Your browser is old and dusty. Try Google Chrome!

Details for slr2070

ORF slr2070
Accession NP_440721.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -240 -254 0.491246 0.207
NP_440795.1_7 Forward -208 -201 7.31561 0.259
NP_441418.1_6 Forward -168 -149 -20.3551 0.111
NP_440815.1_5 Reverse -339 -358 4.71934 0.286
NP_440897.1_6 Reverse -326 -345 1.17865 0.171
NP_442151.1_6 Reverse -326 -340 5.01447 0.298
NP_441818.1_9 Forward -170 -151 -6.39206 0.263
NP_443002.1_5 Forward -235 -217 8.6715 0.297
NP_443027.1_4 Forward -374 -364 8.73149 0.191
NP_443027.1_4 Forward -322 -312 5.97822 0.294
NP_441812.1_1 Reverse -288 -302 15.2402 0.201
NP_441250.1_3 Forward -46 -27 12.4875 0.183
NP_441054.1_2 Forward -306 -287 9.73422 0.284
NP_441054.1_2 Forward -85 -66 9.73422 0.284
NP_440304.1_4 Forward -399 -389 11.0914 0.051
NP_441781.1_7 Forward -372 -353 1.0811 0.239
NP_442602.1_3 Reverse -224 -243 9.63589 0.0781
NP_441200.1_4 Forward -186 -167 8.84924 0.251
NP_441935.1_9 Forward -216 -197 12.9387 0.294
NP_441594.1_6 Forward -338 -319 12.9791 0.109
NP_440132.1_1 Forward -70 -52 7.88563 0.286
NP_441925.1_4 Reverse -151 -170 -17.2092 0.29
NP_440330.1_2 Reverse -245 -264 10.5209 0.297
NP_441083.1_3 Reverse -325 -335 16.5975 0.102
NP_441434.1_1 Forward -95 -81 6.88704 0.297
NP_441558.1_5 Reverse -361 -380 5.30933 0.254
NP_441955.1_8 Reverse -240 -257 8.39697 0.259
NP_441645.1_8 Reverse -30 -49 12.2908 0.262
NP_440209.1_1 Reverse -363 -371 5.13263 0.17
NP_440209.1_1 Forward -133 -125 2.1827 0.254
NP_442889.1_1 Reverse -261 -280 -15.4385 0.292
NP_442398.1_4 Forward -48 -29 9.14342 0.22
NP_441713.1_1 Reverse -251 -270 -9.63698 0.181
NP_440842.1_10 Forward -120 -106 4.22782 0.254
NP_441014.1_10 Forward -54 -35 -1.57461 0.262
NP_443018.1_3 Forward -371 -364 11.3472 0.0846
NP_443018.1_3 Reverse -364 -371 4.16902 0.278
NP_441316.1_7 Reverse -361 -376 -3.85501 0.296
NP_442687.1_7 Forward -134 -124 5.28991 0.211
NP_442687.1_7 Reverse -33 -43 3.81494 0.286
NP_442191.1_4 Forward -254 -240 10.9931 0.276
NP_442770.1_10 Reverse -69 -83 17.9641 0.176
NP_442296.1_9 Forward -371 -352 -1.08219 0.197
NP_441763.1_5 Reverse -24 -43 -4.13045 0.234
NP_442658.1_1 Forward -399 -389 12.9592 0.0423
NP_442658.1_1 Forward -268 -258 8.43603 0.194
NP_442782.1_2 Forward -289 -275 6.98109 0.215
NP_442496.1_5 Forward -25 -7 5.72234 0.285
NP_440720.1_4 Reverse -74 -93 19.8614 0.146
NP_440720.1_7 Reverse -121 -139 22.4378 0.0394
NP_442937.1_5 Reverse -103 -122 8.65258 0.216
NP_441958.1_5 Forward -169 -159 -2.6749 0.28
NP_441127.1_1 Reverse -255 -269 7.57108 0.3
