Your browser is old and dusty. Try Google Chrome!

Details for slr2075

ORF slr2075
Accession NP_440730.1
Symbol groES
Category Chaperones
Definition 10kD chaperonin
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -190 -176 0.88457 0.197
NP_441061.1_2 Reverse -183 -197 0.88457 0.197
NP_440557.1_1 Forward -293 -274 11.6025 0.0997
NP_440795.1_7 Forward -190 -183 14.6904 0.0123
NP_440795.1_7 Reverse -183 -190 14.6904 0.0123
NP_441418.1_6 Reverse -182 -201 -20.65 0.121
NP_441418.1_6 Forward -191 -172 -21.1417 0.139
NP_441453.1_1 Forward -198 -180 4.63995 0.258
NP_441453.1_4 Reverse -182 -190 16.539 0.00633
NP_441453.1_4 Forward -191 -183 16.539 0.00633
NP_442151.1_6 Forward -191 -177 18.5841 0.0071
NP_442151.1_6 Reverse -182 -196 6.3911 0.236
NP_440226.1_1 Reverse -182 -201 10.6192 0.061
NP_441630.1_3 Reverse -174 -193 0.884433 0.261
NP_440120.1_4 Reverse -131 -145 14.7492 0.273
NP_442173.1_1 Forward -190 -182 15.4574 0.00633
NP_442173.1_1 Reverse -183 -191 15.4574 0.00633
NP_442752.1_4 Forward -191 -184 13.8055 0.0199
NP_442752.1_4 Reverse -182 -189 13.8055 0.0199
NP_443027.1_4 Reverse -180 -190 15.3197 0.0437
NP_443027.1_4 Forward -193 -183 13.943 0.0452
NP_442975.1_10 Forward -195 -181 21.3367 0.00107
NP_442975.1_10 Reverse -178 -192 11.5037 0.0497
NP_440784.1_7 Forward -190 -183 15.9687 0.0123
NP_440784.1_7 Reverse -183 -190 15.9687 0.0123
NP_440061.1_9 Reverse -95 -109 6.98048 0.223
NP_440061.1_9 Forward -193 -179 4.91554 0.3
NP_440110.1_4 Reverse -171 -190 10.6192 0.111
NP_440110.1_8 Forward -193 -174 -1.08219 0.233
NP_441476.1_5 Forward -196 -177 0.491109 0.19
NP_442062.1_8 Reverse -182 -192 19.4496 0.000558
NP_442062.1_8 Forward -191 -181 10.3048 0.0493
NP_440761.1_3 Reverse -277 -296 9.30814 0.263
NP_440761.1_4 Forward -196 -177 -12.3902 0.251
NP_441859.1_3 Reverse -181 -200 6.68515 0.171
NP_440304.1_4 Reverse -180 -190 18.9579 0.00406
NP_440304.1_4 Forward -193 -183 9.91146 0.051
NP_442242.1_4 Forward -190 -183 14.3954 0.0124
NP_442242.1_4 Reverse -183 -190 14.3954 0.0124
NP_440044.1_8 Forward -190 -171 2.65439 0.146
NP_440044.1_8 Reverse -183 -202 -1.86883 0.254
NP_441200.1_4 Reverse -128 -147 5.70265 0.294
NP_441208.1_9 Reverse -179 -193 16.2242 0.0671
NP_441208.1_9 Forward -194 -180 7.76774 0.219
NP_440370.1_10 Forward -200 -181 8.45592 0.241
NP_442110.1_7 Forward -191 -177 18.9775 0.0138
NP_442110.1_7 Reverse -182 -196 0.0979218 0.267
NP_440856.1_4 Reverse -175 -194 -3.3438 0.23
NP_441083.1_5 Reverse -182 -192 11.3864 0.0159
NP_441083.1_5 Forward -191 -181 11.2881 0.0159
NP_442827.1_8 Forward -199 -180 15.8299 0.032
NP_442827.1_8 Reverse -174 -193 13.3716 0.0402
NP_441434.1_1 Forward -87 -73 10.1338 0.233
NP_441434.1_1 Reverse -72 -86 10.1338 0.233
NP_441434.1_7 Reverse -184 -198 24.0907 0.00706
NP_442245.1_8 Reverse -305 -324 19.8623 0.229
NP_441738.1_2 Forward -189 -182 15.28 0.0102
NP_441738.1_2 Reverse -184 -191 15.28 0.0102
NP_441738.1_4 Forward -201 -182 15.2408 0.0804
NP_441558.1_5 Reverse -180 -199 22.8122 0.00172
NP_441558.1_5 Forward -193 -174 7.07928 0.195
NP_440209.1_1 Reverse -182 -190 18.1123 0.00295
NP_440209.1_1 Forward -191 -183 18.1123 0.00295
NP_442889.1_8 Forward -194 -180 3.63724 0.273
NP_442889.1_8 Reverse -338 -352 3.34225 0.281
NP_441713.1_1 Forward -197 -178 -13.6686 0.257
NP_440178.1_7 Reverse -181 -200 -1.96717 0.0334
NP_440178.1_7 Forward -192 -173 -21.535 0.229
NP_442059.1_10 Reverse -267 -286 10.7175 0.239
NP_442445.1_1 Forward -106 -87 11.4058 0.271
NP_441716.1_1 Forward -191 -177 4.12949 0.258
NP_442111.1_4 Forward -192 -178 10.816 0.0518
NP_441533.1_9 Reverse -280 -299 14.7491 0.3
NP_440906.1_5 Forward -190 -183 15.8704 0.0124
NP_440906.1_5 Reverse -183 -190 15.8704 0.0124
NP_440747.1_10 Reverse -179 -191 -1.92764 0.0192
NP_440747.1_10 Forward -194 -182 -2.02597 0.0196
NP_441130.1_10 Forward -193 -179 18.5841 0.0133
NP_441130.1_10 Reverse -180 -194 10.521 0.112
NP_441486.1_1 Forward -194 -180 -3.44199 0.178
NP_441486.1_1 Reverse -179 -193 -4.4253 0.198
