward -209 -200 19.4688 0.274
NP_440061.1_9 Forward -189 -175 13.9619 0.0735
NP_440061.1_9 Reverse -176 -190 13.9619 0.0735
NP_440061.1_9 Forward -387 -373 8.65209 0.167
NP_440061.1_9 Reverse -364 -378 6.48882 0.244
NP_440110.1_8 Forward -264 -245 -3.14714 0.288
NP_441054.1_4 Forward -197 -179 2.47742 0.169
NP_441054.1_4 Reverse -168 -186 0.314141 0.174
NP_440878.1_9 Forward -197 -178 11.2092 0.0939
NP_442062.1_8 Forward -187 -177 17.3846 0.00193
NP_442062.1_8 Reverse -178 -188 17.3846 0.00193
NP_441900.1_2 Reverse -334 -352 -6.17641 0.293
NP_442974.1_5 Reverse -264 -283 8.25926 0.186
NP_441859.1_3 Forward -188 -169 5.01354 0.209
NP_440304.1_4 Forward -189 -179 9.91146 0.051
NP_440304.1_4 Reverse -176 -186 9.91146 0.051
NP_440304.1_4 Forward -282 -272 5.78156 0.19
NP_442242.1_4 Forward -186 -179 14.3954 0.0124
NP_442242.1_4 Reverse -179 -186 14.3954 0.0124
NP_440044.1_8 Forward -186 -167 -0.39387 0.22
NP_440044.1_8 Reverse -179 -198 -1.37718 0.244
NP_440307.1_2 Reverse -365 -384 6.19431 0.209
NP_441208.1_9 Forward -250 -236 9.2427 0.217
NP_441208.1_9 Forward -190 -176 8.55439 0.219
NP_441208.1_9 Reverse -175 -189 8.55439 0.219
NP_441208.1_9 Forward -91 -77 4.62115 0.297
NP_441594.1_6 Forward -190 -171 5.80098 0.205
NP_441594.1_6 Reverse -158 -177 -0.295539 0.298
NP_442896.1_7 Forward -165 -146 2.65439 0.142
NP_440856.1_4 Forward -151 -132 6.39097 0.0769
NP_441083.1_3 Reverse -270 -280 15.3192 0.138
NP_441083.1_5 Forward -187 -177 20.3345 0.00053
NP_441083.1_5 Reverse -178 -188 20.3345 0.00053
NP_442827.1_8 Forward -195 -176 10.815 0.0577
NP_441434.1_7 Forward -278 -264 3.24451 0.254
NP_441738.1_2 Forward -185 -178 15.28 0.0102
NP_441738.1_2 Reverse -180 -187 15.28 0.0102
NP_441558.1_5 Forward -189 -170 11.7992 0.0766
NP_441558.1_5 Reverse -176 -195 11.4058 0.0814
NP_441558.1_5 Forward -282 -263 8.25926 0.155
NP_441942.1_7 Forward -165 -146 10.9142 0.282
NP_440209.1_1 Reverse -178 -186 18.1123 0.00295
NP_440209.1_1 Forward -187 -179 18.1123 0.00295
NP_440447.1_5 Forward -259 -249 13.943 0.277
NP_441713.1_1 Forward -193 -174 -2.45882 0.113
NP_441713.1_1 Reverse -172 -191 -4.72043 0.113
NP_440178.1_7 Forward -188 -169 -21.0434 0.207
NP_440178.1_7 Reverse -177 -196 -21.24 0.215
NP_441716.1_1 Forward -187 -173 23.1074 0.00274
NP_441716.1_1 Reverse -178 -192 14.3559 0.0689
NP_441716.1_2 Reverse -90 -109 1.34587 0.254
NP_442111.1_4 Forward -188 -174 9.93102 0.0575
NP_442111.1_4 Reverse -211 -225 4.91614 0.185
NP_442111.1_4 Forward -216 -202 3.24451 0.253
NP_442111.1_4 Reverse -177 -191 2.35953 0.28
NP_441624.1_7 Forward -161 -147 6.78443 0.275
NP_441163.1_1 Forward -195 -178 5.24966 0.277
NP_441495.1_1 Reverse -231 -250 7.7676 0.292
NP_440906.1_5 Forward -186 -179 15.8704 0.0124
NP_440906.1_5 Reverse -179 -186 15.8704 0.0124
NP_440747.1_10 Forward -190 -178 7.51213 0.00286
NP_440747.1_10 Reverse -175 -187 7.51213 0.00286
NP_441130.1_10 Forward -189 -175 16.5192 0.0231
NP_441130.1_10 Reverse -176 -190 16.5192 0.0231
NP_441854.1_1 Reverse -137 -156 19.6648 0.129
NP_441486.1_1 Reverse -175 -189 5.80112 0.0344
NP_441486.1_1 Forward -190 -176 5.80112 0.0344
NP_441486.1_1 Reverse -143 -157 0.589577 0.132
NP_442634.1_2 Reverse -172 -191 -0.4922 0.293
NP_442634.1_4 Forward -249 -235 1.08123 0.149
NP_442634.1_4 Forward -189 -175 -4.91696 0.223
NP_442634.1_4 Reverse -176 -190 -4.91696 0.223
NP_441265.1_3 Reverse -172 -186 4.71948 0.181
NP_440403.1_4 Forward -196 -177 -5.80207 0.221
NP_440403.1_10 Forward -164 -145 2.26107 0.279
NP_441014.1_10 Forward -275 -256 -2.06626 0.27
NP_442848.1_1 Forward -193 -179 7.66941 0.0791
NP_442848.1_1 Reverse -172 -186 5.80112 0.0803
NP_443018.1_3 Forward -186 -179 14.8871 0.0123
NP_443018.1_3 Reverse -179 -186 14.8871 0.0123
NP_443018.1_3 Reverse -377 -384 10.2655 0.107
NP_441316.1_7 Forward -249 -234 -3.56002 0.282
NP_441634.1_8 Forward -189 -175 5.99778 0.114
NP_441634.1_8 Reverse -176 -190 5.99778 0.114
NP_441634.1_9 Reverse -371 -390 8.75009 0.294
NP_440376.1_1 Forward -187 -178 19.4693 0.000692
NP_440376.1_1 Reverse -178 -187 19.4693 0.000692
NP_440376.1_1 Forward -280 -271 4.12963 0.173
NP_442687.1_7 Forward -188 -178 8.92815 0.0994
NP_442687.1_7 Reverse -177 -187 8.92815 0.0994
NP_442191.1_4 Reverse -153 -167 11.284 0.263
NP_442485.1_3 Forward -166 -147 0.0977854 0.247
NP_442485.1_3 Reverse -260 -279 -2.65548 0.264
NP_442485.1_3 Forward -381 -362 -5.60541 0.293
NP_442958.1_3 Forward -198 -179 9.24257 0.142
NP_441013.1_2 Forward -258 -240 8.7706 0.208
NP_441013.1_2 Forward -318 -300 -2.83245 0.287
NP_441422.1_3 Reverse -173 -192 18.2884 0.112
NP_441422.1_7 Reverse -176 -193 -4.18939 0.238
NP_442658.1_1 Reverse -176 -186 9.616 0.147