NP_439905.1_1 Forward -275 -262 10.2457 0.216
NP_442376.1_8 Forward -48 -34 15.0442 0.124
NP_442536.1_8 Forward -173 -154 12.6841 0.251
NP_440496.1_1 Forward -185 -166 11.0125 0.14
NP_442002.1_1 Forward -35 -17 -7.84733 0.257
NP_442002.1_9 Reverse -33 -40 12.2322 0.185
NP_441294.1_7 Reverse -196 -210 8.77068 0.281
NP_441646.1_1 Reverse -226 -245 -0.688862 0.271
NP_442431.1_10 Forward -170 -152 4.83737 0.206
NP_442431.1_10 Forward -182 -164 -0.374176 0.287
NP_440147.1_3 Forward -176 -157 10.4225 0.115
NP_441916.1_7 Reverse -363 -373 3.61828 0.208
NP_441041.1_7 Reverse -121 -133 6.83453 0.19
NP_441725.1_5 Reverse -389 -399 5.19158 0.115
NP_441725.1_5 Forward -371 -361 -0.511621 0.26
NP_439966.1_9 Reverse -122 -131 7.07956 0.253
NP_440674.1_1 Forward -78 -59 12.8808 0.276
NP_440983.1_5 Reverse -153 -172 -9.24366 0.3
NP_440260.1_8 Forward -352 -334 -4.11075 0.264
NP_441514.1_1 Reverse -77 -87 13.4856 0.284
NP_442281.1_1 Reverse -358 -372 7.86545 0.0907
NP_441556.1_7 Forward -277 -258 -0.984623 0.3
NP_441644.1_6 Reverse -363 -373 5.97777 0.172
NP_442215.1_1 Reverse -55 -74 3.14605 0.288
NP_442215.1_2 Reverse -198 -214 -2.30141 0.195
NP_440253.1_2 Forward -133 -115 -2.93078 0.28
NP_440566.1_2 Forward -259 -240 7.66927 0.218
NP_442933.1_10 Reverse -261 -270 9.63616 0.0616
NP_442554.1_8 Reverse -364 -374 4.89658 0.168
NP_442554.1_8 Forward -371 -361 3.71661 0.215
NP_441762.1_7 Forward -134 -122 -3.99259 0.148
NP_442142.1_4 Forward -273 -260 7.19687 0.144
NP_442142.1_4 Reverse -121 -134 4.64028 0.214
NP_440919.1_7 Reverse -215 -233 7.18626 0.228
NP_440919.1_7 Forward -85 -67 5.64375 0.285
NP_440919.1_7 Reverse -235 -253 4.67968 0.289
NP_441525.1_1 Forward -270 -257 11.3273 0.296
NP_441024.1_7 Forward -48 -30 8.17984 0.3
NP_440730.1_4 Forward -398 -379 -5.50708 0.298
NP_441448.1_1 Reverse -246 -265 7.47261 0.221
NP_441468.1_1 Reverse -364 -371 3.97235 0.277
NP_441015.1_10 Forward -260 -241 -7.86702 0.272
NP_441016.2_1 Reverse -241 -260 17.109 0.27
NP_441956.1_10 Reverse -66 -80 18.2885 0.233
NP_440265.1_8 Reverse -63 -81 15.8504 0.216
NP_441826.1_2 Reverse -382 -396 -1.37704 0.245
NP_442808.1_1 Reverse -58 -68 4.99446 0.178
NP_442808.1_1 Forward -268 -258 1.45457 0.285
NP_442542.1_2 Forward -170 -157 7.09911 0.193
NP_440630.1_7 Reverse -150 -169 9.83255 0.0211
NP_441937.1_5 Reverse -246 -265 2.3594 0.278
NP_441114.1_3 Reverse -259 -268 6.39124 0.277
NP_440558.1_2 Forward -270 -251 10.7175 0.0935
NP_440558.1_2 Reverse -254 -273 7.27595 0.12
NP_440558.1_2 Forward -245 -226 -4.52377 0.246
