Your browser is old and dusty. Try Google Chrome!

Details for slr2073

ORF slr2073
Accession NP_440727.1
Symbol ycf50
Category hypothetical protein YCF50
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440295.1_5 Forward -173 -154 15.8299 0.221
NP_441453.1_4 Forward -293 -285 5.0343 0.209
NP_442151.1_6 Forward -83 -69 5.21113 0.288
NP_441818.1_1 Forward -88 -77 8.51463 0.288
NP_441818.1_9 Forward -354 -335 -8.26035 0.276
NP_440120.1_4 Forward -319 -305 15.6342 0.273
NP_001035873.1_1 Forward -359 -340 15.581 0.252
NP_443027.1_4 Reverse -41 -51 6.76487 0.269
NP_441934.1_8 Forward -74 -55 9.83255 0.292
NP_440110.1_8 Reverse -57 -76 2.75272 0.211
NP_441476.1_5 Forward -88 -69 -1.67217 0.205
NP_441476.1_5 Reverse -69 -88 -5.9004 0.271
NP_442062.1_8 Reverse -284 -294 6.37155 0.127
NP_440304.1_4 Reverse -72 -82 6.27322 0.167
NP_441200.1_6 Forward -198 -181 10.3636 0.285
NP_441208.1_9 Reverse -281 -295 4.52282 0.299
NP_442742.1_9 Reverse -54 -73 -5.99873 0.222
NP_441925.1_2 Reverse -115 -134 2.65439 0.262
NP_440769.1_8 Forward -270 -251 10.0292 0.193
NP_441083.1_5 Forward -83 -73 5.78156 0.104
NP_441955.1_8 Forward -77 -60 11.4452 0.207
NP_441444.1_1 Reverse -309 -328 2.26107 0.295
NP_441713.1_1 Reverse -68 -87 -8.35868 0.148
NP_442570.1_3 Forward -91 -72 -4.72043 0.235
NP_441792.1_5 Forward -147 -131 16.0865 0.153
NP_441792.1_5 Reverse -85 -101 8.41667 0.274
NP_442111.1_4 Forward -84 -70 10.1277 0.0562
NP_441486.1_1 Forward -296 -282 -4.7203 0.205
NP_441486.1_1 Reverse -281 -295 -5.60527 0.248
NP_441014.1_10 Reverse -196 -215 -1.27961 0.259
NP_441012.1_4 Reverse -64 -77 6.80412 0.276
NP_443018.1_3 Forward -46 -39 5.34899 0.212
NP_441316.1_7 Forward -295 -280 0.27489 0.193
NP_441634.1_8 Reverse -78 -92 -0.590395 0.262
NP_441634.1_9 Forward -76 -57 7.86512 0.3
NP_440376.1_1 Forward -293 -284 8.35786 0.0441
NP_440376.1_1 Reverse -284 -293 7.76787 0.0688
NP_442687.1_7 Forward -294 -284 10.2065 0.0994
NP_442687.1_7 Reverse -95 -105 10.1081 0.0994
NP_441077.1_6 Forward -283 -267 2.80187 0.276
NP_442958.1_3 Forward -304 -285 -0.39387 0.267
NP_441013.1_3 Forward -105 -86 5.80098 0.281
NP_440533.1_6 Reverse -19 -38 12.1925 0.238
NP_442658.1_1 Reverse -325 -335 5.48612 0.265
NP_442496.1_5 Forward -331 -313 4.34571 0.292
NP_442205.1_9 Reverse -152 -168 2.02515 0.224
NP_442205.1_9 Reverse -28 -44 -0.0397962 0.264
NP_440184.1_7 Reverse -275 -294 13.3189 0.28
NP_442937.1_5 Reverse -69 -88 6.88262 0.268