NP_442658.1_1 Forward -189 -179 9.616 0.147
NP_442782.1_2 Reverse -146 -160 4.03116 0.257
NP_442782.1_2 Forward -160 -146 0.786239 0.284
NP_442205.1_9 Forward -193 -177 3.69678 0.176
NP_442205.1_9 Reverse -172 -188 -3.38305 0.282
NP_441414.1_9 Forward -187 -168 8.25926 0.0289
NP_441414.1_9 Reverse -178 -197 -9.73531 0.266
NP_441958.1_5 Forward -188 -178 12.2714 0.00183
NP_441958.1_5 Reverse -177 -187 12.2714 0.00183
NP_442836.1_5 Forward -193 -174 10.1275 0.117
NP_440203.1_5 Reverse -181 -191 10.3043 0.229
NP_440203.1_5 Forward -184 -174 9.02601 0.275
NP_439905.1_1 Reverse -179 -192 18.1122 0.0324
NP_439905.1_1 Forward -186 -173 8.57408 0.232
NP_440984.1_7 Forward -192 -178 12.4876 0.122
NP_439990.1_5 Forward -192 -179 10.7374 0.128
NP_441338.2_5 Reverse -157 -176 4.22769 0.299
NP_442911.1_2 Reverse -168 -187 22.5172 0.00418
NP_442911.1_2 Forward -197 -178 -4.42544 0.134
NP_440153.1_5 Reverse -179 -193 3.44117 0.212
NP_440153.1_5 Forward -186 -172 2.94952 0.219
NP_440153.1_8 Forward -187 -174 5.03416 0.18
NP_442536.1_4 Reverse -312 -330 7.00065 0.299
NP_440993.1_2 Reverse -173 -189 2.12349 0.269
NP_440993.1_3 Reverse -168 -187 11.5033 0.0886
NP_440993.1_4 Reverse -146 -163 7.512 0.227
NP_440827.1_3 Reverse -141 -160 11.2092 0.274
NP_441099.1_5 Reverse -168 -187 -9.047 0.212
NP_440809.1_9 Reverse -169 -187 1.88744 0.118
NP_441294.1_7 Reverse -174 -188 18.1776 0.00605
NP_441294.1_7 Forward -191 -177 8.86667 0.274
NP_441646.1_1 Forward -194 -175 6.39097 0.173
NP_441646.1_1 Reverse -171 -190 5.99764 0.175
NP_442438.1_10 Reverse -173 -187 12.291 0.0412
NP_442438.1_10 Forward -192 -178 2.65453 0.17
NP_442431.1_10 Forward -253 -235 0.510803 0.273
NP_441000.1_6 Forward -188 -174 -5.11362 0.261
NP_440605.1_4 Reverse -168 -187 14.5416 0.225
NP_442771.1_1 Reverse -204 -222 -4.40575 0.166
NP_440147.1_4 Forward -189 -176 11.524 0.0326
NP_440147.1_4 Reverse -176 -189 11.524 0.0326
NP_440147.1_4 Forward -309 -296 -0.570702 0.291
NP_441550.1_8 Reverse -176 -186 16.7941 0.00906
NP_441550.1_8 Forward -189 -179 16.7941 0.00906
NP_441916.1_7 Forward -187 -177 10.3048 0.0261
NP_441916.1_7 Reverse -178 -188 10.3048 0.0261
NP_441916.1_7 Forward -280 -270 4.40493 0.178
NP_441041.1_4 Forward -253 -234 -0.590531 0.0958
NP_441041.1_4 Reverse -271 -290 -9.34199 0.215
NP_441041.1_4 Forward -167 -148 -13.2752 0.285
NP_440569.1_6 Reverse -143 -162 8.06259 0.219
NP_442004.1_6 Forward -187 -173 8.65272 0.14
NP_442004.1_6 Reverse -178 -192 7.76774 0.156
NP_441725.1_5 Forward -186 -176 9.02648 0.0553
NP_441725.1_5 Reverse -179 -189 9.02648 0.0553
NP_439966.1_7 Reverse -176 -186 14.8275 0.0177
NP_439966.1_7 Forward -189 -179 14.8275 0.0177
NP_439966.1_9 Forward -189 -180 0.884706 0.253
NP_439966.1_9 Reverse -176 -185 0.884706 0.253
NP_442941.1_3 Forward -186 -176 10.9931 0.0116
NP_442941.1_3 Reverse -179 -189 10.9931 0.0116
NP_440289.1_2 Forward -190 -177 2.18257 0.102
NP_440289.1_2 Reverse -175 -188 2.18257 0.102
NP_440260.1_8 Forward -164 -146 4.83737 0.154
NP_441678.1_9 Reverse -259 -278 -2.55715 0.26
NP_442012.1_5 Reverse -264 -283 -0.0988766 0.288
NP_440723.1_4 Forward -158 -139 -3.04881 0.272
NP_441556.1_10 Forward -192 -178 15.6727 0.144
NP_442982.1_5 Reverse -228 -247 -3.44213 0.298
NP_440375.1_8 Forward -384 -365 10.2259 0.138
NP_443030.1_4 Reverse -232 -251 2.16274 0.209
NP_441644.1_6 Forward -187 -177 17.3841 0.00127
NP_441644.1_6 Reverse -178 -188 17.3841 0.00127
NP_441644.1_6 Reverse -271 -281 12.9592 0.0265
NP_442215.1_2 Reverse -131 -147 -2.89139 0.206
NP_442215.1_2 Forward -189 -173 -7.51295 0.297
NP_442029.1_1 Forward -259 -240 -14.3569 0.272
NP_442029.1_6 Forward -154 -135 8.16093 0.211
NP_440929.1_8 Forward -187 -178 19.2726 0.000701
NP_440929.1_8 Reverse -178 -187 19.2726 0.000701
NP_442933.1_10 Forward -187 -178 17.601 0.00325
NP_442933.1_10 Reverse -178 -187 17.601 0.00325
NP_441751.2_8 Forward -186 -172 4.91614 0.0453
NP_441751.2_8 Reverse -179 -193 2.5562 0.0804
NP_441751.2_8 Reverse -26 -40 -5.40861 0.206
NP_442554.1_8 Forward -186 -176 18.0729 0.00543
NP_442554.1_8 Reverse -179 -189 18.0729 0.00543
NP_442554.1_8 Reverse -272 -282 5.38824 0.15
NP_442970.1_1 Forward -105 -91 11.8526 0.269
NP_441762.1_7 Forward -188 -176 2.69391 0.0676
NP_441762.1_7 Reverse -177 -189 2.69391 0.0676
NP_442142.1_4 Forward -283 -270 6.80355 0.154
NP_442142.1_4 Forward -190 -177 4.34528 0.223
NP_442142.1_4 Reverse -175 -188 4.34528 0.223
NP_442142.1_4 Reverse -268 -281 2.28034 0.295
NP_442292.1_1 Forward -186 -177 18.486 0.00229
NP_442292.1_1 Reverse -179 -188 18.486 0.00229
NP_442476.1_6 Forward -186 -172 12.8809 0.0454
NP_442476.1_6 Reverse -179 -193 12.586 0.0469
NP_443009.1_5 Reverse -177 -188 8.90795 0.0965