NP_442634.1_4 Forward -193 -179 4.52282 0.0764
NP_442634.1_4 Reverse -180 -194 4.22782 0.0819
NP_442634.1_4 Reverse -5 -19 -4.4253 0.201
NP_441265.1_3 Reverse -176 -190 3.04785 0.181
NP_441014.1_8 Reverse -56 -75 -8.94866 0.288
NP_441014.1_10 Reverse -181 -200 0.392004 0.243
NP_442848.1_1 Forward -197 -183 5.21113 0.0859
NP_442848.1_1 Reverse -176 -190 -1.8687 0.263
NP_443018.1_3 Forward -190 -183 14.8871 0.0123
NP_443018.1_3 Reverse -183 -190 14.8871 0.0123
NP_441316.1_7 Forward -193 -178 3.91314 0.137
NP_441634.1_8 Reverse -180 -194 5.60446 0.114
NP_441634.1_8 Forward -193 -179 -3.63866 0.295
NP_441182.1_3 Reverse -106 -124 14.3755 0.241
NP_440376.1_1 Forward -191 -182 19.4693 0.000692
NP_440376.1_1 Reverse -182 -191 19.4693 0.000692
NP_441588.1_4 Reverse -65 -75 7.94484 0.164
NP_441588.1_4 Reverse -184 -194 6.96153 0.178
NP_442687.1_7 Forward -192 -182 15.8113 0.0125
NP_442687.1_7 Reverse -181 -191 9.02648 0.0994
NP_442687.1_7 Reverse -270 -280 5.28991 0.211
NP_442191.1_4 Forward -190 -176 14.7744 0.0779
NP_441846.1_10 Reverse -99 -118 -16.4218 0.256
NP_442958.1_3 Reverse -171 -190 8.94757 0.142
NP_442770.1_10 Forward -89 -75 19.3965 0.0525
NP_441422.1_7 Reverse -180 -197 -3.20608 0.23
NP_441422.1_7 Forward -193 -176 -3.79607 0.235
NP_441950.1_5 Forward -149 -130 15.9007 0.252
NP_442658.1_1 Forward -193 -183 18.7607 0.00222
NP_442658.1_1 Reverse -180 -190 15.9091 0.00966
NP_442782.1_2 Reverse -292 -306 2.35953 0.275
NP_442205.1_9 Forward -197 -181 7.33503 0.105
NP_440720.1_1 Reverse -171 -190 20.2556 0.0287
NP_441487.1_9 Forward -192 -173 -2.45882 0.293
NP_442937.1_5 Forward -196 -177 12.0942 0.119
NP_441958.1_5 Reverse -181 -191 21.2195 0.000805
NP_441958.1_5 Forward -192 -182 12.2714 0.00183
NP_442836.1_5 Reverse -176 -195 0.982764 0.289
NP_440203.1_5 Forward -188 -178 11.8776 0.171
NP_439905.1_1 Forward -190 -177 9.95071 0.216
NP_440995.1_8 Reverse -210 -229 -0.787193 0.288
NP_440984.1_7 Reverse -177 -191 13.2743 0.116
NP_440984.1_7 Forward -196 -182 6.88276 0.195
NP_442911.1_2 Forward -201 -182 -0.295539 0.0737
NP_442911.1_2 Reverse -172 -191 -0.787193 0.0786
NP_441580.1_6 Forward -202 -183 2.0644 0.117
NP_440153.1_5 Forward -190 -176 15.0442 0.0551
NP_440153.1_5 Reverse -183 -197 2.65453 0.219
NP_441591.1_10 Reverse -180 -199 7.07928 0.275
NP_443055.1_6 Forward -199 -181 1.49337 0.23
NP_440993.1_2 Reverse -177 -193 23.363 0.0115
NP_440993.1_2 Forward -196 -180 3.00846 0.262
NP_440993.1_3 Reverse -172 -191 -1.67294 0.29
NP_442002.1_9 Forward -192 -185 10.7572 0.185
NP_441294.1_7 Forward -195 -181 13.7621 0.0568
NP_441646.1_1 Forward -132 -113 -0.197208 0.259
NP_442438.1_10 Forward -196 -182 12.1926 0.0412
NP_442438.1_10 Reverse -177 -191 10.3243 0.0547
NP_442438.1_10 Reverse -318 -332 -0.885388 0.283
NP_441752.1_5 Reverse -299 -318 11.1109 0.119
NP_441000.1_6 Reverse -181 -195 5.1128 0.0933
NP_441000.1_6 Forward -192 -178 -5.70361 0.29
NP_442771.1_1 Forward -193 -175 -4.79907 0.166
NP_440147.1_4 Forward -193 -180 12.2123 0.0326
NP_440147.1_4 Reverse -180 -193 11.819 0.0326
NP_441550.1_8 Reverse -180 -190 17.4824 0.00754
NP_441550.1_8 Forward -193 -183 10.501 0.066
NP_441916.1_7 Forward -191 -181 18.9579 0.00144
NP_441916.1_7 Reverse -182 -192 18.4663 0.00144
NP_441916.1_10 Reverse -278 -297 3.73603 0.227
NP_440465.1_4 Forward -192 -173 10.4225 0.26
NP_440465.1_10 Reverse -179 -198 9.83255 0.173
NP_441041.1_4 Reverse -182 -201 -10.0303 0.227
NP_441041.1_7 Forward -194 -182 19.5648 0.00277
NP_441041.1_7 Reverse -179 -191 8.97244 0.125
NP_442396.1_5 Forward -129 -116 6.50913 0.234
NP_442004.1_6 Forward -191 -177 7.07942 0.165
NP_441725.1_5 Reverse -183 -193 9.02648 0.0553
NP_441725.1_5 Forward -190 -180 8.92815 0.0553
NP_439966.1_7 Forward -193 -183 17.4824 0.00636
NP_439966.1_7 Reverse -180 -190 13.8442 0.0234
NP_439966.1_9 Forward -193 -184 10.7178 0.0863
NP_439966.1_9 Reverse -180 -189 0.983037 0.253
NP_442941.1_3 Forward -190 -180 10.9931 0.0116
NP_442941.1_3 Reverse -183 -193 2.53664 0.14