NP_441958.1_5 Reverse -283 -293 1.84832 0.0729
NP_441958.1_5 Forward -294 -284 -6.90313 0.293
NP_439905.1_2 Reverse -334 -348 9.04604 0.235
NP_442690.1_1 Forward -314 -295 -16.1268 0.283
NP_440993.1_4 Reverse -322 -339 4.07041 0.277
NP_440993.1_4 Reverse -57 -74 2.49712 0.3
NP_441099.1_5 Reverse -64 -83 -7.76869 0.18
NP_441294.1_7 Forward -87 -73 11.7463 0.129
NP_440147.1_4 Forward -85 -72 6.01747 0.106
NP_440147.1_4 Reverse -282 -295 0.60927 0.249
NP_441550.1_8 Reverse -72 -82 7.45273 0.159
NP_441916.1_7 Forward -293 -283 6.8632 0.0816
NP_441041.1_7 Reverse -71 -83 6.05711 0.226
NP_441725.1_5 Forward -82 -72 -0.511621 0.26
NP_442941.1_3 Forward -88 -78 -1.29827 0.297
NP_001035871.2_7 Forward -248 -238 11.6814 0.287
NP_440929.1_8 Forward -293 -284 6.78456 0.082
NP_440929.1_8 Reverse -80 -89 2.94966 0.246
NP_442933.1_3 Reverse -308 -327 15.899 0.261
NP_442142.1_4 Reverse -342 -355 4.24695 0.227
NP_440919.1_7 Forward -299 -281 5.35453 0.286
NP_440183.1_1 Forward -82 -63 8.35759 0.244
NP_441020.2_7 Reverse -329 -348 10.815 0.244
NP_441015.1_8 Forward -77 -58 1.76941 0.272
NP_441015.1_10 Reverse -69 -88 -4.91709 0.214
NP_441673.1_1 Forward -293 -284 1.67135 0.0404
NP_441673.1_1 Reverse -284 -293 1.47469 0.0936
NP_441876.1_9 Forward -42 -32 10.501 0.292
NP_441876.1_9 Forward -51 -41 10.4026 0.293
NP_441826.1_2 Reverse -68 -82 7.9644 0.0819
NP_441826.1_5 Reverse -19 -38 1.47442 0.29
NP_442719.1_2 Reverse -295 -313 -11.8796 0.297
NP_441056.1_1 Forward -83 -64 -8.752 0.283
NP_442427.1_8 Forward -270 -251 7.37428 0.215
NP_442808.1_1 Forward -294 -284 15.6142 0.0219
NP_442808.1_1 Reverse -61 -71 3.12618 0.248
NP_440145.1_4 Forward -82 -72 14.3359 0.245
NP_442050.1_5 Reverse -78 -88 8.92768 0.206
NP_440558.1_2 Reverse -71 -90 1.37609 0.181
NP_442789.1_4 Reverse -57 -76 -7.57203 0.298
NP_441878.1_6 Forward -294 -284 -7.19813 0.21
NP_441878.1_6 Reverse -73 -83 -7.59145 0.245
NP_441878.1_6 Reverse -283 -293 -7.68978 0.255
NP_441036.1_8 Reverse -157 -167 10.1081 0.174
NP_442721.1_3 Forward -142 -123 14.7491 0.223
NP_441557.1_5 Forward -293 -284 0.786375 0.106
NP_441557.1_5 Reverse -284 -293 0.589713 0.134
NP_441433.1_8 Reverse -170 -189 -4.42544 0.294
NP_441433.1_9 Forward -198 -179 19.469 0.204
NP_442962.1_5 Forward -111 -92 10.3242 0.184
NP_440101.1_3 Forward -88 -69 0.687771 0.297
NP_440101.1_10 Forward -354 -335 5.70265 0.208
NP_442192.1_5 Forward -20 -1 7.07928 0.292