NP_443009.1_5 Forward -188 -177 8.90795 0.0965
NP_441715.1_4 Reverse -179 -189 7.84651 0.107
NP_441715.1_4 Forward -186 -176 7.84651 0.107
NP_440015.1_9 Forward -187 -169 1.78911 0.23
NP_441448.1_1 Reverse -156 -175 4.12936 0.279
NP_440183.1_9 Forward -383 -364 -12.4886 0.256
NP_441468.1_1 Forward -186 -179 15.8704 0.0124
NP_441468.1_1 Reverse -179 -186 15.8704 0.0124
NP_441015.1_8 Forward -377 -358 1.86774 0.272
NP_441015.1_10 Forward -192 -173 0.982764 0.164
NP_441673.1_1 Forward -187 -178 20.8459 0.000698
NP_441673.1_1 Reverse -178 -187 20.8459 0.000698
NP_441731.1_7 Forward -143 -124 1.57275 0.298
NP_441826.1_2 Reverse -172 -186 3.04785 0.115
NP_441826.1_2 Forward -193 -179 2.75286 0.12
NP_441826.1_2 Reverse -200 -214 -1.18038 0.238
NP_441826.1_2 Reverse -140 -154 -4.32697 0.295
NP_441826.1_2 Forward -227 -213 -4.52363 0.296
NP_442811.1_2 Reverse -374 -393 -3.3438 0.287
NP_442490.1_8 Forward -301 -282 18.1335 0.205
NP_442868.1_6 Reverse -176 -186 17.4829 0.012
NP_442868.1_6 Forward -189 -179 17.4829 0.012
NP_442719.1_2 Reverse -90 -108 -4.2098 0.208
NP_442719.1_2 Forward -155 -137 -10.7979 0.283
NP_441612.1_2 Reverse -178 -188 8.54929 0.21
NP_441612.1_2 Forward -187 -177 8.54929 0.21
NP_442227.1_2 Forward -179 -160 -0.197208 0.253
NP_443058.1_7 Forward -150 -131 4.71934 0.255
NP_443058.1_7 Forward -188 -169 4.42435 0.258
NP_442808.1_1 Reverse -177 -187 8.63269 0.0481
NP_442808.1_1 Forward -188 -178 8.63269 0.0481
NP_442808.1_1 Reverse -369 -379 5.78111 0.141
NP_442808.1_1 Forward -162 -152 2.33954 0.27
NP_442542.1_9 Forward -257 -243 5.60385 0.26
NP_442050.1_5 Reverse -176 -186 15.6142 0.01
NP_442050.1_5 Forward -189 -179 15.6142 0.01
NP_441114.1_3 Reverse -141 -150 7.66954 0.231
NP_440558.1_2 Reverse -235 -254 3.93269 0.153
NP_440558.1_2 Forward -190 -171 2.94938 0.164
NP_440558.1_2 Forward -164 -145 -4.22878 0.243
NP_440558.1_2 Forward -191 -172 -7.37537 0.293
NP_442792.1_5 Reverse -135 -152 8.10198 0.296
NP_441878.1_6 Forward -188 -178 10.4031 0.0176
NP_441878.1_6 Reverse -177 -187 10.4031 0.0176
NP_441878.1_6 Reverse -270 -280 1.55333 0.0937
NP_441878.1_6 Forward -281 -271 0.963343 0.128
NP_441878.1_6 Forward -248 -238 -7.29646 0.217
NP_441036.1_8 Reverse -263 -273 9.7148 0.174
NP_441036.1_8 Forward -188 -178 8.33817 0.174
NP_441036.1_8 Reverse -177 -187 8.33817 0.174
NP_441557.1_5 Forward -187 -178 19.9609 0.000699
NP_441557.1_5 Reverse -178 -187 19.9609 0.000699
NP_441445.1_1 Reverse -169 -188 16.3224 0.0383
NP_441445.1_1 Forward -289 -270 4.42435 0.195
NP_441445.1_1 Forward -196 -177 2.55606 0.233
NP_441445.1_1 Forward -164 -145 -0.688862 0.3
NP_441590.1_1 Reverse -229 -248 11.4058 0.256
NP_442066.2_4 Forward -176 -157 -9.047 0.296
NP_442066.2_9 Forward -191 -178 10.639 0.154
NP_442419.1_2 Reverse -26 -45 0.0977854 0.243
NP_442183.1_1 Reverse -178 -192 7.9644 0.127
NP_442397.1_9 Reverse -264 -283 1.0811 0.295
NP_441549.1_9 Forward -191 -173 10.9339 0.0392
NP_441549.1_9 Reverse -174 -192 -8.24065 0.223
NP_442347.1_2 Forward -186 -177 12.4878 0.056
NP_442347.1_2 Reverse -179 -188 12.4878 0.056
NP_442347.1_2 Reverse -234 -243 3.44131 0.284
NP_441037.1_4 Forward -189 -179 9.55921 0.21
NP_441037.1_4 Reverse -176 -186 9.55921 0.21
NP_441633.1_3 Forward -189 -176 3.75586 0.0699
NP_441633.1_3 Reverse -176 -189 3.75586 0.0699
NP_441633.1_3 Forward -217 -204 -6.86388 0.277
NP_440136.1_2 Forward -186 -179 15.9687 0.0123
NP_440136.1_2 Reverse -179 -186 15.9687 0.0123
NP_442590.1_10 Reverse -264 -283 11.7992 0.153
NP_442590.1_10 Forward -167 -148 2.94938 0.299
NP_442998.1_5 Reverse -314 -324 11.2881 0.189
NP_442998.1_10 Forward -185 -178 15.5754 0.0102
NP_442998.1_10 Reverse -180 -187 15.5754 0.0102
NP_440899.1_1 Reverse -253 -272 13.287 0.138
NP_440299.1_1 Reverse -174 -187 15.7516 0.0142
NP_440299.1_1 Forward -191 -178 9.75346 0.0661
NP_440299.1_1 Forward -246 -233 2.28034 0.292
NP_441799.1_1 Forward -191 -177 16.3219 0.0152
NP_441799.1_1 Reverse -174 -188 15.3386 0.0187
NP_441007.1_10 Forward -192 -179 11.4257 0.064
NP_441007.1_10 Reverse -173 -186 1.9859 0.202
NP_440256.1_1 Forward -283 -264 -2.55715 0.12
NP_440256.1_1 Reverse -373 -392 -6.49039 0.213
NP_441559.1_8 Reverse -173 -187 0.491246 0.166
NP_441559.1_8 Forward -192 -178 -6.78525 0.279
NP_440915.1_6 Reverse -174 -188 2.85119 0.111
NP_440915.1_6 Forward -277 -263 -0.787057 0.209
NP_441866.1_6 Forward -163 -144 10.6184 0.218
NP_442069.1_6 Reverse -239 -258 8.65258 0.173
NP_442866.1_1 Forward -166 -147 -9.63698 0.296
NP_440748.1_5 Reverse -235 -254 -3.54046 0.298
NP_441464.1_8 Reverse -178 -192 9.2427 0.192
NP_441464.1_8 Forward -187 -173 8.55439 0.194
NP_441939.1_3 Reverse -265 -284 5.211 0.284
