Your browser is old and dusty. Try Google Chrome!

Details for slr2062

ORF slr2062
Accession NP_441190.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY052a: 1420842 - 1422331]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440815.1_5 Forward -298 -279 4.03102 0.286
NP_441453.1_4 Forward -379 -371 3.85433 0.284
NP_441453.1_7 Reverse -280 -287 12.9205 0.23
NP_440561.1_4 Reverse -286 -305 12.9187 0.231
NP_440120.1_4 Forward -328 -314 13.3726 0.29
NP_442752.1_4 Forward -283 -276 5.44732 0.202
NP_443027.1_4 Forward -285 -275 7.55152 0.24
NP_443027.1_4 Forward -381 -371 7.15819 0.244
NP_441812.1_1 Reverse -172 -186 17.7968 0.17
NP_440074.1_6 Reverse -241 -260 11.405 0.268
NP_441675.1_4 Forward -61 -42 7.96426 0.232
NP_440061.1_9 Forward -299 -285 13.6669 0.0775
NP_440061.1_9 Forward -300 -286 7.17714 0.216
NP_440061.1_9 Reverse -291 -305 7.07881 0.219
NP_442062.1_8 Forward -379 -369 3.81494 0.252
NP_441781.1_7 Reverse -288 -307 -2.26216 0.289
NP_441208.1_1 Forward -271 -252 -6.58872 0.287
NP_441208.1_9 Reverse -285 -299 6.78443 0.229
NP_441546.1_4 Reverse -243 -262 14.1591 0.236
NP_442827.1_8 Reverse -118 -137 -1.08295 0.241
NP_441149.1_9 Reverse -353 -372 1.6703 0.221
NP_441738.1_2 Reverse -276 -283 9.77352 0.143
NP_441738.1_2 Reverse -246 -253 8.29857 0.176
NP_441444.1_1 Forward -315 -296 2.65439 0.295
NP_439953.1_2 Forward -304 -286 5.91901 0.294
NP_440747.1_10 Forward -300 -288 -12.1541 0.227
NP_441847.1_3 Forward -61 -43 18.2104 0.0556
NP_442973.1_5 Reverse -361 -380 9.73422 0.296
NP_442634.1_4 Forward -285 -271 -3.44199 0.161
NP_443018.1_3 Reverse -371 -378 4.26735 0.267
NP_443018.1_3 Forward -378 -371 4.07068 0.299
NP_440376.1_1 Reverse -288 -297 3.63797 0.2
NP_441857.1_5 Reverse -363 -381 9.95058 0.185
NP_440642.1_10 Forward -95 -81 1.37564 0.293
NP_440236.1_3 Forward -113 -100 16.9322 0.181
NP_442658.1_1 Reverse -368 -378 10.796 0.107
NP_442658.1_1 Forward -299 -289 7.55106 0.214
NP_442782.1_2 Reverse -329 -343 1.86788 0.281
NP_441958.1_2 Reverse -279 -298 9.3409 0.299
NP_441958.1_5 Reverse -125 -135 -1.78992 0.252
NP_441958.1_5 Forward -324 -314 -2.47824 0.273
NP_440203.1_5 Forward -132 -122 9.71433 0.245
NP_439905.1_3 Forward -307 -288 16.3224 0.185
NP_440984.1_7 Reverse -283 -297 8.25939 0.152
NP_440984.1_7 Reverse -365 -379 4.62115 0.296
NP_442911.1_2 Reverse -377 -396 -10.6203 0.284
NP_440153.1_8 Forward -298 -285 -3.61896 0.296
NP_441591.1_10 Forward -381 -362 4.52268 0.297
NP_443055.1_6 Forward -297 -279 6.01657 0.172
NP_443055.1_6 Reverse -254 -272 -2.04653 0.287
