Your browser is old and dusty. Try Google Chrome!

Details for slr2071

ORF slr2071
Accession NP_440722.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -269 -283 2.16287 0.178
NP_441418.1_6 Forward -341 -322 -17.7985 0.0823
NP_441453.1_4 Forward -341 -333 6.80426 0.121
NP_441623.1_1 Reverse -155 -173 -4.30741 0.274
NP_442151.1_6 Forward -271 -257 8.84938 0.164
NP_440226.1_1 Forward -341 -322 2.94938 0.246
NP_442173.1_1 Reverse -333 -341 5.72262 0.203
NP_442752.1_4 Forward -341 -334 13.8055 0.0199
NP_443027.1_4 Forward -343 -333 8.04317 0.219
NP_440784.1_7 Forward -340 -333 6.23397 0.241
NP_440784.1_7 Reverse -333 -340 6.13563 0.241
NP_442861.1_4 Forward -124 -105 0.981987 0.297
NP_441250.1_3 Reverse -269 -288 2.85105 0.267
NP_440878.1_9 Forward -365 -346 -2.95047 0.281
NP_442062.1_8 Forward -341 -331 6.66654 0.119
NP_442062.1_8 Forward -163 -153 4.60159 0.206
NP_440761.1_1 Forward -46 -27 9.93088 0.292
NP_441859.1_3 Reverse -310 -329 10.2251 0.121
NP_441802.1_1 Reverse -194 -213 16.8141 0.174
NP_442242.1_4 Reverse -333 -340 10.8555 0.127
NP_441781.1_7 Reverse -262 -281 -0.197208 0.256
NP_442602.1_3 Forward -172 -153 -0.39387 0.22
NP_441935.1_1 Reverse -379 -398 16.5191 0.121
NP_441208.1_9 Reverse -359 -373 4.62115 0.297
NP_441925.1_4 Forward -375 -356 -16.2258 0.281
NP_441083.1_5 Forward -368 -358 1.55333 0.204
NP_441083.1_5 Forward -341 -331 1.06167 0.218
NP_441083.1_5 Reverse -332 -342 0.766681 0.218
NP_442827.1_8 Reverse -146 -165 10.815 0.0577
NP_441149.1_7 Reverse -75 -94 0.687771 0.28
NP_441149.1_9 Reverse -37 -56 0.293673 0.244
NP_441738.1_2 Reverse -334 -341 15.28 0.0102
NP_440209.1_1 Reverse -332 -340 11.9175 0.0184
NP_440209.1_1 Forward -341 -333 8.57422 0.0425
NP_442889.1_8 Forward -344 -330 5.01387 0.243
NP_441770.1_10 Forward -165 -146 12.2908 0.226
NP_442570.1_3 Forward -279 -260 -1.86883 0.212
NP_442570.1_8 Forward -62 -44 12.9988 0.179
NP_441792.1_5 Reverse -70 -86 9.10498 0.242
NP_442111.1_4 Reverse -331 -345 4.22782 0.216
NP_440906.1_5 Forward -340 -333 6.23397 0.234
NP_440906.1_5 Reverse -333 -340 6.13563 0.241
NP_440747.1_10 Reverse -329 -341 5.05386 0.019
NP_440747.1_10 Forward -344 -332 -2.4193 0.0434
NP_441130.1_7 Forward -162 -148 15.6336 0.287
NP_441486.1_1 Forward -274 -260 2.16287 0.0892
NP_442848.1_9 Forward -169 -150 6.68596 0.182
NP_443018.1_3 Forward -340 -333 12.6255 0.0471
NP_443018.1_3 Reverse -312 -319 9.47889 0.127
NP_443018.1_3 Forward -162 -155 7.6106 0.156
NP_443018.1_3 Reverse -333 -340 5.25066 0.214
NP_441634.1_8 Forward -291 -277 -3.63866 0.295
NP_440376.1_1 Reverse -154 -163 2.75299 0.215
NP_440376.1_1 Forward -341 -332 0.0980582 0.285
NP_440376.1_1 Reverse -332 -341 -0.196935 0.285
NP_440580.1_4 Reverse -159 -178 9.24257 0.173
NP_442687.1_7 Reverse -261 -271 6.46988 0.165