NP_439985.1_7 Reverse -172 -191 5.89931 0.208
NP_439985.1_7 Forward -193 -174 2.94938 0.28
NP_442993.1_1 Reverse -178 -194 -9.47957 0.186
NP_442386.1_5 Reverse -293 -312 10.1267 0.164
NP_442386.1_9 Reverse -177 -186 13.8639 0.0289
NP_442386.1_9 Forward -188 -179 13.8639 0.0289
NP_442386.1_9 Forward -162 -153 5.21086 0.262
NP_440570.1_5 Reverse -246 -265 -3.24547 0.289
NP_441750.1_4 Reverse -184 -203 7.96426 0.159
NP_441340.1_5 Forward -186 -179 15.6737 0.0124
NP_441340.1_5 Reverse -179 -186 15.6737 0.0124
NP_442714.1_7 Forward -186 -167 10.2259 0.126
NP_440586.1_8 Forward -186 -179 13.2151 0.026
NP_440586.1_8 Reverse -179 -186 13.2151 0.026
NP_440586.1_8 Reverse -377 -384 9.08521 0.178
NP_440586.1_8 Reverse -239 -246 5.64364 0.297
NP_442251.1_6 Forward -186 -179 15.2804 0.0124
NP_442251.1_6 Reverse -179 -186 15.2804 0.0124
NP_441262.1_3 Reverse -178 -185 14.7888 0.0223
NP_441262.1_3 Forward -187 -180 14.7888 0.0223
NP_440027.1_3 Forward -385 -367 8.08151 0.196
NP_440027.1_3 Forward -176 -158 2.37835 0.29
NP_443051.1_1 Reverse -177 -186 10.4228 0.00754
NP_443051.1_1 Forward -188 -179 10.4228 0.00754
NP_441232.1_10 Reverse -167 -186 8.35759 0.142
NP_439937.1_9 Forward -188 -171 14.1977 0.0317
NP_439937.1_9 Reverse -177 -194 -14.2198 0.287
NP_440408.1_7 Forward -161 -142 10.2259 0.251
NP_440439.1_1 Forward -190 -177 3.65753 0.11
NP_440439.1_1 Reverse -175 -188 3.65753 0.11
NP_439943.1_4 Forward -155 -136 10.4225 0.214
NP_440372.1_2 Forward -186 -179 16.3621 0.0124
NP_440372.1_2 Reverse -179 -186 16.3621 0.0124
NP_439977.1_5 Reverse -172 -191 1.27776 0.195
NP_439977.1_5 Forward -193 -174 -0.787193 0.236
NP_442384.1_10 Forward -187 -174 11.9173 0.0319
NP_442384.1_10 Reverse -178 -191 11.0324 0.039
NP_440364.1_10 Forward -195 -176 15.0441 0.256
NP_442262.1_10 Forward -186 -179 14.1988 0.0123
NP_442262.1_10 Reverse -179 -186 14.1988 0.0123
NP_442262.1_10 Reverse -377 -384 9.18389 0.211
NP_441689.1_5 Forward -189 -179 5.87944 0.197
NP_441689.1_5 Reverse -176 -186 5.87944 0.197
NP_440163.1_10 Forward -283 -273 7.94484 0.297
NP_440163.1_10 Reverse -268 -278 7.94484 0.297
NP_440344.1_10 Reverse -171 -188 1.12048 0.0317
NP_440282.1_3 Reverse -141 -160 -2.75381 0.298
NP_440531.1_6 Reverse -368 -387 5.01433 0.118
NP_440531.1_6 Forward -195 -176 -5.50708 0.299
NP_440562.1_3 Reverse -179 -196 8.29864 0.15
NP_441965.1_3 Reverse -168 -187 5.01433 0.159
NP_441965.1_10 Reverse -175 -191 10.3833 0.107
NP_440297.1_9 Forward -186 -176 -0.216628 0.282
NP_440297.1_9 Reverse -272 -282 -0.216628 0.282
NP_440297.1_9 Reverse -179 -189 -0.216628 0.282
NP_442280.1_10 Forward -317 -299 9.35044 0.233
NP_441896.1_3 Forward -196 -177 1.76941 0.209
NP_440650.1_3 Forward -250 -231 13.4708 0.0616
NP_440894.1_10 Reverse -128 -147 5.50599 0.229
NP_442078.1_3 Reverse -246 -265 6.68515 0.186
NP_440999.1_2 Forward -390 -371 8.75091 0.288
NP_440999.1_9 Forward -191 -177 8.84938 0.0709
NP_440999.1_9 Reverse -174 -188 2.35953 0.151
NP_440888.1_2 Forward -187 -173 19.0751 0.00173
NP_440888.1_2 Reverse -178 -192 16.2235 0.00758
NP_441771.1_4 Forward -73 -54 -3.93378 0.292
NP_440600.1_4 Reverse -333 -351 -3.81576 0.243
NP_440179.1_6 Reverse -179 -198 5.211 0.245
NP_442277.1_4 Forward -170 -151 8.84842 0.12
NP_442033.1_10 Reverse -176 -195 5.30933 0.077
NP_442033.1_10 Forward -189 -170 -6.58872 0.186
NP_442033.1_10 Forward -250 -231 -12.0953 0.261
NP_442033.1_10 Reverse -114 -133 -12.4886 0.271
NP_441543.1_2 Forward -186 -177 16.9127 0.00359
NP_441543.1_2 Reverse -179 -188 16.9127 0.00359
NP_442845.1_2 Reverse -172 -186 12.9793 0.1
NP_442845.1_2 Forward -193 -179 6.19444 0.215
NP_442845.1_2 Reverse -146 -160 5.70279 0.225
NP_441551.1_5 Reverse -174 -190 9.30094 0.21
NP_441551.1_5 Forward -191 -175 7.62932 0.243
NP_441258.1_9 Reverse -175 -194 8.75091 0.239
NP_441469.1_8 Reverse -270 -279 11.8978 0.141
NP_441469.1_8 Forward -188 -179 6.48957 0.227
NP_441469.1_8 Reverse -177 -186 6.48957 0.227
NP_443064.1_6 Forward -187 -177 12.5669 0.0796
NP_443064.1_6 Reverse -178 -188 12.5669 0.0796
NP_443064.1_6 Reverse -264 -274 8.30077 0.3
NP_442578.1_7 Forward -186 -179 14.5921 0.026
NP_442578.1_7 Reverse -179 -186 14.5921 0.026
NP_441462.1_2 Forward -187 -177 11.5831 0.00406
NP_441462.1_2 Reverse -178 -188 11.5831 0.00406
NP_441621.1_7 Forward -189 -175 -2.95034 0.188
NP_441621.1_7 Reverse -176 -190 -2.95034 0.188
NP_440668.1_9 Reverse -263 -282 14.7491 0.171
NP_443062.1_1 Reverse -233 -251 5.13317 0.238
NP_443062.1_1 Forward -187 -169 4.64563 0.255
NP_443062.1_1 Reverse -271 -289 4.2556 0.268
NP_443062.1_6 Reverse -170 -189 5.11266 0.209
NP_441601.1_2 Reverse -172 -191 -4.03212 0.28
NP_442204.1_5 Forward -197 -178 0.58944 0.258