NP_440558.1_2 Reverse -121 -140 -5.80207 0.264
NP_441048.1_4 Forward -371 -352 11.6025 0.266
NP_442789.1_4 Forward -260 -241 -6.49039 0.285
NP_441878.1_6 Reverse -362 -372 1.65166 0.0795
NP_441878.1_6 Forward -398 -388 1.65166 0.0795
NP_441445.1_1 Forward -218 -199 6.98095 0.138
NP_441445.1_1 Forward -177 -158 3.93269 0.204
NP_441433.1_2 Forward -114 -95 13.7658 0.265
NP_442419.1_2 Reverse -241 -260 -3.63879 0.269
NP_441116.1_9 Forward -89 -75 11.7993 0.268
NP_440979.1_3 Reverse -45 -63 9.75391 0.293
NP_440979.1_6 Reverse -155 -174 14.7491 0.27
NP_442347.1_2 Reverse -262 -271 5.01461 0.244
NP_441037.1_4 Reverse -361 -371 6.34312 0.267
NP_442594.1_8 Forward -170 -151 9.0459 0.2
NP_442385.1_8 Forward -377 -358 6.09597 0.215
NP_442998.1_5 Forward -244 -234 7.35486 0.295
NP_440299.1_6 Reverse -211 -230 5.80098 0.276
NP_442802.1_2 Reverse -242 -261 12.9783 0.252
NP_441007.1_10 Forward -377 -364 2.47756 0.186
NP_442333.2_5 Reverse -148 -167 -9.53865 0.246
NP_440256.1_1 Forward -171 -152 -5.31042 0.18
NP_441229.1_10 Reverse -223 -242 1.17943 0.288
NP_441559.1_8 Reverse -253 -267 4.52282 0.117
NP_441559.1_8 Reverse -351 -365 0.982901 0.159
NP_441559.1_8 Forward -58 -44 0.88457 0.16
NP_441559.1_8 Forward -271 -257 -7.76856 0.299
NP_442158.1_4 Forward -198 -188 11.8781 0.264
NP_442866.1_1 Forward -377 -358 -6.29373 0.254
NP_442866.1_1 Forward -320 -301 -7.96535 0.274
NP_440748.1_5 Forward -264 -245 12.0942 0.127
NP_441464.1_10 Forward -163 -149 8.16106 0.287
NP_441494.1_6 Reverse -252 -265 9.2624 0.227
NP_441404.1_8 Reverse -317 -331 14.8469 0.271
NP_441340.1_5 Forward -371 -364 4.07068 0.239
NP_442240.1_1 Reverse -380 -399 4.03023 0.275
NP_440161.1_3 Reverse -122 -141 14.0608 0.126
NP_442714.1_7 Reverse -258 -277 -0.39387 0.263
NP_440586.1_8 Forward -371 -364 12.8218 0.0395
NP_440586.1_8 Reverse -207 -214 7.02027 0.279
NP_442251.1_6 Reverse -125 -132 8.69224 0.199
NP_440192.1_4 Reverse -255 -274 13.5695 0.169
NP_440684.1_9 Reverse -258 -272 7.57108 0.261
NP_440027.1_3 Reverse -382 -400 9.16315 0.187
NP_440027.1_8 Reverse -242 -261 6.48849 0.27
NP_441232.1_10 Forward -167 -148 2.65439 0.243
NP_439937.1_8 Forward -272 -253 -2.0655 0.254
NP_439937.1_9 Forward -268 -251 2.98806 0.0798
NP_439937.1_9 Reverse -256 -273 -12.1548 0.27
NP_439937.1_9 Reverse -275 -292 -17.268 0.296
NP_441595.1_2 Reverse -186 -199 12.0938 0.277
NP_441789.1_7 Reverse -160 -179 -2.8529 0.264
NP_442285.1_7 Forward -346 -327 9.14423 0.274
NP_440316.1_10 Forward -398 -388 7.55152 0.246
NP_441803.1_2 Forward -275 -256 15.7324 0.0384
NP_441877.1_7 Reverse -241 -260 0.293673 0.269