NP_442687.1_7 Reverse -153 -163 4.10993 0.266
NP_442485.1_3 Reverse -149 -168 11.3075 0.105
NP_440781.1_1 Forward -160 -146 10.7177 0.296
NP_442958.1_3 Forward -300 -281 -0.4922 0.268
NP_440642.1_10 Forward -363 -349 1.37564 0.293
NP_442770.1_1 Reverse -329 -343 18.0918 0.271
NP_440571.1_5 Reverse -120 -139 14.4541 0.221
NP_442658.1_1 Forward -343 -333 7.35439 0.214
NP_442658.1_1 Reverse -152 -162 6.56775 0.224
NP_440800.1_7 Reverse -80 -94 12.291 0.241
NP_441487.1_6 Reverse -146 -165 -1.67217 0.285
NP_441317.1_4 Forward -92 -78 11.5648 0.249
NP_441958.1_5 Forward -342 -332 -6.31315 0.28
NP_440450.1_3 Reverse -269 -288 20.944 0.013
NP_442685.1_2 Reverse -120 -130 14.1397 0.254
NP_440203.1_5 Reverse -142 -152 10.4026 0.225
NP_439905.1_1 Forward -162 -149 19.1938 0.019
NP_439905.1_1 Reverse -281 -294 7.49244 0.258
NP_440984.1_7 Reverse -257 -271 5.30946 0.259
NP_443055.1_6 Reverse -324 -342 10.3431 0.126
NP_440993.1_4 Reverse -262 -279 6.43035 0.245
NP_440934.1_2 Reverse -263 -282 -0.590531 0.297
NP_440138.1_6 Reverse -155 -174 7.27514 0.213
NP_439975.1_2 Forward -53 -35 9.16393 0.215
NP_441099.1_5 Reverse -322 -341 -1.47551 0.109
NP_441099.1_6 Forward -98 -79 12.1925 0.282
NP_442002.1_9 Forward -342 -335 10.7572 0.185
NP_440809.1_4 Reverse -173 -192 11.1109 0.105
NP_441000.1_6 Reverse -331 -345 -1.96703 0.216
NP_442771.1_1 Reverse -182 -200 -10.5023 0.265
NP_441295.1_4 Forward -162 -143 -1.27885 0.29
NP_441295.1_4 Reverse -146 -165 -1.47551 0.29
NP_441916.1_7 Reverse -332 -342 6.96153 0.0784
NP_441041.1_7 Reverse -136 -148 5.18252 0.272
NP_441406.1_2 Forward -345 -326 17.7974 0.088
NP_439966.1_7 Forward -343 -333 8.23937 0.14
NP_439966.1_7 Reverse -330 -340 5.68278 0.214
NP_439966.1_7 Reverse -309 -319 5.19112 0.24
NP_439966.1_9 Forward -343 -334 0.884706 0.253
NP_442941.1_3 Reverse -333 -343 0.963343 0.16
NP_440289.1_2 Forward -344 -331 0.117615 0.175
NP_440289.1_2 Reverse -161 -174 -5.09393 0.297
NP_442281.1_1 Reverse -257 -271 5.1122 0.169
NP_442281.1_1 Forward -346 -332 5.01387 0.172
NP_442281.1_1 Reverse -306 -320 2.94893 0.249
NP_441079.1_7 Reverse -241 -260 -3.54122 0.238
NP_439983.1_7 Reverse -358 -376 21.7503 0.0324
NP_441644.1_6 Forward -271 -261 9.02601 0.0872
NP_441644.1_6 Forward -163 -153 4.10949 0.249
NP_441644.1_6 Reverse -262 -272 4.10949 0.249
NP_441644.1_6 Forward -341 -331 4.01116 0.253
NP_443049.1_6 Forward -342 -332 13.6904 0.149
NP_442215.1_2 Forward -273 -257 11.9566 0.035
NP_442215.1_2 Forward -370 -354 -0.236458 0.164
NP_442215.1_2 Reverse -260 -276 -5.15301 0.246
NP_442029.1_6 Reverse -191 -210 3.04771 0.286
NP_440253.1_2 Forward -341 -323 1.10079 0.17
NP_440929.1_8 Reverse -311 -320 3.04799 0.238
NP_442933.1_10 Reverse -332 -341 6.48957 0.119
NP_441751.2_8 Reverse -333 -347 -5.31028 0.202