NP_442204.1_6 Reverse -367 -386 4.32602 0.293
NP_440516.1_2 Forward -193 -175 -2.73412 0.299
NP_440516.1_8 Forward -187 -178 16.9127 0.00442
NP_440516.1_8 Reverse -178 -187 16.9127 0.00442
NP_440516.1_8 Forward -273 -264 5.80125 0.112
NP_442428.1_5 Forward -186 -179 15.8704 0.0124
NP_442428.1_5 Reverse -179 -186 15.8704 0.0124
NP_442428.1_8 Forward -165 -146 6.78429 0.224
NP_440783.1_5 Reverse -259 -278 -1.86883 0.251
NP_441267.1_1 Reverse -172 -191 4.62101 0.227
NP_441867.1_2 Reverse -307 -326 -16.0285 0.291
NP_440673.1_3 Forward -185 -178 12.4288 0.0426
NP_440673.1_3 Reverse -180 -187 12.4288 0.0426
NP_440673.1_7 Reverse -274 -293 0.58944 0.267
NP_441052.1_2 Forward -187 -177 19.9412 0.00106
NP_441052.1_2 Reverse -178 -188 19.9412 0.00106
NP_442219.1_9 Forward -186 -177 17.7976 0.00718
NP_442219.1_9 Reverse -179 -188 17.7976 0.00718
NP_440436.1_4 Forward -186 -177 17.2072 0.00233
NP_440436.1_4 Reverse -179 -188 17.2072 0.00233
NP_441884.1_9 Reverse -175 -194 -13.5702 0.138
NP_441884.1_9 Forward -190 -171 -21.3384 0.242
NP_442705.1_1 Reverse -239 -258 13.4708 0.262
NP_440314.1_9 Reverse -318 -337 -5.01543 0.216
NP_440314.1_9 Reverse -179 -198 -5.99873 0.225
NP_441719.1_2 Reverse -43 -57 12.8678 0.296
NP_441719.1_4 Forward -186 -179 16.3621 0.0124
NP_441719.1_4 Reverse -179 -186 16.3621 0.0124
NP_441004.1_2 Forward -159 -140 -2.65548 0.264
NP_441004.1_2 Forward -352 -333 -4.22878 0.29
NP_441004.1_4 Forward -151 -141 14.533 0.175
NP_440296.1_10 Forward -373 -354 -15.2418 0.29
NP_441115.1_4 Forward -188 -170 7.68819 0.278
NP_442854.1_6 Reverse -271 -290 0.982764 0.287
NP_443054.1_2 Forward -282 -268 3.24451 0.24
NP_442430.1_4 Forward -163 -144 15.2408 0.186
NP_441851.1_10 Forward -188 -178 15.8113 0.00552
NP_441851.1_10 Reverse -177 -187 15.8113 0.00552
NP_441668.1_4 Forward -158 -139 3.83436 0.183
NP_442515.1_1 Reverse -177 -191 20.3541 0.0162
NP_442515.1_1 Forward -188 -174 11.3077 0.0416
NP_441046.1_2 Reverse -167 -186 0.884433 0.262
NP_441046.1_2 Forward -45 -26 -1.27885 0.288
NP_441349.1_10 Reverse -168 -187 3.83436 0.0627
NP_441349.1_10 Forward -197 -178 -1.86883 0.109
NP_441349.1_10 Forward -290 -271 -6.88371 0.238
NP_441409.1_6 Reverse -172 -191 -9.93197 0.196
NP_441409.1_6 Forward -193 -174 -10.3253 0.203
NP_440432.1_9 Forward -121 -106 -1.49507 0.167
NP_440474.1_8 Forward -186 -172 4.8172 0.266
NP_442168.1_5 Reverse -234 -253 5.211 0.202
NP_440588.1_2 Forward -196 -177 -0.4922 0.15
NP_440588.1_2 Reverse -169 -188 -3.63879 0.191
NP_440588.1_2 Reverse -229 -248 -4.72043 0.226
NP_440195.1_4 Reverse -146 -165 11.9958 0.136
NP_440195.1_4 Reverse -239 -258 5.11266 0.29
NP_442006.1_3 Reverse -161 -179 -6.1757 0.298
NP_441003.1_9 Reverse -229 -248 9.73422 0.213
NP_441570.1_1 Forward -187 -169 -14.7305 0.227
NP_440078.1_10 Forward -34 -15 3.83436 0.257
NP_441078.1_4 Forward -187 -178 19.6659 0.0007
NP_441078.1_4 Reverse -178 -187 19.6659 0.0007
NP_441078.1_4 Reverse -271 -280 -1.37691 0.254
NP_441078.1_4 Forward -280 -271 -1.47524 0.266
NP_442729.1_8 Forward -191 -178 10.049 0.125
NP_440539.1_9 Reverse -246 -265 -2.65548 0.286
NP_442443.1_1 Forward -349 -330 -5.31042 0.282
NP_440526.1_3 Forward -186 -175 10.6779 0.0646
NP_440526.1_3 Reverse -179 -190 10.6779 0.0646
NP_441432.1_8 Reverse -177 -186 16.8143 0.00595
NP_441432.1_8 Forward -188 -179 16.8143 0.00595
NP_442320.1_8 Reverse -172 -186 -1.47537 0.082
NP_441732.1_2 Reverse -174 -190 3.30346 0.0141
NP_441732.1_2 Forward -191 -175 3.20513 0.0141
NP_442815.1_2 Forward -252 -234 4.24738 0.244
NP_440760.1_1 Reverse -178 -197 -16.3235 0.172
NP_440760.1_1 Forward -187 -168 -21.9284 0.246
NP_442797.1_6 Reverse -355 -374 17.7268 0.17
NP_440199.1_10 Forward -43 -33 11.0914 0.165
NP_440461.1_3 Forward -354 -335 13.8641 0.297
NP_441805.1_1 Reverse -74 -93 -5.70374 0.293
NP_442298.1_10 Reverse -179 -198 12.2908 0.239
NP_440713.1_4 Reverse -168 -187 20.4523 0.0161
NP_440713.1_4 Forward -165 -146 3.04771 0.251
NP_442489.1_7 Forward -187 -178 20.1576 0.000695
NP_442489.1_7 Reverse -178 -187 20.1576 0.000695
NP_442489.1_7 Reverse -271 -280 -1.37691 0.195
NP_442489.1_7 Forward -280 -271 -1.47524 0.203
NP_442079.1_7 Forward -186 -167 12.8808 0.0838
NP_440559.1_1 Forward -186 -177 17.4043 0.00658
NP_440559.1_1 Reverse -179 -188 17.4043 0.00658
NP_441659.2_8 Forward -187 -177 18.1713 0.00133
NP_441659.2_8 Reverse -178 -188 18.1713 0.00133
NP_441659.2_8 Reverse -271 -281 -0.314959 0.298
NP_440426.1_7 Reverse -182 -201 0.687771 0.26
NP_442913.1_10 Forward -196 -177 7.66927 0.0519
NP_442913.1_10 Reverse -169 -188 -0.295539 0.158
NP_442776.1_6 Reverse -137 -156 7.17762 0.292
NP_440779.1_4 Forward -261 -244 15.2337 0.272