NP_442262.1_10 Forward -371 -364 10.3639 0.153
NP_441689.1_5 Forward -322 -312 5.68278 0.215
NP_440163.1_10 Reverse -203 -213 10.7964 0.193
NP_442910.1_1 Reverse -225 -244 1.47442 0.133
NP_440297.1_9 Forward -396 -386 1.06167 0.282
NP_440297.1_9 Forward -371 -361 0.176696 0.282
NP_440999.1_9 Reverse -257 -271 3.93283 0.12
NP_440888.1_2 Reverse -382 -396 8.45543 0.16
NP_440600.1_4 Reverse -374 -392 -2.63579 0.204
NP_441543.1_2 Forward -371 -362 5.21127 0.209
NP_442315.1_1 Forward -220 -202 3.55906 0.287
NP_441306.1_10 Forward -45 -31 14.2569 0.25
NP_441621.1_7 Forward -135 -121 -3.34366 0.188
NP_441601.1_4 Reverse -241 -260 -2.65548 0.293
NP_441410.1_3 Reverse -297 -316 3.83436 0.295
NP_440519.1_8 Reverse -252 -268 2.71347 0.259
NP_442204.1_1 Reverse -352 -363 9.49844 0.0759
NP_442428.1_5 Reverse -364 -371 4.36568 0.271
NP_442428.1_8 Forward -259 -240 4.22769 0.224
NP_441443.1_7 Forward -171 -152 -2.16383 0.268
NP_442120.1_10 Forward -371 -352 -11.2103 0.262
NP_440673.1_2 Forward -345 -326 12.3406 0.149
NP_440673.1_3 Reverse -126 -133 10.4622 0.139
NP_441052.1_2 Forward -209 -199 1.06167 0.252
NP_442907.1_9 Reverse -54 -73 -6.78538 0.293
NP_441004.1_1 Forward -186 -167 -9.44032 0.207
NP_442366.1_3 Reverse -260 -278 -4.70074 0.275
NP_442206.1_7 Forward -126 -107 11.8975 0.295
NP_440328.1_4 Reverse -357 -376 1.47442 0.224
NP_443054.1_2 Reverse -354 -368 -0.0987402 0.284
NP_442430.1_2 Forward -219 -200 1.57275 0.271
NP_441851.1_10 Reverse -362 -372 5.97822 0.19
NP_442814.1_2 Reverse -257 -276 5.80098 0.259
NP_442011.1_9 Reverse -257 -276 9.14423 0.286
NP_442856.1_7 Forward -400 -381 -5.70374 0.286
NP_441668.1_4 Reverse -35 -54 3.73603 0.185
NP_442709.1_3 Reverse -214 -233 4.916 0.224
NP_442689.1_3 Reverse -354 -373 15.6341 0.123
NP_441661.1_3 Forward -249 -232 -4.68105 0.245
NP_441394.1_2 Reverse -262 -281 17.0107 0.251
NP_440474.1_8 Reverse -364 -378 12.782 0.0806
NP_442450.1_5 Reverse -361 -371 5.5849 0.237
NP_442006.1_2 Forward -255 -238 -15.9891 0.235
NP_442243.1_1 Forward -378 -360 0.411736 0.231
NP_441570.1_1 Forward -168 -150 -17.6804 0.287
NP_441570.1_2 Forward -247 -229 6.214 0.267
NP_440707.1_6 Forward -51 -32 10.4217 0.283
NP_442443.1_1 Reverse -348 -367 0.884433 0.215
NP_440526.1_3 Forward -371 -360 1.72983 0.267
NP_441432.1_8 Forward -392 -383 5.70292 0.144
NP_441432.1_8 Forward -69 -60 3.24465 0.252
NP_440629.1_4 Reverse -66 -85 21.6323 0.0501
NP_442797.1_1 Reverse -151 -170 4.916 0.19
NP_442797.1_7 Reverse -244 -262 7.4923 0.198
NP_441131.1_5 Reverse -43 -62 8.16093 0.251