NP_440289.1_2 Forward -194 -181 12.9006 0.0132
NP_440289.1_2 Reverse -179 -192 -4.40561 0.288
NP_442281.1_1 Forward -196 -182 16.8135 0.00698
NP_442281.1_1 Reverse -177 -191 6.29216 0.13
NP_441334.1_7 Forward -193 -174 6.78429 0.0214
NP_441334.1_7 Reverse -180 -199 -18.5851 0.275
NP_442256.1_2 Forward -193 -175 -5.58572 0.214
NP_440437.1_1 Reverse -176 -195 3.73603 0.116
NP_442012.1_1 Reverse -176 -195 7.57094 0.11
NP_441457.1_7 Reverse -180 -199 17.5024 0.0397
NP_440498.1_1 Forward -200 -182 -2.3408 0.241
NP_442982.1_5 Reverse -172 -191 5.70265 0.156
NP_442982.1_5 Reverse -87 -106 -3.24547 0.297
NP_441644.1_6 Forward -191 -181 19.0557 0.000803
NP_441644.1_6 Reverse -182 -192 10.1076 0.0628
NP_442215.1_2 Forward -193 -177 -1.71142 0.187
NP_442215.1_2 Forward -296 -280 -7.31629 0.291
NP_440253.1_2 Reverse -182 -200 6.214 0.0836
NP_440929.1_8 Forward -191 -182 19.2726 0.000701
NP_440929.1_8 Reverse -182 -191 19.2726 0.000701
NP_442933.1_10 Forward -191 -182 17.601 0.00325
NP_442933.1_10 Reverse -182 -191 17.601 0.00325
NP_441751.2_8 Reverse -183 -197 -5.40861 0.206
NP_442554.1_8 Forward -190 -180 19.1546 0.00369
NP_442554.1_8 Reverse -183 -193 16.008 0.0065
NP_441762.1_7 Reverse -181 -193 12.527 0.0142
NP_441762.1_7 Forward -192 -180 11.7404 0.0142
NP_442142.1_4 Forward -194 -181 14.4733 0.0311
NP_442142.1_4 Reverse -60 -73 10.1468 0.079
NP_442142.1_4 Reverse -179 -192 6.31189 0.169
NP_442292.1_1 Forward -190 -181 17.5026 0.00435
NP_442292.1_1 Reverse -183 -192 9.63616 0.0183
NP_440919.1_7 Reverse -33 -51 4.19764 0.298
NP_442476.1_6 Reverse -183 -197 3.44117 0.156
NP_440895.1_10 Reverse -181 -198 3.57876 0.149
NP_442381.1_8 Forward -194 -175 -11.5053 0.263
NP_441711.1_4 Reverse -173 -192 6.88262 0.144
NP_443009.1_5 Reverse -181 -192 19.626 0.00102
NP_443009.1_5 Forward -192 -181 7.82632 0.118
NP_442408.2_1 Forward -191 -172 6.39097 0.143
NP_441715.1_4 Reverse -183 -193 9.32148 0.097
NP_441715.1_4 Forward -190 -180 7.25653 0.108
NP_440730.1_1 Forward -130 -111 23.9922 0.0156
NP_440730.1_2 Forward -70 -51 30.6787 0.0000908
NP_440730.1_5 Forward -90 -71 21.1406 0.0778
NP_441198.1_5 Forward -189 -176 12.2117 0.228
NP_441198.1_8 Reverse -180 -190 15.4199 0.0427
NP_441468.1_1 Forward -190 -183 15.8704 0.0124
NP_441468.1_1 Reverse -183 -190 15.8704 0.0124
NP_441020.2_6 Reverse -180 -197 16.9518 0.0231
NP_441020.2_6 Forward -193 -176 10.3636 0.146
NP_441015.1_10 Forward -196 -177 -4.52377 0.205
NP_441673.1_1 Forward -191 -182 20.8459 0.000698
NP_441673.1_1 Reverse -182 -191 20.8459 0.000698
NP_441826.1_2 Reverse -176 -190 5.50613 0.0975
NP_441826.1_2 Forward -197 -183 2.65453 0.123
NP_441764.1_6 Forward -346 -335 16.8733 0.253
NP_442868.1_6 Reverse -180 -190 8.63316 0.0555
NP_442868.1_6 Forward -193 -183 8.53483 0.0555
NP_441056.1_1 Forward -398 -379 -6.39206 0.27
NP_442559.1_3 Reverse -158 -177 7.86593 0.291
NP_442808.1_1 Forward -192 -182 18.4657 0.00201
NP_442808.1_1 Reverse -181 -191 8.73102 0.0481
NP_442542.1_9 Reverse -175 -189 17.8952 0.042
NP_442050.1_5 Reverse -180 -190 17.1874 0.00812
NP_442050.1_5 Forward -193 -183 8.23937 0.234
NP_442342.1_9 Forward -193 -177 2.41848 0.29
NP_440558.1_2 Reverse -299 -318 -1.86883 0.218
NP_442789.1_4 Forward -193 -174 -7.96535 0.299
NP_441518.1_3 Forward -201 -182 1.67108 0.0649
NP_441878.1_6 Reverse -181 -191 10.5014 0.0176
NP_441878.1_6 Forward -192 -182 10.4031 0.0176
NP_441036.1_8 Forward -192 -182 17.7779 0.000554
NP_441036.1_8 Reverse -181 -191 15.713 0.00724
NP_441557.1_5 Forward -191 -182 19.9609 0.000699
NP_441557.1_5 Reverse -182 -191 19.9609 0.000699
NP_442066.2_9 Forward -195 -182 8.47575 0.185
NP_442795.1_5 Reverse -292 -311 16.8141 0.0811
NP_442795.1_10 Reverse -306 -325 13.9625 0.28
NP_442419.1_2 Reverse -177 -196 6.58763 0.152
NP_441739.1_2 Reverse -70 -86 2.12282 0.288
NP_441308.1_8 Reverse -180 -190 12.4681 0.218
NP_441308.1_8 Forward -193 -183 9.22315 0.226
NP_440101.1_10 Forward -197 -178 13.4708 0.135