NP_442554.1_8 Reverse -333 -343 4.3066 0.189
NP_442554.1_8 Reverse -263 -273 3.61828 0.218
NP_442554.1_8 Forward -270 -260 2.33998 0.274
NP_442554.1_8 Reverse -155 -165 2.24165 0.276
NP_441762.1_7 Forward -342 -330 1.90727 0.0721
NP_442142.1_4 Reverse -329 -342 8.86849 0.106
NP_442142.1_4 Forward -344 -331 7.88518 0.127
NP_442142.1_4 Forward -202 -189 6.60689 0.16
NP_442292.1_1 Forward -340 -331 -0.0986038 0.239
NP_442292.1_1 Reverse -333 -342 -0.196935 0.239
NP_442381.1_8 Forward -344 -325 -6.09707 0.152
NP_443009.1_5 Reverse -139 -150 8.61296 0.104
NP_443009.1_5 Forward -164 -153 4.97473 0.222
NP_442092.1_4 Reverse -42 -61 14.5516 0.259
NP_441715.1_4 Reverse -333 -343 9.02648 0.105
NP_441448.1_1 Forward -343 -324 6.4893 0.249
NP_441198.1_8 Reverse -138 -148 11.3181 0.211
NP_440379.1_5 Reverse -151 -170 -10.9153 0.285
NP_441468.1_1 Forward -340 -333 6.13563 0.209
NP_441468.1_1 Reverse -333 -340 6.0373 0.223
NP_441673.1_1 Forward -341 -332 1.37636 0.114
NP_441673.1_1 Reverse -332 -341 1.1797 0.163
NP_441826.1_2 Reverse -274 -288 -0.688726 0.22
NP_442490.1_10 Forward -164 -146 19.587 0.0401
NP_442868.1_6 Forward -343 -333 0.57002 0.217
NP_442868.1_6 Reverse -330 -340 -0.314959 0.284
NP_441944.1_3 Forward -351 -332 13.8641 0.149
NP_442808.1_1 Reverse -331 -341 7.74772 0.0697
NP_442692.1_1 Forward -288 -269 -5.50708 0.276
NP_442542.1_2 Reverse -152 -165 16.3422 0.066
NP_442542.1_9 Reverse -147 -161 21.0417 0.00966
NP_442342.1_9 Forward -370 -354 2.32015 0.29
NP_440346.1_6 Reverse -50 -60 13.8557 0.291
NP_440558.1_2 Reverse -259 -278 0.294447 0.193
NP_440558.1_2 Reverse -66 -85 -4.13045 0.243
NP_440558.1_2 Reverse -151 -170 -5.50708 0.26
NP_441518.1_3 Reverse -322 -341 -13.0786 0.264
NP_441878.1_6 Reverse -261 -271 10.4031 0.0176
NP_441878.1_6 Forward -164 -154 1.16001 0.11
NP_441878.1_6 Forward -272 -262 0.668351 0.139
NP_441878.1_6 Reverse -153 -163 -7.49312 0.231
NP_441036.1_8 Forward -342 -332 7.05986 0.21
NP_441557.1_5 Forward -341 -332 1.08137 0.0794
NP_441557.1_5 Reverse -332 -341 0.589713 0.134
NP_442066.2_9 Reverse -13 -26 9.36073 0.175
NP_442419.1_2 Reverse -327 -346 -1.7705 0.246
NP_440101.1_3 Reverse -149 -168 7.07928 0.18
NP_441564.1_2 Forward -283 -264 3.04771 0.144
NP_441564.1_2 Forward -54 -35 0.491109 0.214
NP_441407.1_5 Reverse -322 -341 2.55606 0.295
NP_442347.1_2 Reverse -333 -342 10.9145 0.0571
NP_442645.1_2 Forward -279 -260 -13.5702 0.158
NP_441633.1_3 Forward -291 -278 -2.144 0.173
NP_440136.1_2 Forward -340 -333 6.23397 0.171
NP_440136.1_2 Reverse -333 -340 6.13563 0.193
NP_442998.1_10 Reverse -334 -341 15.5754 0.0102
NP_441799.1_1 Reverse -328 -342 5.1122 0.223
NP_442333.2_5 Forward -174 -155 -13.6686 0.259
NP_440256.1_1 Reverse -329 -348 -6.29373 0.207