NP_441805.1_6 Reverse -253 -272 12.5858 0.19
NP_439935.1_1 Reverse -357 -376 5.99764 0.281
NP_442727.1_1 Reverse -245 -259 12.6843 0.256
NP_442489.1_7 Reverse -363 -372 5.3096 0.0708
NP_442489.1_7 Forward -53 -44 5.01461 0.0832
NP_442489.1_7 Reverse -44 -53 -1.86856 0.259
NP_441452.1_1 Reverse -240 -259 14.4541 0.292
NP_440559.1_1 Forward -371 -362 4.62128 0.24
NP_441022.1_1 Reverse -192 -201 10.491 0.299
NP_442346.1_5 Forward -336 -326 8.23984 0.143
NP_442346.1_5 Reverse -362 -372 6.07655 0.216
NP_440545.1_3 Reverse -359 -376 1.51381 0.118
NP_440831.1_3 Forward -127 -108 15.5124 0.104
NP_441786.1_10 Forward -275 -256 5.80098 0.287
NP_440486.1_6 Forward -283 -264 8.75091 0.235
NP_441653.1_2 Forward -265 -246 7.00843 0.223
NP_440010.1_10 Reverse -228 -247 7.66927 0.226
NP_440010.1_10 Forward -347 -328 6.09597 0.226
NP_440010.1_10 Reverse -104 -123 3.04771 0.264
NP_441943.1_8 Forward -251 -232 -6.09707 0.261
NP_442311.1_5 Forward -49 -30 2.0644 0.254
NP_440847.1_5 Forward -135 -116 11.2092 0.281
NP_441585.1_5 Reverse -334 -353 0.490334 0.291
NP_441833.1_3 Forward -20 -6 18.8791 0.133
NP_441112.1_5 Reverse -288 -307 11.7008 0.154
NP_440204.1_1 Forward -173 -154 2.16274 0.278
NP_442140.1_3 Forward -132 -122 8.1415 0.123
NP_440875.1_9 Reverse -365 -375 12.7522 0.104
NP_440594.1_5 Reverse -88 -107 3.9319 0.293
NP_440567.1_1 Reverse -364 -378 -0.393733 0.281
NP_442497.1_10 Forward -371 -362 0.29472 0.199
NP_441239.1_9 Forward -399 -387 10.5604 0.076
NP_441239.1_9 Forward -374 -362 9.28209 0.11
NP_441239.1_9 Reverse -157 -169 3.18557 0.292
NP_441951.1_9 Reverse -253 -272 -1.08219 0.283
NP_442270.1_9 Reverse -241 -260 -9.63698 0.238
NP_442643.1_3 Forward -260 -241 -4.52377 0.261
NP_440949.1_7 Reverse -151 -170 12.29 0.214
NP_440391.1_5 Forward -47 -28 7.57094 0.276
NP_440391.1_7 Forward -378 -359 7.76679 0.273
NP_442809.1_6 Forward -180 -161 2.0644 0.269
NP_440546.1_4 Reverse -267 -277 6.45857 0.296
NP_440546.1_6 Reverse -251 -270 7.66927 0.268
NP_441230.1_3 Reverse -255 -274 11.7992 0.145
NP_442340.1_3 Reverse -328 -347 7.27595 0.11
NP_442340.1_3 Forward -166 -147 -11.3086 0.299
NP_440868.1_4 Reverse -120 -132 -1.04266 0.291
NP_441204.1_1 Forward -134 -115 17.0107 0.0808
NP_441582.1_5 Reverse -230 -249 16.3215 0.101
NP_442402.1_4 Forward -49 -30 -0.787962 0.189
NP_442402.1_4 Reverse -360 -379 -7.6711 0.278
NP_441848.1_4 Reverse -70 -86 9.93796 0.267
NP_441843.2_4 Reverse -355 -374 19.4492 0.163
NP_440825.1_6 Forward -178 -159 9.83255 0.285
NP_442837.1_3 Reverse -262 -269 6.82395 0.184
NP_440160.1_2 Reverse -273 -292 -3.3438 0.259