NP_442919.1_3 Forward -292 -273 11.5862 0.133
NP_441116.1_9 Forward -262 -248 16.2242 0.157
NP_441574.1_1 Forward -348 -329 -6.58872 0.277
NP_442347.1_2 Reverse -81 -90 7.76787 0.124
NP_440151.1_5 Forward -354 -335 2.85105 0.29
NP_441633.1_3 Forward -85 -72 9.75405 0.0363
NP_440136.1_2 Forward -88 -81 4.16902 0.234
NP_442590.1_10 Forward -111 -92 4.81767 0.27
NP_442998.1_10 Reverse -286 -293 3.97235 0.297
NP_441799.1_1 Reverse -280 -294 11.012 0.0629
NP_441799.1_1 Forward -87 -73 3.44058 0.298
NP_442802.1_2 Forward -334 -315 12.29 0.287
NP_440256.1_1 Reverse -194 -213 -9.53865 0.281
NP_441559.1_8 Reverse -289 -303 -4.22864 0.219
NP_441559.1_8 Reverse -279 -293 -6.19526 0.275
NP_441559.1_8 Reverse -322 -336 -7.57189 0.295
NP_440915.1_6 Reverse -172 -186 3.44117 0.101
NP_442158.1_4 Reverse -14 -24 13.0581 0.239
NP_442785.1_2 Reverse -159 -178 21.4356 0.0489
NP_442785.1_7 Reverse -282 -296 16.6175 0.144
NP_440748.1_5 Reverse -65 -84 1.76941 0.226
NP_441464.1_1 Reverse -323 -342 7.37428 0.262
NP_441939.1_3 Forward -82 -63 5.89931 0.259
NP_441494.1_6 Reverse -69 -82 21.3571 0.0343
NP_442386.1_9 Reverse -79 -88 7.76745 0.217
NP_440570.1_5 Reverse -64 -83 -1.96717 0.277
NP_441271.1_8 Forward -352 -342 14.1397 0.266
NP_443051.1_1 Reverse -283 -292 0.196389 0.213
NP_439937.1_8 Reverse -57 -76 -4.6221 0.286
NP_439937.1_9 Forward -294 -277 -15.8914 0.287
NP_441740.2_10 Forward -89 -70 6.4893 0.286
NP_439943.1_4 Forward -361 -342 5.30933 0.287
NP_440589.1_3 Forward -342 -323 7.47261 0.17
NP_442384.1_10 Forward -293 -280 2.77255 0.213
NP_441018.1_7 Forward -358 -339 10.3242 0.209
NP_442262.1_10 Forward -46 -39 7.6106 0.274
NP_440531.1_6 Reverse -276 -295 10.6192 0.0655
NP_440888.1_2 Forward -185 -171 6.29216 0.241
NP_441543.1_2 Reverse -285 -294 7.37455 0.127
NP_443064.1_6 Forward -83 -73 11.0156 0.13
NP_442337.1_8 Forward -100 -81 -0.983855 0.278
NP_441462.1_2 Forward -293 -283 1.455 0.0898
NP_441621.1_7 Reverse -60 -74 -5.60527 0.256
NP_440939.1_5 Reverse -352 -368 12.8416 0.205
NP_440516.1_2 Forward -299 -281 11.7205 0.0715
NP_440516.1_8 Reverse -74 -83 -0.68859 0.297
NP_442428.1_4 Forward -343 -324 2.75272 0.248
NP_442428.1_5 Reverse -75 -82 3.67736 0.298
NP_441867.1_2 Reverse -65 -84 -11.2103 0.219
NP_441867.1_2 Forward -333 -314 -13.3736 0.277
NP_440673.1_3 Reverse -76 -83 8.20058 0.234
NP_442219.1_9 Reverse -75 -84 5.3096 0.177
NP_441004.1_1 Forward -354 -335 -18.1918 0.298