NP_442183.1_1 Reverse -182 -196 16.6175 0.0139
NP_442183.1_1 Forward -191 -177 8.45605 0.115
NP_441407.1_7 Reverse -111 -129 15.4571 0.162
NP_441407.1_8 Reverse -52 -71 19.6656 0.117
NP_441549.1_9 Forward -195 -177 -10.0106 0.268
NP_441467.1_3 Reverse -69 -88 16.7157 0.216
NP_442347.1_2 Reverse -183 -192 11.1111 0.056
NP_442347.1_2 Forward -190 -181 3.34298 0.284
NP_440547.1_1 Reverse -101 -120 11.0117 0.214
NP_442888.1_6 Reverse -281 -300 2.94938 0.244
NP_441037.1_4 Reverse -180 -190 16.5761 0.0168
NP_441037.1_4 Forward -193 -183 16.2838 0.0168
NP_442317.1_6 Reverse -177 -196 3.73603 0.262
NP_441633.1_3 Forward -193 -180 5.91914 0.0481
NP_441633.1_3 Reverse -180 -193 3.95252 0.0699
NP_440136.1_2 Forward -190 -183 15.9687 0.0123
NP_440136.1_2 Reverse -183 -190 15.9687 0.0123
NP_442998.1_5 Reverse -133 -143 9.81313 0.233
NP_442998.1_10 Forward -189 -182 15.5754 0.0102
NP_442998.1_10 Reverse -184 -191 15.5754 0.0102
NP_440899.1_8 Forward -298 -279 -2.26216 0.221
NP_440299.1_1 Reverse -178 -191 10.3434 0.0573
NP_441799.1_1 Reverse -178 -192 11.2087 0.0606
NP_441799.1_1 Forward -195 -181 10.0287 0.0797
NP_441007.1_10 Reverse -177 -190 11.1307 0.0646
NP_441007.1_10 Forward -196 -183 5.52582 0.18
NP_440256.1_1 Reverse -179 -198 1.27776 0.077
NP_440256.1_1 Forward -194 -175 -8.16202 0.253
NP_441559.1_8 Reverse -177 -191 1.17956 0.156
NP_441559.1_8 Forward -306 -292 0.196253 0.169
NP_440915.1_6 Forward -195 -181 15.4376 0.0183
NP_440915.1_6 Reverse -178 -192 5.60446 0.088
NP_441296.1_9 Forward -51 -38 12.5067 0.22
NP_442452.1_8 Reverse -176 -190 13.6669 0.273
NP_440748.1_5 Reverse -100 -119 -1.08219 0.267
NP_441464.1_8 Reverse -182 -196 10.521 0.178
NP_441939.1_3 Forward -190 -171 19.0757 0.0131
NP_441939.1_3 Reverse -183 -202 10.6192 0.123
NP_441199.1_6 Reverse -178 -197 1.37609 0.22
NP_441494.1_6 Reverse -177 -190 15.8506 0.125
NP_442993.1_1 Reverse -182 -198 -0.0397962 0.0684
NP_442993.1_1 Forward -150 -134 -9.28291 0.181
NP_442386.1_9 Forward -192 -183 15.7322 0.0144
NP_442386.1_9 Reverse -181 -190 6.39082 0.219
NP_441340.1_5 Forward -190 -183 15.6737 0.0124
NP_441340.1_5 Reverse -183 -190 15.6737 0.0124
NP_442240.1_1 Reverse -174 -193 5.01354 0.265
NP_442240.1_2 Forward -190 -171 -15.4385 0.212
NP_440161.1_3 Forward -177 -158 8.35759 0.273
NP_440586.1_8 Forward -190 -183 13.2151 0.026
NP_440586.1_8 Reverse -183 -190 13.2151 0.026
NP_442251.1_6 Forward -190 -183 15.2804 0.0124
NP_442251.1_6 Reverse -183 -190 15.2804 0.0124
NP_441262.1_3 Reverse -182 -189 14.7888 0.0223
NP_441262.1_3 Forward -191 -184 14.7888 0.0223
NP_443051.1_1 Reverse -181 -190 19.5676 0.00335
NP_443051.1_1 Forward -192 -183 10.4228 0.00754
NP_439937.1_9 Forward -192 -175 -8.02495 0.173
NP_441595.1_2 Reverse -73 -86 9.89744 0.277
NP_441595.1_2 Forward -86 -73 9.89744 0.277
NP_441595.1_5 Reverse -175 -193 17.5221 0.122
NP_440439.1_1 Reverse -179 -192 19.7838 0.0105
NP_440439.1_1 Forward -194 -181 9.36073 0.0465
NP_440372.1_2 Forward -190 -183 16.3621 0.0124
NP_440372.1_2 Reverse -183 -190 16.3621 0.0124
NP_441803.1_2 Forward -196 -177 5.50599 0.169
NP_441803.1_2 Reverse -177 -196 4.22769 0.18
NP_439977.1_5 Forward -197 -178 14.1591 0.0531
NP_442384.1_10 Forward -191 -178 10.934 0.0399
NP_442114.1_4 Reverse -182 -193 12.1534 0.107
NP_442262.1_10 Forward -190 -183 14.1988 0.0123
NP_442262.1_10 Reverse -183 -190 14.1988 0.0123
NP_441689.1_5 Reverse -180 -190 8.43603 0.132
NP_441689.1_5 Reverse -283 -293 5.38779 0.265
NP_442244.1_3 Forward -188 -169 7.7676 0.177
NP_440344.1_10 Forward -198 -181 0.235503 0.0365
NP_440344.1_10 Reverse -175 -192 -9.99092 0.163
NP_442123.1_3 Reverse -182 -201 17.109 0.0891
NP_440487.1_1 Forward -194 -175 -3.24547 0.214
NP_440562.1_3 Forward -190 -173 8.20031 0.15
NP_442529.1_4 Forward -200 -181 7.66927 0.289
NP_440297.1_9 Reverse -183 -193 -0.216628 0.282
NP_440297.1_9 Forward -190 -180 -0.314959 0.282
NP_441896.1_3 Forward -200 -181 9.53756 0.0872
NP_441896.1_3 Reverse -173 -192 2.3594 0.197
NP_440700.1_5 Forward -285 -266 17.109 0.209