NP_442346.1_5 Forward -188 -178 16.6963 0.00248
NP_442346.1_5 Reverse -177 -187 16.6963 0.00248
NP_442346.1_5 Forward -281 -271 10.5014 0.0934
NP_442346.1_5 Reverse -112 -122 8.1415 0.146
NP_440545.1_3 Reverse -174 -191 18.2301 0.0104
NP_440545.1_3 Forward -191 -174 8.49531 0.0444
NP_440545.1_3 Forward -251 -234 1.8088 0.112
NP_440250.1_1 Reverse -142 -160 8.47561 0.273
NP_440459.1_2 Reverse -137 -154 17.0501 0.0834
NP_440459.1_2 Reverse -262 -279 14.3952 0.119
NP_442603.1_7 Reverse -178 -192 18.1901 0.0171
NP_442603.1_7 Forward -187 -173 11.4053 0.117
NP_441888.1_7 Forward -390 -376 0.491246 0.295
NP_441050.1_5 Forward -152 -134 6.01734 0.188
NP_440449.1_6 Forward -281 -263 6.40784 0.252
NP_441047.1_2 Reverse -377 -396 -3.73712 0.3
NP_440170.1_6 Forward -160 -141 11.7992 0.283
NP_441502.1_3 Forward -189 -170 6.88262 0.25
NP_441833.1_4 Forward -186 -179 15.9687 0.0124
NP_441833.1_4 Reverse -179 -186 15.9687 0.0124
NP_441895.1_2 Reverse -187 -206 -26.8449 0.256
NP_441895.1_10 Forward -53 -34 -27.7299 0.29
NP_442162.1_8 Reverse -364 -383 2.0644 0.263
NP_442162.1_9 Forward -186 -179 16.2637 0.0124
NP_442162.1_9 Reverse -179 -186 16.2637 0.0124
NP_442404.1_9 Forward -184 -170 12.2903 0.263
NP_442199.1_5 Reverse -170 -189 -6.49039 0.275
NP_442199.1_7 Reverse -131 -150 2.35861 0.26
NP_442140.1_3 Forward -186 -176 13.5497 0.0542
NP_442140.1_3 Reverse -179 -189 13.5497 0.0542
NP_440875.1_9 Forward -245 -235 7.88535 0.255
NP_441813.1_5 Reverse -176 -186 8.73149 0.0367
NP_441813.1_5 Forward -189 -179 8.73149 0.0367
NP_440594.1_8 Forward -186 -173 10.6384 0.159
NP_440594.1_8 Reverse -179 -192 9.95012 0.173
NP_440594.1_10 Forward -91 -77 18.8785 0.126
NP_440152.1_8 Reverse -197 -216 7.86593 0.261
NP_442089.1_9 Reverse -270 -289 14.4541 0.26
NP_440590.1_4 Reverse -179 -192 13.589 0.013
NP_440590.1_4 Forward -186 -173 13.4906 0.013
NP_440590.1_4 Reverse -265 -278 8.18076 0.0475
NP_440567.1_1 Forward -186 -172 14.2576 0.0187
NP_440567.1_1 Reverse -179 -193 1.96621 0.188
NP_442497.1_10 Forward -186 -177 10.4228 0.0087
NP_442497.1_10 Reverse -179 -188 10.4228 0.0087
NP_440821.1_4 Reverse -176 -186 17.9746 0.00497
NP_440821.1_4 Forward -189 -179 17.9746 0.00497
NP_441239.1_9 Forward -189 -177 7.11881 0.169
NP_441239.1_9 Reverse -176 -188 7.11881 0.169
NP_441239.1_9 Forward -282 -270 5.25052 0.223
NP_441239.1_9 Reverse -269 -281 3.48056 0.285
NP_441727.1_3 Reverse -171 -190 9.0459 0.197
NP_441892.1_1 Forward -256 -239 4.3654 0.111
NP_441892.1_1 Forward -289 -272 -5.56602 0.283
NP_442044.1_1 Reverse -173 -192 3.73603 0.131
NP_442044.1_1 Forward -192 -173 -13.6686 0.277
NP_442270.1_9 Forward -198 -179 -9.83364 0.246
NP_441541.1_1 Forward -110 -92 -4.10417 0.271
NP_440833.1_6 Reverse -323 -337 10.8154 0.242
NP_442216.1_4 Forward -262 -254 8.08217 0.255
NP_442216.1_4 Forward -210 -202 8.08217 0.255
NP_440546.1_4 Forward -187 -177 10.046 0.109
NP_440546.1_4 Reverse -178 -188 10.046 0.109
NP_440546.1_4 Reverse -113 -123 9.46426 0.136
NP_441230.1_5 Forward -166 -147 -0.0988766 0.277
NP_440462.1_6 Forward -189 -179 10.3048 0.0396
NP_440462.1_6 Reverse -176 -186 10.3048 0.0396
NP_441184.1_3 Reverse -263 -282 8.55425 0.231
NP_440868.1_4 Forward -191 -179 19.0169 0.0123
NP_440868.1_4 Reverse -174 -186 17.0502 0.0124
NP_442499.1_3 Forward -248 -230 6.80398 0.282
NP_441249.1_8 Forward -371 -352 6.78429 0.236
NP_441582.1_5 Reverse -176 -195 8.16011 0.164
NP_441582.1_5 Forward -189 -170 7.17681 0.185
NP_441582.1_5 Forward -328 -309 3.34192 0.266
NP_441474.1_2 Forward -100 -82 19.2912 0.292
NP_442402.1_4 Forward -151 -132 3.63691 0.15
NP_442402.1_4 Reverse -83 -102 -7.47443 0.276
NP_442402.1_4 Reverse -329 -348 -9.34271 0.288
NP_441848.1_4 Forward -106 -90 13.9486 0.183
NP_440696.1_3 Reverse -366 -384 5.52568 0.198
NP_440843.1_8 Forward -253 -234 11.9958 0.297
NP_442039.1_4 Forward -186 -179 15.1821 0.0124
NP_442039.1_4 Reverse -179 -186 15.1821 0.0124
NP_441811.1_2 Reverse -45 -64 16.2232 0.284
NP_441811.1_8 Forward -193 -179 16.6175 0.113
NP_441811.1_8 Forward -253 -239 8.06273 0.238
NP_441811.1_8 Reverse -172 -186 7.66941 0.241
NP_442679.1_1 Forward -61 -42 -0.590531 0.221
NP_441053.1_3 Reverse -242 -261 -1.08219 0.278
NP_442837.1_3 Forward -186 -179 15.7721 0.0124
NP_442837.1_3 Reverse -179 -186 15.7721 0.0124
NP_440160.1_2 Reverse -134 -153 -0.885524 0.232
NP_440160.1_2 Forward -286 -267 -9.14533 0.293
NP_439994.1_3 Reverse -177 -196 14.877 0.101
NP_442053.1_1 Forward -187 -178 18.3876 0.0007
NP_442053.1_1 Reverse -178 -187 18.3876 0.0007
NP_440505.1_3 Reverse -176 -186 16.598 0.00683
NP_440505.1_3 Forward -189 -179 16.598 0.00683
NP_440013.1_10 Forward -292 -273 16.4207 0.212
NP_441408.2_7 Forward -288 -269 0.58944 0.22