NP_442813.1_4 Reverse -4 -23 -7.96535 0.299
NP_440129.1_10 Forward -78 -64 5.30946 0.185
NP_442308.1_4 Reverse -68 -87 0.982764 0.267
NP_441851.1_10 Reverse -79 -89 9.61647 0.114
NP_441851.1_10 Forward -294 -284 4.50326 0.266
NP_440593.1_3 Forward -88 -69 8.06259 0.109
NP_441046.1_2 Forward -304 -285 -0.197208 0.276
NP_442689.1_8 Reverse -297 -314 -5.1727 0.268
NP_441349.1_10 Forward -93 -74 -9.24366 0.287
NP_440588.1_2 Forward -92 -73 -5.70374 0.259
NP_442006.1_2 Reverse -145 -162 -17.3657 0.274
NP_442006.1_2 Reverse -29 -46 -19.234 0.299
NP_440483.1_1 Reverse -61 -80 -7.96535 0.276
NP_441570.1_1 Reverse -74 -92 -9.32229 0.134
NP_441078.1_4 Reverse -284 -293 8.55452 0.0274
NP_441078.1_4 Forward -293 -284 7.66954 0.052
NP_442443.1_1 Forward -356 -337 -6.78538 0.298
NP_440526.1_3 Forward -82 -71 7.62965 0.139
NP_441432.1_8 Reverse -283 -292 12.7828 0.0354
NP_441432.1_8 Forward -84 -75 4.91628 0.196
NP_441333.1_1 Reverse -227 -237 10.9226 0.29
NP_441732.1_2 Forward -297 -281 -17.346 0.253
NP_441732.1_2 Reverse -280 -296 -17.346 0.253
NP_440760.1_1 Forward -83 -64 -21.83 0.245
NP_442274.1_8 Reverse -314 -332 14.8104 0.286
NP_442274.1_8 Forward -75 -57 13.5697 0.286
NP_442489.1_7 Forward -293 -284 1.47469 0.0905
NP_442489.1_7 Reverse -284 -293 0.786375 0.152
NP_442489.1_7 Reverse -74 -83 -1.96689 0.28
NP_440559.1_1 Forward -82 -73 4.32629 0.288
NP_441659.2_8 Forward -293 -283 1.84832 0.224
NP_442346.1_5 Forward -84 -74 6.76487 0.192
NP_440545.1_3 Forward -87 -70 -4.09106 0.218
NP_441856.1_8 Forward -170 -151 11.8975 0.274
NP_441653.1_2 Reverse -63 -82 8.0714 0.198
NP_441112.1_6 Forward -216 -197 1.96607 0.246
NP_440671.1_4 Reverse -68 -82 6.58777 0.243
NP_442045.1_5 Forward -168 -149 -0.983855 0.278
NP_442021.1_3 Forward -354 -335 -5.9004 0.257
NP_440590.1_4 Reverse -159 -172 -4.30728 0.26
NP_440567.1_1 Reverse -75 -89 1.76955 0.194
NP_442497.1_10 Forward -82 -73 0.393051 0.175
NP_440821.1_4 Reverse -72 -82 0.0783647 0.205
NP_442270.1_9 Forward -94 -75 -6.49039 0.207
NP_440863.1_1 Forward -326 -312 17.194 0.165
NP_440833.1_6 Reverse -250 -264 14.2569 0.157
NP_441617.1_6 Reverse -295 -314 -1.27885 0.256
NP_441782.1_1 Forward -246 -227 20.7546 0.125
NP_441230.1_5 Reverse -328 -347 2.85105 0.209
NP_440462.1_4 Reverse -36 -50 8.45605 0.263
NP_442592.1_7 Forward -88 -69 18.0924 0.163
NP_440868.1_4 Forward -297 -285 1.12062 0.192
NP_442499.1_3 Forward -349 -331 8.67227 0.279