NP_442440.1_4 Reverse -352 -371 17.3048 0.197
NP_442440.1_7 Reverse -283 -302 10.6192 0.215
NP_441916.1_7 Reverse -370 -380 5.28991 0.138
NP_440206.1_4 Reverse -269 -288 0.293673 0.289
NP_439966.1_7 Reverse -261 -271 7.15773 0.154
NP_440736.1_3 Reverse -124 -143 -1.18052 0.282
NP_441514.1_6 Reverse -306 -313 14.2971 0.248
NP_442281.1_1 Reverse -365 -379 4.32555 0.199
NP_441334.1_7 Reverse -272 -291 -15.4385 0.275
NP_441556.1_7 Reverse -278 -297 9.93006 0.171
NP_441556.1_10 Reverse -283 -297 11.5845 0.223
NP_442982.1_5 Reverse -297 -316 13.9625 0.0761
NP_442982.1_5 Reverse -80 -99 2.3594 0.218
NP_441644.1_6 Reverse -288 -298 3.61784 0.272
NP_440867.1_10 Reverse -279 -298 1.47442 0.295
NP_442247.1_6 Forward -298 -279 14.2574 0.14
NP_440253.1_2 Reverse -126 -144 -2.53746 0.268
NP_442933.1_6 Reverse -200 -219 18.6683 0.107
NP_442933.1_10 Reverse -370 -379 4.81794 0.212
NP_442933.1_10 Forward -379 -370 4.12963 0.28
NP_442142.1_4 Reverse -367 -380 3.7553 0.246
NP_442142.1_4 Forward -242 -229 2.57534 0.286
NP_442142.1_4 Reverse -360 -373 2.37867 0.294
NP_443009.1_5 Reverse -287 -298 8.90795 0.0965
NP_443009.1_5 Forward -298 -287 5.07306 0.218
NP_440730.1_4 Reverse -288 -307 -4.91709 0.298
NP_441198.1_8 Reverse -286 -296 11.8064 0.183
NP_440379.1_5 Forward -312 -293 -10.9153 0.285
NP_441468.1_1 Reverse -371 -378 4.07068 0.263
NP_442253.1_5 Reverse -285 -302 2.30045 0.156
NP_441876.1_9 Forward -292 -282 10.3043 0.295
NP_441330.1_1 Forward -384 -365 -4.03212 0.0864
NP_441330.1_1 Reverse -202 -221 -15.4385 0.281
NP_442227.1_2 Forward -47 -28 -1.08219 0.262
NP_442808.1_1 Reverse -261 -271 3.22451 0.247
NP_441114.1_3 Forward -296 -287 7.57121 0.231
NP_440558.1_2 Reverse -285 -304 8.45592 0.111
NP_440558.1_2 Forward -301 -282 -1.7705 0.218
NP_442576.1_9 Forward -149 -135 15.7678 0.291
NP_441048.1_6 Reverse -243 -257 16.9137 0.296
NP_440274.1_2 Forward -44 -30 14.8469 0.236
NP_441878.1_6 Reverse -287 -297 1.25834 0.108
NP_441878.1_6 Forward -298 -288 -7.49312 0.231
NP_442503.1_9 Forward -229 -210 6.98095 0.272
NP_441445.1_8 Forward -42 -23 -12.2919 0.277
NP_441914.1_9 Reverse -288 -302 17.4042 0.246
NP_442397.1_9 Forward -344 -325 4.22769 0.254
NP_442397.1_9 Forward -323 -304 3.83436 0.262
NP_441549.1_9 Reverse -284 -302 7.98396 0.0711
NP_442888.1_6 Reverse -359 -378 4.81767 0.228
NP_441633.1_3 Forward -299 -286 -4.7006 0.209
NP_440899.1_2 Forward -294 -275 12.4867 0.112
NP_440899.1_8 Forward -90 -71 -9.73531 0.268
NP_440810.1_8 Reverse -346 -365 16.9115 0.232
NP_441799.1_1 Reverse -122 -136 3.8339 0.279
NP_441799.1_1 Forward -383 -369 3.73557 0.284