NP_440894.1_10 Reverse -177 -196 2.75272 0.283
NP_440894.1_10 Forward -196 -177 2.16274 0.294
NP_440999.1_9 Forward -195 -181 11.6026 0.0438
NP_440999.1_9 Reverse -178 -192 2.94952 0.14
NP_440888.1_2 Forward -191 -177 19.6651 0.00106
NP_440888.1_2 Reverse -182 -196 16.5185 0.00647
NP_440491.1_1 Forward -194 -175 11.4975 0.17
NP_440491.1_1 Reverse -261 -280 10.5229 0.184
NP_442277.1_4 Reverse -173 -192 12.585 0.0645
NP_442033.1_10 Forward -193 -174 5.01433 0.0796
NP_441543.1_2 Reverse -183 -192 18.486 0.00236
NP_441543.1_2 Forward -190 -181 15.9293 0.00518
NP_442845.1_2 Reverse -176 -190 5.1128 0.243
NP_442845.1_2 Reverse -44 -58 3.73617 0.279
NP_441551.1_5 Forward -195 -179 8.02265 0.241
NP_441469.1_8 Forward -192 -183 16.126 0.00797
NP_441469.1_8 Reverse -181 -190 6.5879 0.227
NP_443064.1_6 Forward -191 -181 10.8217 0.13
NP_442578.1_7 Forward -190 -183 14.5921 0.026
NP_442578.1_7 Reverse -183 -190 14.5921 0.026
NP_442578.1_7 Forward -397 -390 9.38056 0.138
NP_441462.1_2 Forward -191 -181 20.2362 0.000805
NP_441462.1_2 Reverse -182 -192 11.5831 0.00406
NP_441621.1_7 Forward -193 -179 13.9626 0.0266
NP_441621.1_7 Reverse -180 -194 6.48943 0.068
NP_443062.1_1 Reverse -182 -200 5.03566 0.242
NP_442204.1_1 Reverse -178 -189 10.1868 0.0736
NP_442204.1_5 Reverse -172 -191 17.5024 0.0348
NP_442204.1_5 Forward -201 -182 1.0811 0.246
NP_440504.1_7 Reverse -43 -62 -4.81876 0.295
NP_441351.1_8 Reverse -180 -199 -0.197208 0.296
NP_440516.1_8 Forward -191 -182 16.9127 0.00442
NP_440516.1_8 Reverse -182 -191 16.9127 0.00442
NP_442428.1_5 Forward -190 -183 15.8704 0.0124
NP_442428.1_5 Reverse -183 -190 15.8704 0.0124
NP_442120.1_10 Forward -197 -178 -6.98204 0.217
NP_440673.1_2 Reverse -313 -332 8.63366 0.264
NP_440673.1_3 Forward -189 -182 12.4288 0.0426
NP_440673.1_3 Reverse -184 -191 12.4288 0.0426
NP_440673.1_7 Reverse -171 -190 6.58763 0.155
NP_440865.1_9 Forward -197 -178 2.16274 0.116
NP_441052.1_2 Reverse -182 -192 10.5014 0.0285
NP_441052.1_2 Forward -191 -181 10.4031 0.0285
NP_442219.1_9 Reverse -183 -192 8.35786 0.0681
NP_442219.1_9 Forward -190 -181 8.25953 0.0681
NP_440436.1_4 Reverse -183 -192 18.1905 0.00233
NP_440436.1_4 Forward -190 -181 9.24241 0.0871
NP_441884.1_8 Reverse -181 -200 -7.76869 0.254
NP_441884.1_9 Forward -194 -175 15.8307 0.0078
NP_442907.1_2 Reverse -183 -201 12.4089 0.181
NP_441719.1_4 Forward -190 -183 16.3621 0.0124
NP_441719.1_4 Reverse -183 -190 16.3621 0.0124
NP_441733.1_10 Forward -194 -181 10.5407 0.106
NP_441733.1_10 Reverse -179 -192 9.06573 0.127
NP_442813.1_4 Forward -289 -270 -0.39387 0.225
NP_442813.1_4 Forward -296 -277 -8.94866 0.299
NP_442366.1_3 Forward -192 -174 4.05072 0.101
NP_441034.1_4 Reverse -177 -196 16.3877 0.148
NP_440296.1_10 Forward -194 -175 -5.31042 0.225
NP_441115.1_4 Forward -192 -174 20.5695 0.00493
NP_442694.1_4 Reverse -329 -338 11.4061 0.277
NP_443054.1_2 Reverse -180 -194 12.586 0.0722
NP_441851.1_10 Forward -192 -182 16.008 0.00552
NP_441851.1_10 Reverse -181 -191 8.53483 0.114
NP_441851.1_10 Forward -60 -50 4.89658 0.24
NP_442622.1_1 Reverse -181 -200 -11.6036 0.257
NP_441668.1_4 Reverse -29 -48 4.71934 0.173
NP_441668.1_4 Forward -304 -285 -0.688862 0.261
NP_442515.1_1 Forward -125 -111 5.60446 0.107
NP_442515.1_1 Reverse -181 -195 -3.34366 0.29
NP_442515.1_1 Forward -192 -178 -4.13031 0.298
NP_440593.1_3 Forward -106 -87 -0.0988766 0.199
NP_440593.1_3 Reverse -177 -196 -1.27885 0.211
NP_442709.1_3 Reverse -127 -146 5.99764 0.174
NP_440940.1_7 Forward -201 -183 12.4081 0.0927
NP_441349.1_10 Reverse -172 -191 -0.0988766 0.0928
NP_441409.1_6 Reverse -176 -195 -11.1119 0.215
NP_440389.1_5 Reverse -175 -194 16.1751 0.189
NP_440432.1_9 Reverse -183 -198 7.94471 0.0427
NP_440432.1_9 Forward -190 -175 -0.905081 0.167
NP_440474.1_8 Reverse -183 -197 11.897 0.0963
NP_440474.1_8 Forward -190 -176 5.40719 0.25
NP_440588.1_2 Reverse -173 -192 9.53756 0.0442
NP_441570.1_1 Reverse -182 -200 0.805796 0.0361