NP_441559.1_8 Forward -154 -140 -0.393733 0.175
NP_441559.1_8 Forward -282 -268 -7.76856 0.299
NP_440717.1_1 Forward -162 -143 6.09597 0.265
NP_440717.1_3 Forward -365 -351 8.75042 0.258
NP_441866.1_4 Forward -59 -46 12.564 0.282
NP_442069.1_4 Reverse -341 -360 5.11266 0.254
NP_442866.1_1 Reverse -149 -168 -4.22878 0.225
NP_441464.1_8 Forward -370 -356 6.78443 0.226
NP_441464.1_8 Forward -220 -206 5.01447 0.26
NP_440188.1_4 Reverse -269 -288 11.1109 0.172
NP_440677.1_1 Forward -286 -267 7.7676 0.228
NP_440677.1_6 Forward -158 -139 7.57094 0.298
NP_442386.1_9 Reverse -331 -340 6.09583 0.23
NP_442386.1_9 Forward -342 -333 5.9975 0.23
NP_441750.1_1 Forward -341 -322 -11.6036 0.3
NP_441340.1_5 Forward -340 -333 6.23397 0.132
NP_441340.1_5 Reverse -333 -340 5.84064 0.208
NP_442484.1_2 Forward -282 -263 0.884433 0.242
NP_440586.1_8 Forward -340 -333 14.69 0.026
NP_440586.1_8 Reverse -312 -319 10.9535 0.119
NP_442251.1_6 Reverse -333 -340 12.0355 0.0627
NP_442959.1_5 Forward -26 -7 12.0942 0.222
NP_441262.1_3 Forward -341 -334 14.7888 0.0223
NP_443051.1_1 Forward -321 -312 4.71961 0.111
NP_443051.1_1 Forward -342 -333 0.884706 0.125
NP_439937.1_8 Reverse -309 -328 -0.983855 0.247
NP_439937.1_9 Forward -164 -147 -10.6799 0.232
NP_440439.1_1 Reverse -151 -164 -0.669033 0.229
NP_440372.1_2 Forward -340 -333 6.82395 0.0854
NP_440372.1_2 Reverse -333 -340 6.52896 0.188
NP_441572.1_7 Reverse -256 -275 -3.14714 0.207
NP_442384.1_10 Forward -271 -258 2.2809 0.23
NP_442114.1_4 Reverse -332 -343 8.4168 0.197
NP_440699.1_1 Reverse -236 -255 10.1695 0.232
NP_441631.1_5 Forward -168 -149 17.5024 0.233
NP_441018.1_7 Reverse -150 -169 13.0775 0.142
NP_442262.1_10 Forward -340 -333 12.9205 0.0422
NP_442262.1_10 Reverse -312 -319 11.9372 0.0736
NP_442262.1_10 Forward -162 -155 8.8889 0.219
NP_440531.1_6 Reverse -146 -165 -5.11376 0.293
NP_440189.1_2 Forward -171 -152 -0.000545616 0.283
NP_440189.1_2 Forward -328 -309 -0.590531 0.289
NP_440562.1_10 Reverse -323 -341 16.6371 0.123
NP_440297.1_9 Reverse -155 -165 0.57002 0.282
NP_440297.1_9 Forward -270 -260 -0.118297 0.282
NP_442280.1_10 Forward -281 -263 15.2919 0.113
NP_441592.1_4 Reverse -160 -179 -2.55715 0.265
NP_442067.1_4 Reverse -143 -162 8.25926 0.194
NP_440999.1_2 Reverse -269 -288 9.73422 0.275
NP_440999.1_9 Reverse -276 -290 3.14618 0.135
NP_440888.1_2 Forward -163 -149 12.2903 0.0476
NP_440792.1_5 Forward -340 -321 13.9625 0.12
NP_442225.1_10 Forward -351 -332 11.5033 0.206
NP_441543.1_2 Reverse -333 -342 8.65285 0.0968
NP_441543.1_2 Forward -340 -331 5.50626 0.197
NP_442845.1_2 Forward -277 -263 4.12949 0.267
NP_442845.1_2 Reverse -154 -168 3.53951 0.287
NP_440722.1_4 Forward -34 -16 18.151 0.221
NP_442710.1_7 Forward -137 -118 -5.10833 0.279
NP_442710.1_7 Reverse -120 -139 -7.31885 0.294