NP_442479.1_9 Forward -271 -252 -12.3902 0.281
NP_441672.1_6 Forward -169 -150 12.7816 0.192
NP_442402.1_4 Reverse -309 -328 -9.24438 0.287
NP_442402.1_4 Reverse -288 -307 -9.34271 0.288
NP_441848.1_7 Forward -365 -346 0.392004 0.228
NP_441084.1_6 Reverse -325 -339 10.1198 0.254
NP_439942.1_2 Reverse -99 -118 12.6962 0.269
NP_440843.1_8 Forward -354 -335 20.2556 0.166
NP_442023.1_2 Forward -214 -195 4.22769 0.286
NP_441811.1_8 Reverse -68 -82 9.83269 0.225
NP_441811.1_8 Reverse -74 -88 5.70279 0.293
NP_442679.1_1 Reverse -349 -368 -0.885524 0.226
NP_440160.1_2 Reverse -163 -182 -2.36049 0.245
NP_442053.1_1 Reverse -284 -293 5.21127 0.203
NP_440505.1_7 Forward -75 -56 -2.0655 0.289
NP_442533.1_6 Reverse -192 -201 3.34298 0.216
NP_442533.1_6 Reverse -333 -342 3.04799 0.228
NP_442541.1_10 Forward -47 -33 4.32555 0.252
NP_441482.1_7 Reverse -68 -82 0.294584 0.0586
NP_441697.1_5 Forward -282 -263 -11.2207 0.294
NP_441697.1_5 Reverse -262 -281 -11.2207 0.294
NP_441028.1_6 Forward -160 -150 5.38779 0.255
NP_441028.1_6 Forward -42 -32 3.42118 0.296
NP_441527.1_4 Forward -249 -230 -7.11457 0.23
NP_441527.1_4 Reverse -32 -51 -10.7433 0.274
NP_440007.1_9 Reverse -70 -84 1.27789 0.289
NP_439965.1_1 Forward -92 -73 0.392778 0.146
NP_441972.1_3 Reverse -142 -161 16.4207 0.146
NP_441972.1_5 Forward -82 -63 6.09597 0.0852
NP_441286.1_1 Forward -84 -72 -4.48425 0.161
NP_441705.1_3 Reverse -349 -368 -1.47551 0.279
NP_440886.1_7 Forward -84 -74 4.7978 0.218
NP_440886.1_7 Reverse -86 -96 3.91283 0.26
NP_441069.1_5 Reverse -336 -354 8.96727 0.126
NP_441626.1_2 Forward -292 -285 5.05399 0.238
NP_442238.1_3 Forward -342 -323 7.7676 0.197
NP_442794.1_1 Forward -352 -340 3.08724 0.286
NP_441401.1_9 Reverse -213 -231 18.1273 0.234
NP_441962.1_4 Reverse -340 -359 -11.7019 0.244
NP_441962.1_4 Reverse -101 -120 -14.7502 0.293
NP_440387.1_1 Reverse -284 -300 1.5335 0.102
NP_441431.1_2 Forward -296 -282 11.897 0.131
NP_441836.1_1 Forward -359 -340 17.6355 0.073
NP_441836.1_2 Forward -360 -341 -1.96717 0.224
NP_441993.1_1 Forward -342 -323 6.0399 0.188
NP_442698.1_7 Forward -164 -146 18.3087 0.292
NP_441853.1_5 Reverse -333 -352 10.3242 0.224
NP_440293.1_3 Forward -338 -319 1.76941 0.207
NP_440293.1_3 Forward -344 -325 -4.81876 0.265
NP_440766.1_5 Reverse -349 -361 7.84677 0.288
NP_439988.1_3 Forward -347 -333 5.89945 0.278
NP_442867.1_8 Forward -162 -143 4.12936 0.291
NP_440801.1_9 Forward -101 -87 12.6414 0.286