NP_441570.1_1 Forward -191 -173 -9.51896 0.139
NP_441078.1_4 Forward -191 -182 19.6659 0.0007
NP_441078.1_4 Reverse -182 -191 19.6659 0.0007
NP_440526.1_3 Reverse -183 -194 11.7595 0.0646
NP_440526.1_3 Reverse -51 -62 7.33466 0.153
NP_440526.1_3 Forward -190 -179 2.31981 0.267
NP_441432.1_8 Reverse -181 -190 16.8143 0.00595
NP_441432.1_8 Forward -192 -183 8.25953 0.0755
NP_442320.1_8 Forward -197 -183 16.5192 0.00763
NP_442320.1_8 Reverse -176 -190 -2.85201 0.1
NP_442344.1_7 Reverse -183 -202 0.491109 0.0936
NP_441732.1_2 Reverse -178 -194 3.30346 0.0141
NP_441732.1_2 Forward -195 -179 -14.9861 0.145
NP_440760.1_1 Reverse -182 -201 -12.7836 0.0947
NP_441057.1_4 Reverse -166 -184 4.44404 0.231
NP_440913.1_1 Reverse -180 -198 9.95058 0.176
NP_442407.1_8 Forward -191 -172 19.174 0.138
NP_441072.1_2 Forward -202 -183 11.0125 0.189
NP_442489.1_2 Forward -202 -183 3.73603 0.234
NP_442489.1_7 Forward -191 -182 20.1576 0.000695
NP_442489.1_7 Reverse -182 -191 20.1576 0.000695
NP_440559.1_1 Reverse -183 -192 8.75118 0.0586
NP_440559.1_1 Forward -190 -181 8.65285 0.0586
NP_441659.2_8 Forward -191 -181 20.9245 0.000805
NP_441659.2_8 Reverse -182 -192 11.9764 0.0147
NP_442913.1_10 Reverse -173 -192 10.8159 0.0421
NP_439956.1_7 Reverse -297 -316 2.3594 0.275
NP_440779.1_5 Forward -191 -174 -14.2191 0.243
NP_440779.1_5 Reverse -182 -199 -14.5141 0.246
NP_442346.1_5 Reverse -181 -191 16.303 0.00248
NP_442346.1_5 Forward -192 -182 9.02648 0.118
NP_440545.1_3 Forward -195 -178 9.77361 0.0374
NP_440545.1_3 Reverse -178 -195 8.98696 0.0411
NP_440025.1_1 Forward -195 -176 11.8975 0.147
NP_440459.1_1 Forward -128 -109 16.8141 0.216
NP_440459.1_2 Reverse -283 -300 14.0018 0.119
NP_440459.1_2 Forward -326 -309 7.31533 0.296
NP_441653.1_2 Forward -202 -183 9.13438 0.161
NP_441943.1_10 Reverse -70 -84 19.7634 0.121
NP_442603.1_7 Forward -191 -177 12.782 0.0948
NP_440449.1_6 Reverse -174 -192 18.5657 0.065
NP_441948.1_4 Forward -198 -180 -0.964162 0.14
NP_441833.1_4 Forward -190 -183 15.9687 0.0124
NP_441833.1_4 Reverse -183 -190 15.9687 0.0124
NP_442162.1_9 Forward -190 -183 16.2637 0.0124
NP_442162.1_9 Reverse -183 -190 16.2637 0.0124
NP_440671.1_4 Forward -197 -183 6.98109 0.23
NP_442546.1_2 Forward -145 -126 1.6703 0.29
NP_442199.1_5 Forward -199 -180 4.71934 0.103
NP_442140.1_3 Reverse -183 -193 17.4829 0.0159
NP_442140.1_3 Forward -190 -180 7.94484 0.124
NP_441671.1_1 Reverse -186 -205 -1.37718 0.288
NP_440875.1_9 Reverse -184 -194 17.619 0.0104
NP_440875.1_9 Forward -189 -179 14.5042 0.0411
NP_441813.1_5 Forward -193 -183 10.0098 0.0208
NP_441813.1_5 Reverse -180 -190 8.73149 0.0367
NP_440590.1_4 Forward -190 -177 12.999 0.013
NP_440590.1_4 Reverse -183 -196 11.9173 0.0173
NP_440567.1_1 Forward -190 -176 17.6008 0.0153
NP_440567.1_1 Reverse -183 -197 4.42448 0.121
NP_442497.1_10 Forward -190 -181 17.601 0.00813
NP_442497.1_10 Reverse -183 -192 10.4228 0.0087
NP_440821.1_4 Forward -193 -183 18.7612 0.00422
NP_440821.1_4 Reverse -180 -190 10.7964 0.0146
NP_441239.1_9 Reverse -180 -192 17.4436 0.0146
NP_441239.1_9 Forward -193 -181 16.0669 0.0175
NP_440706.1_1 Reverse -178 -197 -2.75381 0.258
NP_441892.1_1 Forward -200 -183 4.07041 0.116
NP_441892.1_1 Reverse -173 -190 -5.07437 0.273
NP_441892.1_10 Forward -301 -282 9.53756 0.291
NP_440665.1_1 Forward -121 -102 -14.1602 0.261
NP_440604.1_6 Forward -191 -172 0.294447 0.166
NP_440354.1_7 Reverse -176 -194 7.29564 0.269
NP_441617.1_6 Forward -301 -282 -6.09707 0.278
NP_440546.1_4 Forward -191 -181 13.5365 0.0459
NP_440546.1_4 Reverse -182 -192 11.8882 0.0679
NP_440546.1_6 Forward -170 -151 10.8159 0.245
NP_441230.1_5 Forward -196 -177 4.71934 0.185
NP_440462.1_6 Reverse -180 -190 19.4496 0.00371
NP_440462.1_6 Forward -193 -183 17.9746 0.00578
NP_442611.1_1 Forward -191 -172 -1.67217 0.282
NP_440868.1_4 Reverse -178 -190 9.97041 0.0405
NP_440868.1_4 Forward -195 -183 9.77374 0.043
NP_441582.1_5 Forward -193 -174 7.07848 0.187
NP_442402.1_10 Reverse -118 -128 11.6809 0.241