NP_441469.1_8 Forward -342 -333 6.39124 0.227
NP_442315.1_2 Forward -58 -46 11.347 0.291
NP_442578.1_7 Forward -340 -333 14.6904 0.026
NP_441462.1_2 Forward -341 -331 -0.0199663 0.177
NP_441462.1_2 Reverse -154 -164 -1.10161 0.281
NP_441462.1_5 Forward -54 -35 2.26107 0.291
NP_443062.1_1 Reverse -332 -350 15.664 0.0359
NP_442204.1_1 Forward -345 -334 1.82863 0.266
NP_442204.1_2 Forward -351 -332 7.96426 0.263
NP_441560.1_6 Forward -373 -354 14.5524 0.241
NP_440516.1_6 Forward -163 -149 8.16044 0.25
NP_440516.1_8 Forward -341 -332 10.5211 0.00816
NP_442428.1_5 Forward -340 -333 6.13563 0.209
NP_442428.1_5 Reverse -333 -340 6.0373 0.212
NP_441443.1_10 Forward -161 -143 6.01657 0.245
NP_440673.1_2 Forward -281 -262 7.75569 0.292
NP_440673.1_3 Reverse -334 -341 12.4288 0.0426
NP_440673.1_3 Forward -161 -154 8.98723 0.203
NP_441052.1_2 Reverse -262 -272 11.4848 0.0285
NP_441052.1_2 Forward -341 -331 6.8632 0.0857
NP_441052.1_2 Reverse -280 -290 1.65166 0.233
NP_441052.1_2 Reverse -332 -342 1.25834 0.249
NP_441052.1_2 Forward -271 -261 1.16001 0.25
NP_442219.1_8 Reverse -322 -341 9.42334 0.23
NP_442219.1_9 Forward -340 -331 8.65285 0.0681
NP_440436.1_4 Reverse -333 -342 8.55409 0.0997
NP_441884.1_9 Forward -344 -325 -22.9117 0.284
NP_441884.1_9 Reverse -356 -375 -23.6983 0.284
NP_441884.1_9 Forward -166 -147 -25.2716 0.29
NP_441719.1_4 Forward -340 -333 13.5105 0.026
NP_441719.1_4 Reverse -333 -340 6.52896 0.188
NP_441004.1_1 Forward -84 -65 -17.6018 0.292
NP_441004.1_4 Reverse -151 -161 7.74818 0.289
NP_440129.1_10 Forward -348 -334 4.42448 0.185
NP_440094.1_9 Forward -290 -271 -3.24547 0.227
NP_443054.1_2 Forward -165 -151 3.53951 0.24
NP_443054.1_2 Forward -291 -277 1.76955 0.245
NP_441851.1_10 Forward -342 -332 4.60159 0.259
NP_442011.1_1 Reverse -276 -295 -1.37718 0.268
NP_442856.1_7 Forward -350 -331 -5.80207 0.287
NP_440593.1_3 Forward -276 -257 -6.98204 0.285
NP_441046.1_2 Forward -130 -111 3.6377 0.231
NP_442843.1_1 Reverse -155 -174 -12.0953 0.298
NP_439960.1_10 Reverse -144 -162 -1.75081 0.245
NP_440396.1_1 Forward -286 -267 -5.21209 0.272
NP_442450.1_5 Reverse -330 -340 5.78156 0.227
NP_440588.1_2 Forward -298 -279 -5.11376 0.24
NP_442006.1_2 Reverse -145 -162 -6.451 0.164
NP_442006.1_2 Reverse -352 -369 -16.7758 0.264
NP_441570.1_1 Forward -341 -323 -9.0273 0.127
NP_441078.1_4 Forward -341 -332 0.196389 0.205
NP_441078.1_4 Reverse -332 -341 -0.000272808 0.205
NP_441078.1_4 Forward -271 -262 -1.47524 0.266
NP_441078.1_4 Reverse -154 -163 -1.57357 0.266
NP_441078.1_4 Reverse -262 -271 -1.77023 0.266
NP_441663.1_8 Forward -347 -328 -1.37718 0.243
NP_442443.1_1 Forward -340 -321 -5.11376 0.281
NP_442443.1_1 Reverse -146 -165 -6.49039 0.294
NP_441432.1_8 Forward -398 -389 6.48957 0.114