NP_440914.1_1 Forward -187 -177 17.5935 0.000537
NP_440914.1_1 Reverse -178 -188 17.5935 0.000537
NP_440914.1_7 Forward -103 -84 4.72643 0.29
NP_441011.1_8 Reverse -127 -136 8.35786 0.144
NP_441011.1_8 Forward -186 -177 8.25953 0.144
NP_441011.1_8 Reverse -179 -188 8.25953 0.144
NP_441011.1_8 Reverse -153 -162 5.50626 0.256
NP_442533.1_6 Forward -187 -178 17.2076 0.00137
NP_442533.1_6 Reverse -178 -187 17.2076 0.00137
NP_442533.1_6 Reverse -271 -280 13.8644 0.0178
NP_442533.1_6 Forward -280 -271 7.17789 0.0948
NP_443050.1_8 Forward -236 -217 18.3865 0.169
NP_442232.1_3 Reverse -170 -189 -14.6519 0.288
NP_442322.1_4 Forward -393 -376 -4.19006 0.256
NP_442322.1_4 Reverse -353 -370 -8.12328 0.286
NP_443016.1_1 Forward -332 -313 -3.3438 0.225
NP_442535.1_9 Forward -196 -178 5.42735 0.159
NP_441482.1_7 Forward -227 -213 -11.8001 0.284
NP_439944.1_9 Forward -186 -176 19.1546 0.00329
NP_439944.1_9 Reverse -179 -189 19.1546 0.00329
NP_439944.1_9 Reverse -114 -124 8.63316 0.105
NP_442664.1_3 Forward -203 -189 10.6193 0.282
NP_440116.1_8 Forward -186 -167 -5.50708 0.194
NP_441527.1_4 Forward -62 -43 -12.4621 0.288
NP_440115.1_6 Reverse -175 -185 17.9746 0.0163
NP_440115.1_6 Forward -190 -180 17.9746 0.0163
NP_440007.1_9 Forward -277 -263 8.94771 0.171
NP_440007.1_9 Forward -251 -237 1.27789 0.289
NP_441680.1_4 Reverse -240 -259 6.98095 0.175
NP_441680.1_4 Forward -175 -156 -1.7705 0.266
NP_441347.1_5 Forward -150 -136 9.93039 0.269
NP_441961.1_4 Forward -163 -144 5.89931 0.27
NP_440608.1_6 Reverse -179 -198 3.53858 0.29
NP_443045.1_5 Reverse -162 -175 15.6054 0.206
NP_441602.1_3 Forward -247 -228 -1.27885 0.226
NP_441170.1_4 Reverse -169 -187 10.4422 0.181
NP_441972.1_5 Forward -186 -167 5.99764 0.087
NP_441972.1_5 Reverse -141 -160 -2.55715 0.186
NP_441972.1_5 Reverse -239 -258 -7.4737 0.249
NP_441106.1_1 Forward -188 -179 9.63616 0.0311
NP_441106.1_1 Reverse -177 -186 9.63616 0.0311
NP_441106.1_1 Forward -281 -272 2.75299 0.261
NP_440429.1_2 Forward -279 -260 11.1109 0.258
NP_440429.1_2 Reverse -147 -166 9.14423 0.272
NP_439903.1_6 Reverse -137 -156 -0.689632 0.284
NP_442306.1_10 Forward -192 -173 -19.3717 0.197
NP_442306.1_10 Reverse -173 -192 -19.9617 0.201
NP_441286.1_1 Forward -188 -176 21.6718 0.00196
NP_441286.1_1 Reverse -177 -189 21.6718 0.00196
NP_441286.1_1 Forward -216 -204 0.923956 0.102
NP_442058.1_6 Reverse -54 -73 -3.54046 0.29
NP_440670.1_8 Forward -187 -178 18.3876 0.000699
NP_440670.1_8 Reverse -178 -187 18.3876 0.000699
NP_440886.1_7 Forward -188 -178 7.94438 0.0805
NP_440886.1_7 Reverse -177 -187 7.94438 0.0805
NP_442614.1_2 Reverse -178 -192 15.7325 0.0773
NP_442614.1_2 Forward -187 -173 13.8643 0.112
NP_442614.1_2 Forward -34 -20 9.2427 0.242
NP_442614.1_2 Reverse -146 -160 9.14437 0.242
NP_442614.1_2 Reverse -314 -328 7.17775 0.275
NP_442072.1_9 Forward -188 -170 -20.532 0.204
NP_440907.2_8 Forward -186 -176 10.8943 0.0969
NP_440907.2_8 Reverse -179 -189 10.8943 0.0969
NP_441287.1_1 Forward -344 -330 23.009 0.00649
NP_442264.1_2 Forward -191 -174 10.5603 0.188
NP_441021.1_1 Reverse -179 -198 -0.000545616 0.0949
NP_441021.1_1 Reverse -265 -284 -12.2919 0.283
NP_441463.1_3 Reverse -168 -187 7.17762 0.0545
NP_441463.1_6 Forward -189 -175 8.44524 0.25
NP_441463.1_6 Reverse -176 -190 8.44524 0.25
NP_441626.1_2 Forward -186 -179 15.7721 0.0124
NP_441626.1_2 Reverse -179 -186 15.7721 0.0124
NP_442365.1_7 Forward -191 -172 4.03102 0.153
NP_442365.1_7 Reverse -235 -254 -3.63879 0.222
NP_442209.1_6 Reverse -179 -198 14.1591 0.209
NP_442615.1_1 Forward -196 -178 8.57394 0.0282
NP_442615.1_1 Reverse -169 -187 5.82068 0.0374
NP_441962.1_4 Reverse -173 -192 -0.000545616 0.117
NP_441962.1_4 Forward -252 -233 -10.227 0.224
NP_440387.1_1 Reverse -178 -194 12.0549 0.014
NP_440387.1_1 Forward -187 -171 -1.71142 0.143
NP_441431.1_2 Forward -190 -176 7.07881 0.251
NP_441431.1_2 Reverse -175 -189 7.07881 0.251
NP_441488.1_7 Forward -193 -174 0.687771 0.296
NP_441836.1_2 Reverse -172 -191 11.6025 0.0706
NP_441836.1_2 Forward -193 -174 -2.75381 0.231
NP_441836.1_2 Reverse -370 -389 -4.32711 0.255
NP_441836.1_2 Reverse -133 -152 -6.58872 0.3
NP_441993.1_1 Reverse -161 -180 4.67549 0.215
NP_441174.1_4 Reverse -387 -397 10.2065 0.288
NP_440467.1_3 Forward -186 -167 13.6001 0.19
NP_441206.1_4 Reverse -26 -45 -5.99873 0.263
NP_441237.1_9 Forward -186 -176 14.9263 0.0242
NP_441237.1_9 Reverse -179 -189 14.9263 0.0242
NP_439910.1_2 Reverse -170 -187 -22.0856 0.207
NP_440457.1_1 Reverse -174 -186 9.77374 0.092
NP_440457.1_1 Forward -191 -179 0.137309 0.25
NP_440213.1_5 Forward -160 -141 22.1239 0.0647
NP_440798.1_6 Forward -186 -173 3.65753 0.15
NP_442680.1_5 Forward -62 -43 -1.19775 0.299