NP_440640.1_6 Forward -378 -359 -0.000545616 0.277
NP_440256.1_1 Reverse -367 -386 -8.35868 0.259
NP_440256.1_1 Forward -382 -363 -10.1286 0.295
NP_441559.1_8 Forward -302 -288 10.1277 0.0614
NP_441559.1_8 Reverse -249 -263 3.34284 0.143
NP_441559.1_8 Reverse -284 -298 -6.88358 0.281
NP_440915.1_6 Forward -301 -287 2.45787 0.118
NP_442158.1_4 Forward -231 -221 10.5998 0.285
NP_442452.1_3 Forward -71 -52 1.17943 0.282
NP_441464.1_10 Forward -274 -260 8.55439 0.28
NP_441494.1_6 Reverse -283 -296 15.6539 0.127
NP_442993.1_1 Forward -323 -307 -8.88958 0.176
NP_442386.1_9 Reverse -261 -270 9.34074 0.166
NP_442386.1_9 Reverse -369 -378 5.0142 0.27
NP_441340.1_5 Forward -378 -371 3.97235 0.274
NP_442484.1_4 Forward -315 -296 27.6295 0.000314
NP_442791.1_5 Reverse -281 -300 -9.63698 0.279
NP_441254.1_1 Reverse -240 -253 10.5401 0.295
NP_442474.1_9 Forward -375 -356 11.3075 0.205
NP_441134.1_10 Forward -340 -322 16.5388 0.145
NP_440586.1_8 Forward -378 -371 9.57686 0.146
NP_442251.1_6 Reverse -346 -353 6.43063 0.298
NP_441262.1_7 Forward -232 -213 23.2047 0.029
NP_440027.1_3 Reverse -360 -378 10.0481 0.177
NP_439937.1_9 Forward -299 -282 -11.2699 0.248
NP_440439.1_1 Forward -286 -273 2.47756 0.133
NP_441181.1_2 Forward -239 -220 10.5209 0.17
NP_441803.1_2 Reverse -358 -377 -0.197208 0.269
NP_441572.1_7 Reverse -268 -287 -6.09707 0.281
NP_442384.1_10 Forward -135 -122 1.29759 0.263
NP_442114.1_2 Forward -31 -12 2.0644 0.262
NP_440531.1_6 Reverse -280 -299 1.86774 0.166
NP_440531.1_6 Reverse -362 -381 -2.95047 0.26
NP_441060.1_1 Forward -262 -243 12.2785 0.294
NP_441335.1_9 Reverse -280 -298 18.7012 0.0653
NP_442280.1_10 Reverse -289 -307 7.49983 0.268
NP_442280.1_10 Forward -312 -294 6.72063 0.268
NP_441103.1_9 Forward -314 -304 14.931 0.192
NP_442067.1_4 Reverse -277 -296 7.66927 0.194
NP_440999.1_9 Forward -239 -225 -0.688726 0.214
NP_440888.1_2 Forward -316 -302 10.2254 0.1
NP_440888.1_2 Reverse -288 -302 7.96378 0.175
NP_443064.1_8 Forward -309 -299 16.2041 0.223
NP_442204.1_1 Forward -287 -276 2.12362 0.266
NP_442428.1_5 Reverse -371 -378 4.46401 0.267
NP_440783.1_3 Forward -353 -334 -0.295539 0.266
NP_441267.1_1 Forward -304 -285 2.55606 0.234
NP_440673.1_3 Forward -133 -126 7.51227 0.252
NP_441052.1_2 Reverse -262 -272 3.02829 0.185
NP_440436.1_4 Forward -378 -369 10.7174 0.0743
NP_442577.1_1 Forward -283 -264 2.0644 0.192
NP_441004.1_1 Forward -269 -250 -3.24547 0.155
NP_441004.1_1 Forward -349 -330 -4.6221 0.172
NP_441004.1_1 Forward -378 -359 -12.5869 0.247
NP_442873.1_5 Forward -289 -270 12.4867 0.216