NP_441432.1_8 Reverse -153 -162 3.7363 0.243
NP_441432.1_8 Forward -272 -263 3.14632 0.259
NP_442344.1_7 Reverse -333 -352 -9.63698 0.262
NP_442353.1_4 Reverse -281 -300 1.57197 0.242
NP_442489.1_7 Reverse -332 -341 7.47288 0.0613
NP_442489.1_7 Forward -341 -332 0.688044 0.152
NP_442489.1_7 Reverse -154 -163 -1.57357 0.213
NP_442489.1_7 Forward -271 -262 -1.6719 0.235
NP_442489.1_7 Reverse -262 -271 -1.77023 0.247
NP_442489.1_7 Forward -163 -154 -1.86856 0.259
NP_440757.1_6 Forward -374 -355 8.84924 0.28
NP_440559.1_1 Forward -340 -331 6.19458 0.134
NP_441022.1_1 Reverse -119 -128 13.7524 0.188
NP_441040.1_2 Forward -158 -139 -12.2919 0.255
NP_441040.1_5 Reverse -257 -276 3.34271 0.275
NP_442008.1_2 Reverse -329 -348 10.9142 0.133
NP_442346.1_5 Reverse -261 -271 11.5831 0.0634
NP_442346.1_5 Forward -272 -262 11.3864 0.0681
NP_440831.1_3 Reverse -145 -164 8.32868 0.229
NP_440831.1_3 Forward -350 -331 5.12514 0.29
NP_440486.1_6 Forward -354 -335 6.88262 0.278
NP_442551.1_4 Forward -273 -258 5.09311 0.242
NP_440847.1_3 Reverse -325 -339 10.717 0.283
NP_441833.1_4 Reverse -333 -340 6.52896 0.0924
NP_441833.1_4 Forward -340 -333 6.23397 0.163
NP_442162.1_9 Forward -340 -333 6.62729 0.142
NP_442162.1_9 Reverse -333 -340 6.52896 0.178
NP_441044.1_4 Reverse -83 -101 2.77242 0.238
NP_442199.1_5 Forward -349 -330 -1.57384 0.181
NP_442140.1_3 Forward -340 -330 4.79825 0.238
NP_442140.1_3 Reverse -333 -343 4.69992 0.238
NP_440875.1_9 Reverse -334 -344 17.327 0.0126
NP_440875.1_9 Reverse -313 -323 11.1948 0.179
NP_441813.1_5 Forward -343 -333 9.7148 0.0241
NP_441813.1_5 Reverse -309 -319 3.51995 0.167
NP_442472.1_1 Reverse -375 -394 18.6815 0.203
NP_440590.1_4 Reverse -333 -346 -5.97891 0.296
NP_440567.1_1 Reverse -333 -347 -0.688726 0.298
NP_442497.1_10 Reverse -333 -342 0.589713 0.153
NP_440821.1_4 Forward -343 -333 0.471689 0.174
NP_441239.1_9 Reverse -152 -164 7.51213 0.158
NP_441239.1_9 Forward -370 -358 4.75886 0.243
NP_441239.1_9 Forward -165 -153 4.5622 0.251
NP_441239.1_9 Reverse -143 -155 2.98891 0.3
NP_440400.1_1 Forward -377 -358 -0.29631 0.285
NP_442270.1_6 Forward -342 -324 17.2271 0.279
NP_440212.1_9 Reverse -21 -40 1.3301 0.275
NP_440354.1_5 Forward -82 -63 2.55606 0.251
NP_440546.1_7 Reverse -145 -155 15.8113 0.237
NP_440462.1_6 Forward -343 -333 14.0414 0.0235
NP_442340.1_3 Forward -161 -142 2.75272 0.137
NP_440868.1_4 Reverse -328 -340 12.6253 0.0235
NP_440868.1_4 Forward -345 -333 7.80712 0.0637
NP_440868.1_4 Reverse -150 -162 -0.452677 0.269
NP_441474.1_1 Reverse -322 -341 5.30853 0.212
NP_442402.1_4 Forward -213 -194 -10.1294 0.297
NP_441848.1_7 Forward -130 -111 -0.787962 0.244
NP_442039.1_7 Reverse -147 -157 14.533 0.211
NP_442039.1_7 Forward -47 -37 6.8632 0.292
NP_442837.1_3 Reverse -333 -340 12.1338 0.0702