NP_441084.1_6 Reverse -283 -297 11.3802 0.205
NP_441084.1_6 Reverse -180 -194 11.2833 0.208
NP_441084.1_6 Reverse -125 -139 10.6046 0.234
NP_441843.2_9 Reverse -184 -202 18.0785 0.0976
NP_441843.2_9 Reverse -266 -284 9.5194 0.284
NP_442039.1_4 Forward -190 -183 15.1821 0.0124
NP_442039.1_4 Reverse -183 -190 15.1821 0.0124
NP_442837.1_3 Forward -190 -183 15.7721 0.0124
NP_442837.1_3 Reverse -183 -190 15.7721 0.0124
NP_439994.1_3 Forward -192 -173 13.2186 0.129
NP_442053.1_1 Forward -191 -182 18.3876 0.0007
NP_442053.1_1 Reverse -182 -191 18.3876 0.0007
NP_440505.1_3 Reverse -180 -190 15.418 0.0114
NP_440505.1_3 Forward -193 -183 14.1397 0.0235
NP_440505.1_7 Forward -305 -286 5.50599 0.183
NP_441203.1_1 Forward -190 -171 -2.75381 0.0655
NP_442532.1_7 Forward -191 -177 6.29277 0.171
NP_442532.1_7 Reverse -182 -196 6.19444 0.171
NP_440914.1_1 Forward -191 -181 16.3248 0.00196
NP_440914.1_1 Reverse -182 -192 8.6151 0.186
NP_441011.1_8 Reverse -183 -192 16.9127 0.00602
NP_441011.1_8 Forward -190 -181 16.6177 0.00602
NP_442533.1_6 Forward -191 -182 17.2076 0.00137
NP_442533.1_6 Reverse -182 -191 17.2076 0.00137
NP_442232.1_3 Reverse -174 -193 -15.4385 0.291
NP_442232.1_9 Reverse -373 -392 13.6666 0.224
NP_442229.1_1 Reverse -180 -194 8.94708 0.184
NP_441482.1_7 Forward -197 -183 -8.5552 0.193
NP_441482.1_7 Reverse -176 -190 -10.2268 0.209
NP_439944.1_9 Forward -190 -180 17.7779 0.00341
NP_439944.1_9 Reverse -183 -193 10.4031 0.0887
NP_441527.1_4 Reverse -272 -291 -4.72727 0.188
NP_441527.1_4 Forward -347 -328 -10.9342 0.277
NP_440115.1_6 Reverse -179 -189 16.008 0.0325
NP_440007.1_9 Forward -315 -301 5.01447 0.266
NP_440007.1_9 Forward -304 -290 3.53951 0.269
NP_443045.1_5 Forward -106 -93 14.2391 0.275
NP_441602.1_3 Forward -196 -177 11.3075 0.111
NP_441602.1_3 Reverse -177 -196 -1.37718 0.226
NP_441602.1_4 Forward -202 -183 11.0125 0.278
NP_441972.1_5 Reverse -183 -202 -4.52377 0.211
NP_441106.1_1 Reverse -181 -190 18.486 0.0028
NP_441106.1_1 Forward -192 -183 18.191 0.0028
NP_442306.1_10 Reverse -177 -196 0.0977854 0.0484
NP_441286.1_1 Reverse -181 -193 5.34885 0.0259
NP_441286.1_1 Forward -192 -180 5.15219 0.0259
NP_440670.1_8 Forward -191 -182 18.3876 0.000699
NP_440670.1_8 Reverse -182 -191 18.3876 0.000699
NP_440886.1_7 Forward -192 -182 17.7774 0.0011
NP_440886.1_7 Reverse -181 -191 8.04271 0.0805
NP_442614.1_2 Forward -273 -259 8.55439 0.255
NP_440205.1_4 Reverse -126 -145 14.6508 0.238
NP_442072.1_9 Reverse -181 -199 -4.20908 0.0413
NP_442072.1_9 Forward -192 -174 -12.4689 0.0852
NP_440513.1_6 Reverse -172 -191 9.34008 0.27
NP_441753.1_10 Reverse -173 -192 6.39097 0.186
NP_440907.2_8 Forward -190 -180 19.1541 0.00362
NP_440907.2_8 Reverse -183 -193 17.4824 0.00685
NP_441021.1_1 Forward -190 -171 -11.2103 0.258
NP_441021.1_8 Reverse -177 -195 4.05072 0.225
NP_441463.1_3 Forward -201 -182 -0.295539 0.132
NP_441463.1_6 Forward -314 -300 7.28563 0.262
NP_441626.1_2 Forward -190 -183 15.7721 0.0124
NP_441626.1_2 Reverse -183 -190 15.7721 0.0124
NP_442615.1_1 Reverse -173 -191 5.32902 0.0393
NP_442615.1_1 Forward -200 -182 3.75572 0.0518
NP_441962.1_4 Reverse -177 -196 -5.31042 0.167
NP_440387.1_1 Forward -191 -175 17.1681 0.0044
NP_440387.1_1 Reverse -182 -198 -2.49807 0.148
NP_441431.1_2 Forward -194 -180 15.0436 0.0537
NP_441431.1_2 Reverse -179 -193 13.372 0.0918
NP_441488.1_7 Reverse -176 -195 11.2092 0.113
NP_441993.1_1 Reverse -176 -195 5.06532 0.208
NP_441993.1_1 Reverse -182 -201 1.55686 0.274
NP_441993.1_1 Reverse -179 -198 0.972113 0.288
NP_441174.1_2 Reverse -179 -193 21.2391 0.00172
NP_440114.1_10 Reverse -182 -196 17.2075 0.0116
NP_440114.1_10 Forward -191 -177 8.35772 0.207
NP_440114.1_10 Reverse -297 -311 7.37441 0.236
NP_442323.1_7 Reverse -297 -316 5.11187 0.209
NP_440287.1_5 Forward -151 -132 7.17681 0.286
NP_440287.1_6 Reverse -180 -199 6.19431 0.169
NP_440766.1_4 Reverse -178 -192 16.4209 0.0256
NP_439988.1_3 Forward -189 -175 3.73617 0.298
NP_442743.1_4 Forward -190 -171 -5.9004 0.271