NP_442694.1_4 Forward -252 -243 12.9794 0.225
NP_443054.1_2 Forward -299 -285 6.3911 0.198
NP_443054.1_2 Reverse -261 -275 4.81781 0.24
NP_443054.1_2 Forward -332 -318 0.589577 0.258
NP_441851.1_10 Reverse -287 -297 4.69992 0.254
NP_440463.1_8 Reverse -312 -331 5.07958 0.292
NP_440165.1_3 Forward -135 -121 15.7319 0.276
NP_440432.1_9 Reverse -371 -386 6.9614 0.0441
NP_442843.1_1 Forward -378 -359 -11.5053 0.291
NP_442843.1_1 Reverse -280 -299 -11.8986 0.295
NP_442843.1_5 Forward -27 -8 18.3618 0.147
NP_440588.1_2 Reverse -117 -136 -4.52377 0.22
NP_440588.1_7 Reverse -5 -24 15.3391 0.227
NP_442006.1_2 Reverse -76 -93 -10.4826 0.197
NP_442006.1_2 Forward -332 -315 -17.2674 0.271
NP_442243.1_3 Forward -323 -304 19.1731 0.0877
NP_441570.1_1 Forward -360 -342 -17.7788 0.291
NP_441078.1_4 Forward -297 -288 5.60459 0.111
NP_442348.1_2 Forward -253 -244 17.011 0.055
NP_441094.1_6 Reverse -307 -324 9.67453 0.257
NP_441432.1_8 Reverse -125 -134 11.9961 0.0519
NP_441432.1_8 Forward -298 -289 5.40793 0.158
NP_441432.1_9 Reverse -47 -60 12.8645 0.191
NP_440713.1_4 Forward -44 -25 1.57275 0.284
NP_442489.1_7 Forward -297 -288 -1.6719 0.235
NP_442489.1_7 Reverse -288 -297 -1.96689 0.28
NP_440426.1_7 Forward -293 -274 11.3075 0.124
NP_440363.1_8 Reverse -280 -299 9.93088 0.288
NP_442346.1_5 Forward -380 -370 11.0914 0.0764
NP_442346.1_10 Forward -319 -300 2.85105 0.194
NP_440545.1_3 Forward -301 -284 -3.30441 0.203
NP_440545.1_3 Reverse -284 -301 -5.66436 0.256
NP_442934.1_9 Reverse -163 -181 19.587 0.153
NP_442137.1_1 Forward -346 -327 4.916 0.29
NP_440847.1_3 Forward -93 -79 12.8803 0.232
NP_440170.1_6 Forward -302 -283 10.8159 0.298
NP_440224.1_3 Forward -337 -318 15.3391 0.192
NP_442199.1_5 Forward -387 -368 -4.52377 0.229
NP_442140.1_3 Forward -378 -368 10.5998 0.0902
NP_441671.1_10 Reverse -282 -301 1.57275 0.265
NP_442497.1_2 Forward -63 -44 13.4708 0.206
NP_441239.1_9 Forward -299 -287 4.36554 0.253
NP_441017.1_8 Reverse -285 -300 11.583 0.188
NP_442629.1_3 Forward -380 -361 -0.787193 0.3
NP_440354.1_7 Forward -385 -367 9.55725 0.224
NP_440546.1_4 Forward -379 -369 10.6277 0.109
NP_441509.1_2 Reverse -109 -127 13.4905 0.145
NP_440462.1_6 Forward -285 -275 3.91327 0.224
NP_442499.1_4 Forward -152 -138 23.4024 0.00878
NP_442479.1_9 Reverse -334 -353 -13.4719 0.288
NP_441868.1_4 Forward -304 -290 15.4376 0.282
NP_442402.1_4 Reverse -248 -267 -2.95123 0.209
NP_441084.1_6 Forward -381 -367 14.4828 0.0972
NP_441084.1_6 Reverse -217 -231 10.0228 0.255
NP_441084.1_6 Reverse -205 -219 9.92586 0.257