NP_442837.1_3 Forward -340 -333 6.0373 0.25
NP_442053.1_1 Reverse -332 -341 14.1594 0.0136
NP_442053.1_1 Forward -341 -332 7.86621 0.0863
NP_440505.1_3 Forward -151 -141 8.73149 0.135
NP_440505.1_3 Forward -343 -333 7.05986 0.165
NP_440914.1_1 Reverse -140 -150 8.02955 0.211
NP_440914.1_1 Forward -341 -331 6.66328 0.269
NP_441011.1_8 Reverse -333 -342 7.07956 0.179
NP_442533.1_6 Forward -271 -262 13.9627 0.0155
NP_442533.1_6 Reverse -262 -271 6.68623 0.105
NP_442533.1_6 Forward -163 -154 5.3096 0.145
NP_442541.1_10 Forward -164 -150 0.982316 0.292
NP_442232.1_3 Forward -171 -152 -10.6203 0.271
NP_442229.1_1 Reverse -249 -263 6.19383 0.235
NP_443016.1_1 Forward -277 -258 -7.17871 0.27
NP_441482.1_7 Forward -169 -155 5.89945 0.0373
NP_441482.1_7 Forward -347 -333 -10.7185 0.213
NP_442202.1_10 Forward -164 -150 8.45605 0.255
NP_441527.1_7 Forward -89 -70 9.93006 0.282
NP_440115.1_2 Reverse -191 -210 17.404 0.264
NP_440115.1_6 Forward -344 -334 7.64985 0.146
NP_440007.1_9 Reverse -355 -369 1.27789 0.289
NP_439965.1_7 Forward -284 -265 11.6824 0.294
NP_441544.1_1 Forward -292 -280 15.6736 0.242
NP_440572.1_9 Forward -174 -155 13.3725 0.276
NP_441602.1_3 Reverse -149 -168 -5.11376 0.278
NP_441170.1_4 Forward -280 -262 6.60732 0.205
NP_441972.1_5 Forward -288 -269 6.19431 0.0843
NP_441972.1_5 Reverse -155 -174 -4.81876 0.211
NP_441106.1_1 Forward -342 -333 8.45619 0.0548
NP_441869.1_9 Forward -186 -167 11.3075 0.293
NP_442928.1_3 Reverse -138 -157 11.9368 0.277
NP_441286.1_1 Forward -342 -330 -7.04085 0.3
NP_440670.1_6 Forward -171 -152 13.3725 0.292
NP_440670.1_8 Forward -320 -311 3.53964 0.257
NP_441930.1_2 Reverse -153 -163 13.5497 0.24
NP_441930.1_2 Forward -398 -388 12.3697 0.262
NP_440886.1_7 Forward -342 -332 6.86274 0.113
NP_440886.1_7 Forward -369 -359 5.87944 0.158
NP_440828.1_1 Forward -161 -142 0.981987 0.256
NP_442614.1_2 Forward -271 -257 8.45605 0.255
NP_442072.1_9 Forward -290 -272 -23.0886 0.277
NP_440907.2_8 Reverse -312 -322 12.2709 0.0694
NP_440841.1_4 Reverse -330 -349 -8.65367 0.25
NP_441626.1_2 Forward -340 -333 6.13563 0.177
NP_441626.1_2 Reverse -333 -340 5.93897 0.231
NP_442794.1_1 Reverse -328 -340 4.16888 0.276
NP_442615.1_1 Forward -350 -332 -2.24246 0.141
NP_441962.1_4 Forward -168 -149 -11.6036 0.243
NP_441962.1_4 Reverse -263 -282 -12.6852 0.263
NP_440387.1_1 Forward -341 -325 -6.62797 0.298
NP_441431.1_2 Forward -344 -330 8.75042 0.207
NP_441431.1_2 Reverse -290 -304 6.19383 0.279
NP_442437.1_4 Forward -396 -377 8.06259 0.25
NP_440766.1_4 Forward -324 -310 11.406 0.07
NP_440766.1_5 Reverse -114 -126 7.65579 0.288
NP_441237.1_9 Forward -340 -330 12.3697 0.125
NP_441237.1_9 Forward -397 -387 10.8948 0.214
NP_440643.1_2 Reverse -209 -228 2.0644 0.289
NP_440643.1_2 Forward -313 -294 1.27776 0.298