NP_440801.1_8 Reverse -247 -266 6.4893 0.166
NP_442509.1_9 Forward -212 -202 13.4509 0.0553
NP_442509.1_9 Reverse -264 -274 9.22267 0.192
NP_442509.1_9 Forward -187 -177 8.14104 0.192
NP_442509.1_9 Reverse -178 -188 8.14104 0.192
NP_441253.1_7 Reverse -362 -380 11.7205 0.199
NP_440554.1_4 Forward -186 -176 6.37155 0.123
NP_440554.1_4 Reverse -179 -189 6.37155 0.123
NP_442862.1_3 Forward -264 -247 5.84037 0.267
NP_441885.1_5 Forward -187 -177 20.9245 0.000538
NP_441885.1_5 Reverse -178 -188 20.9245 0.000538
NP_440478.1_10 Forward -387 -373 14.0609 0.12
NP_440478.1_10 Reverse -364 -378 7.57108 0.261
NP_440478.1_10 Reverse -269 -283 6.19444 0.294
NP_442341.1_7 Reverse -177 -191 16.2242 0.0186
NP_442341.1_7 Forward -188 -174 10.226 0.0678
NP_442341.1_7 Forward -327 -313 1.47456 0.288
NP_440409.1_1 Forward -195 -176 0.687771 0.209
NP_440191.1_4 Forward -140 -130 13.439 0.282
NP_443000.1_7 Forward -189 -179 10.4031 0.0345
NP_443000.1_7 Reverse -176 -186 10.4031 0.0345
NP_440507.2_3 Reverse -163 -182 9.63507 0.218
NP_440727.1_2 Forward -195 -176 -1.47551 0.295
NP_441842.1_1 Forward -185 -172 21.4548 0.00999
NP_441842.1_1 Reverse -180 -193 12.4084 0.212
NP_441842.1_10 Reverse -171 -185 8.25939 0.23
NP_440275.1_3 Forward -189 -179 17.6796 0.0102
NP_440275.1_3 Reverse -176 -186 17.6796 0.0102
NP_440091.1_1 Reverse -174 -186 17.7386 0.013
NP_440091.1_1 Forward -191 -179 8.29878 0.0653
NP_441902.1_3 Reverse -253 -263 14.7309 0.211
NP_443010.1_10 Forward -190 -173 16.1063 0.0512
NP_443010.1_10 Reverse -175 -192 12.8207 0.0831
NP_442451.1_2 Forward -195 -176 -1.47551 0.172
NP_441635.1_1 Reverse -78 -97 5.1084 0.27
NP_439962.1_4 Forward -393 -374 -3.14714 0.246
NP_440149.1_8 Reverse -178 -197 -2.26216 0.166
NP_441105.1_3 Reverse -167 -186 -4.81876 0.207
NP_441105.1_3 Reverse -141 -160 -5.31042 0.216
NP_440216.1_1 Forward -187 -173 -0.197071 0.0284
NP_440216.1_1 Reverse -178 -192 -9.34185 0.145
NP_440216.1_9 Forward -383 -374 5.89959 0.289
NP_440172.1_1 Forward -187 -177 15.0247 0.00945
NP_440172.1_1 Reverse -178 -188 15.0247 0.00945
NP_442015.1_3 Reverse -288 -307 12.585 0.255
NP_442015.1_10 Reverse -174 -187 2.87088 0.187
NP_442015.1_10 Forward -191 -178 2.77255 0.187
NP_441045.1_6 Forward -395 -377 16.0463 0.284
NP_441226.1_7 Forward -186 -179 14.4934 0.0123
NP_441226.1_7 Reverse -179 -186 14.4934 0.0123
NP_441111.1_7 Forward -186 -178 18.7023 0.00294
NP_441111.1_7 Reverse -179 -187 18.7023 0.00294
NP_441766.1_2 Forward -187 -178 17.5026 0.00297
NP_441766.1_2 Reverse -178 -187 17.5026 0.00297
NP_440416.1_9 Reverse -8 -27 -21.3384 0.294
NP_442154.1_1 Reverse -377 -395 -18.5654 0.282
NP_440261.1_5 Reverse -179 -192 14.3756 0.0214
NP_440261.1_5 Forward -186 -173 4.8375 0.0516
NP_440261.1_5 Forward -214 -201 -12.4687 0.297
NP_440988.1_10 Reverse -176 -190 20.0016 0.0733
NP_440988.1_10 Forward -189 -175 20.0016 0.0733
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATATTTCTCCGCTCCATCCATGGCTAGCCGGGGCAGGACGTAAACGGTGTAGTGGTCGAGTAAATGGGTAATTTGGGCATCTTCCCCATACTTGGTCATCAGTTGATGCAGGCAATACAAGGCCACGGCCGATCCTGTTACTTCCCCAGCGTGGGTGTTGGCATCGATCCAGTAACCAGGTTTATTGCGATAATCCCCCGTAGCTTGATTGGTGGCGATCGCCACCCAAATGTCCCGGCCGGCATAGCTTTGGCCAATGGTTTGCACCGTTAGCAGGGAACCATAGCTAGTTTGTAGTTGTTGTAAAAACTGGTCTATTTCCTGGTAGGTGAAATAGTGACTGAAATCAAAGGGAGAAACGGTCATGGAGGACGCAACGAATCACAAAGGGTGAATAACG

CDS

ATGGGGATTGGCGTAAACTCAGATCCCAAAGTCGTACATCATCAATCTATACCTAAACCTAATGCCATGGCGATCGCCAATTACAGAGCCATTACAACCAAACAATGGCAAACATGGGTAGAAGCTGCCCGTCTTCAGGCCCTCAACGGTAAGTTACCCCAATACATTCCTCAGTTGAGCTTGGTCGATCCAGGTAATTTTGCCCTAGACATTGGCGACCAAAACGGCATTATTTACGAAGCAGGAGATACAGACTTAACGTTTAGTTTGATGAGTGTGGTCAAACCCTTTCTGTGGCTTTACATACTCCATCACCGGGGTTGGCAGTGGGCCGAGCAAAAAGTTGGCGATCGCCCTTCCCATTTACCTTTTAATTCCGTGGAGCAATTGGAGCAGGATGGGGGTTATCCCCGCAACACCATGGTCAACAGTGGCGCCATCTGCCTAGCGGGTCATATTCCGGGGGCAACGATAGAGCAACGGTGTGAAAATTTTCTCACTTGGTTAAACCACACCGCCCAATGTCAACTCTGGCTTGATCAGGAACTATTGGCTTCAGTCCATTCCCTACCCAATCCCCGCAATCTGGCGATCGCCCATTTGTTGGCAGCAAAAGGTTATGTGGAAGATGCGACCCTGGCTCTAGAAACCTATAACCAACTTTGTTGTTTGAGTGGTTGCCTCAAGGATTTATTCAAGCTAGGCCTAATGTTGCAATGTCCCCAGCCGCCGTTACAACCGGACACCACTGCCAGGGTCAAAGCCACCATGGCCAAAGCAGGACTGTATGAAATGTCAGAAGCGTTTTTTCGGCGCACCGGCTTTATTTGCAAATCGGGGGTCAGTGGCCTAATTTTGGCTTGTTTGCCGGCCCCGTCACCGACCATTTTTGCCTGCTATAGTCCGCCTTTGAATGAAGAAGGAAACCCTGTGGCTCCCCTGGCACTATTAGAGTTTTTGGCAGAGTTCACCTCTAGAAATTAA

Protein

MGIGVNSDPKVVHHQSIPKPNAMAIANYRAITTKQWQTWVEAARLQALNGKLPQYIPQLSLVDPGNFALDIGDQNGIIYEAGDTDLTFSLMSVVKPFLWLYILHHRGWQWAEQKVGDRPSHLPFNSVEQLEQDGGYPRNTMVNSGAICLAGHIPGATIEQRCENFLTWLNHTAQCQLWLDQELLASVHSLPNPRNLAIAHLLAAKGYVEDATLALETYNQLCCLSGCLKDLFKLGLMLQCPQPPLQPDTTARVKATMAKAGLYEMSEAFFRRTGFICKSGVSGLILACLPAPSPTIFACYSPPLNEEGNPVAPLALLEFLAEFTSRN