NP_442509.1_9 Reverse -80 -90 7.35439 0.225
NP_440660.1_10 Reverse -164 -183 15.5357 0.287
NP_442936.1_10 Forward -126 -112 8.78534 0.269
NP_441885.1_5 Reverse -284 -294 0.668351 0.133
NP_442341.1_7 Forward -84 -70 4.81781 0.177
NP_441756.1_5 Reverse -335 -354 1.37609 0.217
NP_441173.1_9 Reverse -257 -265 10.9338 0.242
NP_441173.1_9 Forward -28 -20 9.75379 0.284
NP_440423.1_6 Reverse -29 -48 -21.4367 0.294
NP_440727.1_3 Forward -103 -84 16.6174 0.171
NP_440727.1_3 Reverse -341 -360 15.7324 0.171
NP_442354.1_8 Reverse -129 -148 6.19431 0.266
NP_442451.1_2 Reverse -366 -385 -8.06369 0.241
NP_439962.1_4 Reverse -322 -341 -4.13045 0.267
NP_440175.1_4 Reverse -72 -91 -14.0619 0.273
NP_442214.1_7 Forward -299 -280 15.2101 0.248
NP_442373.1_2 Forward -388 -369 -9.047 0.256
NP_440172.1_1 Reverse -74 -84 3.12662 0.244
NP_441226.1_7 Reverse -81 -88 8.59356 0.197
NP_441111.1_7 Forward -292 -284 -0.472234 0.131
NP_441111.1_7 Reverse -285 -293 -0.668896 0.274
NP_440416.1_9 Forward -180 -161 -13.2752 0.164
NP_440072.1_5 Reverse -65 -83 -2.83245 0.271
NP_441940.1_1 Reverse -335 -354 8.16011 0.264
NP_442154.1_1 Forward -353 -335 -16.1071 0.232
NP_440261.1_5 Forward -82 -69 -10.7971 0.21
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTCGTGCTAGTAATGGGAGGTATCTTTGTTAGTTACCCTAATTTCTGGCCCTGGTTACGGCTCCGGCCTGTGCTTGGGAAACAGTGAGAAATTATCGGTAAAATGTCGGCGAAAGCCTACAAAAGTTAGGAACATTTTGGTAAATTGTCACGACAGGGATAGGAAAATGAAACTCGGTCATTATTGACCGAAAAAGAAAGGGCCTGACCTTAGTAGCTCCTCGCCACTGAGTTGCCGCTCCTTTCCTCCCTGAACCGATGAACCTGCCAATCTAGCAAGAATATTTGCAGTTGATGCCGTTTACCGTGGTCTGGGTTCGCAATCACCCCGGCTTTGGTAGCAACACTAGTTCATCCCATTGACCCCTTTCACTTTACCCAGGAAATACGGACGGTAAACT

CDS

ATGATTTTGACCAAGTTAAAAGACTTCGTCGGCATCAGTGAACACGATGAGTACGAAGAGGATTACGACGAAGAAATGGAGTTTCCCCAGTCAGTGGCCTCCCAGCCGCCGGCCGAAGAAGTTGCCCCTCCCCCTCGCATTAGCCGCGAACCCTTAAGCTTAAATAATGAAACCTCTATTGGTACAGGAGTAAGAAATAACGTGATTGGTATGCCCGGCATCAACAACAGTGTGGCAGAGGTGGTCGTCGTCGAACCCCATTCCTTCGATGAAATGCCCCAGGTGATTCAAACCCTACGGGAACGGAAGTCGGTGGTGTTAAACCTGAATGTGATGGACCCCGAAGAAGCCCAGCGAGCCGTGGATTTTGTGGCCGGTGGTACTTTCGCCATGGATGGCCACCAAGAACGCATTGGTGAGAGTATTTTTCTGTTTACCCCCAACTGCGTCAAAGTCAGTTCTTTGGCAGGTCGTAGTCAGGAAAGCAATGAAACTTCCTCCTCCGTTTCCTCCGATAATTTTCCCACTTGGGGCTATGAAACCAGCCGTTTAGCTCAATAG

Protein

MILTKLKDFVGISEHDEYEEDYDEEMEFPQSVASQPPAEEVAPPPRISREPLSLNNETSIGTGVRNNVIGMPGINNSVAEVVVVEPHSFDEMPQVIQTLRERKSVVLNLNVMDPEEAQRAVDFVAGGTFAMDGHQERIGESIFLFTPNCVKVSSLAGRSQESNETSSSVSSDNFPTWGYETSRLAQ