NP_442867.1_8 Forward -162 -143 4.42435 0.283
NP_440457.1_1 Forward -345 -333 0.333971 0.25
NP_441801.1_4 Forward -203 -193 2.63497 0.29
NP_440801.1_8 Forward -342 -323 0.687771 0.253
NP_441984.1_3 Reverse -150 -168 8.96727 0.217
NP_441332.1_6 Forward -369 -359 10.9691 0.278
NP_440554.1_4 Reverse -333 -343 6.8632 0.111
NP_440554.1_4 Reverse -312 -322 4.0116 0.205
NP_441885.1_5 Forward -341 -331 2.33998 0.0799
NP_440478.1_2 Forward -228 -209 1.0811 0.25
NP_442310.1_1 Reverse -354 -373 11.9958 0.244
NP_442341.1_7 Forward -290 -276 11.6026 0.0534
NP_442341.1_7 Forward -164 -150 5.60446 0.151
NP_442341.1_7 Reverse -153 -167 1.47456 0.288
NP_442341.1_9 Forward -343 -329 11.602 0.122
NP_440409.1_1 Forward -297 -278 -4.81876 0.281
NP_443000.1_7 Forward -343 -333 1.84832 0.228
NP_443000.1_7 Reverse -296 -306 1.55333 0.244
NP_441842.1_10 Reverse -147 -161 6.78443 0.272
NP_440275.1_3 Forward -322 -312 6.56821 0.101
NP_440275.1_3 Forward -343 -333 5.87989 0.13
NP_443060.1_5 Forward -279 -260 10.9134 0.175
NP_441635.1_1 Forward -42 -23 6.34979 0.245
NP_441122.1_1 Forward -275 -260 12.5663 0.17
NP_440175.1_4 Reverse -260 -279 -3.44213 0.122
NP_440175.1_7 Reverse -150 -168 13.462 0.19
NP_441105.1_3 Forward -331 -312 1.76941 0.11
NP_441105.1_3 Forward -174 -155 -7.76869 0.259
NP_440216.1_1 Reverse -332 -346 -3.93365 0.0918
NP_440216.1_1 Reverse -140 -154 -12.4884 0.274
NP_440172.1_1 Forward -341 -331 6.27322 0.107
NP_441111.1_7 Reverse -333 -341 8.86921 0.0589
NP_441766.1_2 Reverse -332 -341 8.55452 0.054
NP_441766.1_9 Reverse -146 -165 23.7955 0.0167
NP_441766.1_9 Forward -162 -143 -1.18052 0.266
NP_440416.1_9 Forward -348 -329 -14.1602 0.173
NP_440416.1_9 Reverse -325 -344 -16.7168 0.22
NP_443052.1_10 Reverse -257 -276 16.6773 0.271
NP_442154.1_1 Reverse -182 -200 -15.4188 0.218
NP_440261.1_5 Forward -270 -257 -2.93064 0.0983
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTAGGCATTGAGCAACAGTACCGTTACACGGCCCACATCACCCTTGGTTACTTCGACCCGGCGATCGAGAAGTTGGCAGATTCGATCGGAGTTAGTGAACAGTTGGCTGCTGTCAATGACCGCTGGATTGGCCATGACCCAGAGATTTTAGATATTCATAGCATTGAGCTGCGCTATTTCAGCGATATGACCCAATTTACTCGCCAGGACTACTATCCCGTTTTGAGGGCTAGCTAGGCCCATTGCCGCCAGGGGATTCTCTCATTAATACACAAATTTTTGTCCGTAAACATTACAGTGTACAGGGCCAATTTCTGGCTTGTGCATAGGTTACGGCTGGAATTTTTGGGTTTAGATGGGAAAAGAGATATTTTGTTAATCTGCGGAAGTATTTACCAAG

CDS

ATGTTTAAATTCCTTGCCAATAATTATTCACAATCTTTGGGGTTAACTGCTTGCCTGGGGCTATTCACCTACTTGGCGATCGCCGTTCCAGTGGAAGCCCAGGGGCAAAATAGTTTTGAAAATTACCGTCAGCAATGCCTGCGTCGGGTGGAACAGGCTGGCATTAAGGGGGCGGCGGCTCAGGAAATGTGCAACTGCACAATTAATAAGTTCAAGCAAAAATATTCCCTGGCAGAATTTACCAAGCTTGTGCAACAGTCGGAAACCAACCAGGCGATCGCCAGACAATTGGCGGAAGTAGGGGAAGAGTGTTTGTACGAATAG

Protein

MFKFLANNYSQSLGLTACLGLFTYLAIAVPVEAQGQNSFENYRQQCLRRVEQAGIKGAAAQEMCNCTINKFKQKYSLAEFTKLVQQSETNQAIARQLAEVGEECLYE