NP_440160.1_9 Reverse -109 -128 7.96426 0.27
NP_440505.1_3 Forward -393 -383 5.68323 0.217
NP_441102.1_10 Forward -196 -177 5.30933 0.297
NP_441252.1_6 Reverse -31 -38 14.3954 0.168
NP_442532.1_7 Reverse -363 -377 12.6843 0.0917
NP_442533.1_1 Forward -186 -167 -9.93197 0.23
NP_442533.1_6 Forward -209 -200 2.35967 0.259
NP_442533.1_6 Reverse -389 -398 1.37636 0.3
NP_442322.1_2 Reverse -78 -97 19.0748 0.13
NP_442229.1_1 Forward -374 -360 7.47213 0.196
NP_441028.1_6 Reverse -174 -184 14.9258 0.158
NP_441028.1_6 Forward -346 -336 10.1076 0.21
NP_441028.1_6 Reverse -237 -247 6.27276 0.23
NP_441028.1_6 Reverse -262 -272 3.51951 0.292
NP_440721.1_1 Forward -134 -115 17.109 0.0236
NP_440721.1_3 Forward -331 -312 20.6481 0.0293
NP_440721.1_4 Forward -290 -271 17.0107 0.254
NP_440721.1_5 Forward -229 -210 14.9449 0.14
NP_440721.1_6 Forward -24 -5 18.8597 0.086
NP_440721.1_7 Forward -83 -64 17.404 0.161
NP_442202.1_1 Reverse -208 -224 19.2225 0.0603
NP_441680.1_4 Forward -256 -237 6.29264 0.176
NP_441602.1_3 Forward -173 -154 -4.32711 0.263
NP_441809.1_7 Forward -226 -207 6.68596 0.245
NP_440828.1_4 Reverse -325 -344 -6.3928 0.273
NP_442614.1_2 Forward -335 -321 7.17775 0.275
NP_441427.1_2 Reverse -240 -259 7.07928 0.276
NP_441021.1_1 Forward -371 -352 -7.67036 0.187
NP_442211.1_3 Reverse -330 -349 7.27748 0.283
NP_441962.1_4 Reverse -145 -164 -10.0303 0.223
NP_441962.1_4 Forward -340 -321 -12.5869 0.26
NP_441431.1_2 Reverse -121 -135 7.47213 0.241
NP_441836.1_2 Reverse -320 -339 -5.80207 0.288
NP_441993.1_1 Forward -371 -352 4.38312 0.221
NP_440114.1_10 Reverse -124 -138 5.99778 0.289
NP_440114.1_10 Reverse -363 -377 5.80112 0.292
NP_441206.1_7 Reverse -357 -375 5.23069 0.2
NP_441500.1_6 Reverse -28 -46 15.9488 0.168
NP_440287.1_6 Forward -374 -355 2.0644 0.254
NP_440293.1_3 Forward -132 -113 -2.85214 0.241
NP_440293.1_3 Reverse -225 -244 -4.6221 0.264
NP_440293.1_3 Reverse -249 -268 -6.58872 0.291
NP_440766.1_5 Reverse -31 -43 9.75661 0.275
NP_440766.1_5 Reverse -272 -284 8.80169 0.277
NP_441237.1_9 Forward -371 -361 14.828 0.0242
NP_441237.1_9 Reverse -125 -135 9.61647 0.281
NP_442743.1_4 Forward -254 -235 -6.39206 0.279
NP_441246.1_1 Forward -185 -166 6.09597 0.185
NP_442867.1_8 Reverse -19 -38 3.83436 0.297
NP_440801.1_10 Forward -274 -255 5.211 0.289
NP_441984.1_1 Reverse -255 -273 10.4422 0.207
NP_441332.1_6 Reverse -151 -161 10.7754 0.287
NP_440473.1_9 Reverse -352 -371 -7.86702 0.24
NP_442509.1_9 Forward -20 -10 9.12434 0.192
NP_441253.1_1 Reverse -353 -372 4.71934 0.271
NP_441253.1_8 Reverse -358 -372 11.8274 0.229