NP_441311.1_2 Reverse -176 -190 12.8803 0.23
NP_439910.1_2 Forward -199 -182 -3.79607 0.0691
NP_440457.1_1 Reverse -178 -190 7.31547 0.105
NP_440457.1_1 Forward -68 -56 1.21895 0.244
NP_440798.1_6 Forward -190 -177 11.524 0.0592
NP_440798.1_6 Reverse -183 -196 2.47756 0.17
NP_441984.1_9 Reverse -184 -203 18.1898 0.188
NP_440473.1_9 Forward -202 -183 -9.24366 0.26
NP_442509.1_9 Reverse -182 -192 16.2041 0.00739
NP_442509.1_9 Forward -191 -181 8.04271 0.192
NP_440554.1_4 Forward -190 -180 15.418 0.0199
NP_440554.1_4 Reverse -183 -193 13.943 0.0218
NP_442862.1_3 Forward -142 -125 5.05372 0.28
NP_441761.1_1 Reverse -303 -322 3.73603 0.265
NP_441885.1_5 Reverse -182 -192 11.4848 0.00668
NP_441885.1_5 Forward -191 -181 11.3864 0.00668
NP_440478.1_10 Forward -193 -179 7.27608 0.264
NP_441428.1_8 Forward -199 -180 11.9958 0.168
NP_442341.1_7 Forward -192 -178 12.3893 0.0454
NP_442341.1_7 Reverse -181 -195 3.8345 0.21
NP_441756.1_5 Forward -195 -176 -4.22878 0.294
NP_441756.1_5 Forward -110 -91 -4.42544 0.294
NP_441173.1_9 Forward -320 -312 9.85212 0.275
NP_442534.1_7 Reverse -174 -193 10.9142 0.192
NP_440409.1_1 Reverse -174 -193 0.884433 0.209
NP_440423.1_10 Reverse -374 -393 9.63589 0.26
NP_443000.1_7 Reverse -180 -190 10.7964 0.0345
NP_443000.1_7 Forward -193 -183 2.04498 0.226
NP_443000.1_7 Forward -231 -221 1.65166 0.235
NP_441842.1_1 Forward -189 -176 14.67 0.0969
NP_441842.1_10 Reverse -175 -189 19.7641 0.0142
NP_441842.1_10 Forward -198 -184 6.19444 0.297
NP_440275.1_3 Reverse -180 -190 18.6629 0.0082
NP_440275.1_3 Forward -193 -183 17.9746 0.0082
NP_440091.1_1 Forward -195 -183 20.1968 0.00953
NP_440091.1_1 Reverse -178 -190 0.825626 0.227
NP_443060.1_1 Forward -135 -116 7.86512 0.3
NP_442451.1_2 Forward -199 -180 0.392778 0.153
NP_442451.1_2 Reverse -174 -193 -9.44032 0.259
NP_439962.1_4 Reverse -174 -193 8.25926 0.134
NP_440804.1_7 Forward -87 -70 12.7228 0.175
NP_440149.1_8 Reverse -182 -201 7.7676 0.0628
NP_440149.1_8 Forward -191 -172 -4.81876 0.213
NP_440149.1_10 Forward -191 -172 -4.52377 0.251
NP_441105.1_3 Reverse -171 -190 -7.57203 0.255
NP_441105.1_3 Forward -38 -19 -8.26035 0.269
NP_441105.1_3 Reverse -81 -100 -9.83364 0.297
NP_440216.1_1 Forward -191 -177 8.25939 0.0061
NP_440216.1_1 Reverse -182 -196 6.29277 0.0156
NP_440172.1_1 Forward -191 -181 17.5813 0.00421
NP_440172.1_1 Forward -294 -284 10.9931 0.0445
NP_440172.1_1 Reverse -182 -192 8.73149 0.0586
NP_442015.1_10 Reverse -178 -191 4.93583 0.156
NP_441226.1_7 Forward -190 -183 14.4934 0.0123
NP_441226.1_7 Reverse -183 -190 14.4934 0.0123
NP_441111.1_7 Forward -190 -182 18.7023 0.00294
NP_441111.1_7 Reverse -183 -191 18.7023 0.00294
NP_442379.1_10 Reverse -175 -192 -1.73112 0.223
NP_441766.1_2 Forward -191 -182 17.5026 0.00297
NP_441766.1_2 Reverse -182 -191 17.5026 0.00297
NP_440416.1_1 Reverse -182 -201 -14.4552 0.288
NP_443052.1_8 Forward -201 -182 -0.4922 0.0697
NP_443052.1_8 Reverse -172 -191 -1.18052 0.0784
NP_440896.1_8 Reverse -266 -285 15.1424 0.202
NP_440261.1_5 Forward -190 -177 6.70579 0.0318
NP_440261.1_5 Reverse -183 -196 -10.6005 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATGCGATAAAACGTTCTTCTGTAGTGGAATCAGGATCAAGCTCGTGAATGGTGAGAGGATCAAAAAAGACCATTTCAGCTTCTGCAAAGGAAATGCCATGCTTTTGCCGATTACTTTTGGCCTTTTGCGGATCATACTCAAACTGCATACATACATAATATGCATTACAAAGTGTTCGGTCAATAAAGGAGTAGTCCTGCACAGAAGCGGCGATCGCCTCCGGGCAACTTTGCAGTGAAGGATCTAGTCGGCTCCCGATTTTTGCCCTGAGTTCGGGAAACCACACTCACCGGGGTGTTGCACTGGGTCAAGCAATTTAGCTAAATTAGCACTCGTGAGGTGGGAGTGCTAAACCCTCTCCCAAATTACTACTGACCTTGCAAGACTATCATCTGGAGG

CDS

ATGACTTCTATGGCCGCTATTTCCATTAATGTTTCTACTGTGAAACCCCTTGGCGATCGGGTGTTTGTGAAAGTAAGCCCCGCTGAAGAAAAAACCGCTGGGGGGATTTTGTTGCCTGATAACGCCAAAGAAAAACCCCAAATTGGTGAAGTTGTCCAAGTGGGCCCCGGCAAACGCAACGACGACGGTACCTACTCCCCTGTGGAAGTCAAAGTGGGCGATAAGGTTCTCTATTCCAAGTATGCCGGCACCGATATCAAACTTGGTGGCGACGACTATGTTCTGTTAACTGAAAAAGATATTTTGGCCTCCGTTGCCTAG

Protein

MTSMAAISINVSTVKPLGDRVFVKVSPAEEKTAGGILLPDNAKEKPQIGEVVQVGPGKRNDDGTYSPVEVKVGDKVLYSKYAGTDIKLGGDDYVLLTEKDILASVA