NP_442439.1_8 Reverse -325 -344 8.35759 0.253
NP_442862.1_3 Forward -220 -203 7.31533 0.258
NP_442862.1_3 Reverse -216 -233 5.64371 0.268
NP_442737.1_7 Forward -69 -50 17.6007 0.205
NP_441885.1_5 Forward -391 -381 -1.29827 0.259
NP_440507.2_3 Forward -171 -152 8.06178 0.261
NP_441842.1_1 Reverse -365 -378 12.8017 0.185
NP_441359.1_5 Reverse -242 -261 14.6508 0.0556
NP_439962.1_4 Reverse -238 -257 -5.9004 0.28
NP_442495.1_4 Forward -189 -179 12.0747 0.25
NP_441105.1_3 Reverse -246 -265 -8.16202 0.267
NP_441105.1_3 Forward -85 -66 -9.63698 0.292
NP_440216.1_9 Reverse -207 -216 8.06287 0.286
NP_441718.1_4 Forward -376 -357 11.0117 0.299
NP_442015.1_10 Reverse -111 -124 -0.767364 0.281
NP_443052.1_9 Reverse -241 -260 2.0644 0.177
NP_442116.1_1 Forward -135 -117 19.7837 0.126
NP_442154.1_1 Forward -170 -152 -11.5839 0.215
NP_442154.1_6 Reverse -254 -273 8.55425 0.205
NP_440261.1_5 Reverse -160 -173 -10.7971 0.21
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGGGCACTGGCACTCGGTAAATGTGGATGCCATCGACCATTTCCTGGGACGGACTTTCCTCTGTGGCCACGGTAATTAAATGGATCTCATAGCCCTGTTGAACTAATTCTGGGTAGAGTTCTGCCACATGGCGAGCAATGCCGCCGACAATGCGGGGGGGAAATTCCCAAGCTAGCACCAAGATTTTCATGGCTGTGACCAATTTTTGTGAGTGCATGGAGGGAAAGTCGGGGCTATTGGTGTCGTGGGCACTCTAAAACATTATGCGCAATCGTGGCGTGGCCACACGGCCAAATTCGTTTCGGAGGTTAGTTAATTTTGCTGGAGTTCTGGCTTTCGAGTTGCAGTCAATTGCCAATGTTTGCCCAACTGAGGGAATGAAGAACCGGCTAAAGATTG

CDS

GTGCTAAATGTCCGGAGACTCCACCCAAACAGTAAACTTGCCATAGGAACTTTTTCAATCTGTGTCAGGGAGGCGAGTGTGGACGATACTTACCAAGGCTATATCAATCGGGTGGCGCCCCAAACCTTGGCGATCGCCTACGAGCAACAATTGATTAATGCTCAAGGTTCTCCCAAGTTTGACCAAGGACAGCCGGTGCCTTTTCCCGGTTTCAGTGTGGTAACTCCTATTGCCGCTGATGATCCCACTAACCAGAGCTTTTATGGCCATCTGACTACTGTACAGGGCCAGGTGGGAGAAATTTTGGGGGAGAGTTTTGTGGCGGTGCCCCCGGAAAGCTTGCACCTCACCGTAGCAGACTTGATTTGGGATGGCCCCTACCAGGCCCTACGTCGTCATAATCCTGACTTTGAAAAACAACTTTGTAACTGTTTGCAACATTCCTTTGCGGATCACCAACATCAGTCGGGGCCATACTCCGGCTGCCAATGGCAGGTCCTGGGATTGTTGGTTTTACCCCGTTCCTTGGGGGTGGTTTTGGTGCCCCAACGGGAAGCGGATTATGAACCGATACTTAAGGTACGACGGGCCATTTTCCAAAATCCCACCCTGATTGGTTTAGGCATTGAGCAACAGTACCGTTACACGGCCCACATCACCCTTGGTTACTTCGACCCGGCGATCGAGAAGTTGGCAGATTCGATCGGAGTTAGTGAACAGTTGGCTGCTGTCAATGACCGCTGGATTGGCCATGACCCAGAGATTTTAGATATTCATAGCATTGAGCTGCGCTATTTCAGCGATATGACCCAATTTACTCGCCAGGACTACTATCCCGTTTTGAGGGCTAGCTAG

Protein

MLNVRRLHPNSKLAIGTFSICVREASVDDTYQGYINRVAPQTLAIAYEQQLINAQGSPKFDQGQPVPFPGFSVVTPIAADDPTNQSFYGHLTTVQGQVGEILGESFVAVPPESLHLTVADLIWDGPYQALRRHNPDFEKQLCNCLQHSFADHQHQSGPYSGCQWQVLGLLVLPRSLGVVLVPQREADYEPILKVRRAIFQNPTLIGLGIEQQYRYTAHITLGYFDPAIEKLADSIGVSEQLAAVNDRWIGHDPEILDIHSIELRYFSDMTQFTRQDYYPVLRAS