NP_442023.1_3 Reverse -168 -187 12.3883 0.261
NP_440232.1_2 Forward -160 -141 3.53937 0.171
NP_442696.1_6 Forward -302 -283 -1.96717 0.147
NP_440160.1_2 Reverse -288 -307 -7.96535 0.286
NP_439994.1_3 Forward -136 -117 7.95079 0.296
NP_440505.1_7 Forward -301 -282 0.0977854 0.259
NP_442360.1_5 Forward -337 -327 14.3364 0.233
NP_440914.1_1 Reverse -220 -230 7.15123 0.249
NP_442533.1_6 Forward -297 -288 6.98123 0.0992
NP_442541.1_3 Reverse -278 -297 10.6192 0.145
NP_441482.1_9 Forward -353 -340 12.0151 0.278
NP_441028.1_6 Reverse -355 -365 5.68278 0.243
NP_441028.1_6 Forward -293 -283 4.40448 0.278
NP_441527.1_4 Forward -156 -137 -8.16498 0.241
NP_441347.1_5 Forward -303 -289 18.2885 0.118
NP_441972.1_5 Forward -296 -277 -6.29373 0.229
NP_441106.1_1 Reverse -369 -378 10.8161 0.0311
NP_440429.1_2 Reverse -156 -175 8.55425 0.272
NP_441869.1_2 Forward -386 -367 11.6025 0.232
NP_439903.1_6 Forward -138 -119 -0.886293 0.287
NP_441930.1_2 Forward -298 -288 12.8614 0.248
NP_441463.1_6 Forward -299 -285 6.02939 0.283
NP_442842.1_4 Forward -282 -263 8.65258 0.223
NP_442084.1_6 Reverse -68 -86 4.83737 0.276
NP_440114.1_10 Reverse -370 -384 8.45605 0.202
NP_442323.1_7 Forward -288 -269 2.85027 0.258
NP_442087.1_2 Forward -272 -253 17.0844 0.117
NP_440293.1_4 Forward -176 -157 18.4857 0.194
NP_440293.1_9 Reverse -288 -302 10.2813 0.276
NP_441237.1_9 Forward -297 -287 10.2065 0.241
NP_442635.1_5 Reverse -298 -311 14.0806 0.221
NP_442867.1_8 Reverse -315 -334 8.45592 0.233
NP_440798.1_6 Reverse -315 -328 9.85238 0.0874
NP_442680.1_7 Reverse -97 -116 -3.63879 0.265
NP_441984.1_6 Forward -308 -296 15.5753 0.219
NP_440554.1_5 Reverse -99 -117 13.5888 0.158
NP_441173.1_9 Forward -125 -117 11.7204 0.226
NP_441173.1_9 Reverse -259 -267 10.2454 0.261
NP_441842.1_10 Forward -330 -316 12.8809 0.0895
NP_441190.1_5 Forward -23 -4 17.8948 0.153
NP_442495.1_4 Reverse -278 -288 15.5163 0.13
NP_441135.1_3 Reverse -286 -305 12.6841 0.199
NP_440261.1_5 Forward -296 -283 4.8375 0.0516
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGCAGGATATCTAACTCATCAAGCCATCGTTGATAGTGGAGGGAAAAGCAATCTTTGCGTAACGCTCTAGGCCAGTGGGAGATAGGTCTTCCCCTTCTGGCCAGGCAATGCCCCCCAGGGGATCTATCTGGGCTTGGCGGAAATAACGGGGATTTTTTAAGCGCCAGTAATTGTCATTGGTTTCAATGATTGTTTGAAGATCCAGAATCAATTCTTGACCATTTTCTAGTTTGATTTGCAGTTGAAAGTTATCCAGAGGAAATACACTGATTGCCTTCAACCAAGGAGTTTTAACCTGAGAGTTCATTCCATTTCTCCATTGACTCTGCTTGATTATCAGAAAAATGGGTTTAAAACCCCCTCCTTTAGGAGGGCTTTAATTTTCTTGTAGAATAACAGC

CDS

ATGAAGCTAAGGTATCAGTACCGATTTTACCCCACAAACCAACAGCGACAGGGCTTAGCCCAGTTGTTCGGATGTGTGCGGGTAGTGTGGAACGATGCTTTAGCTTTTTGCAAAGATTCGGAAAAATTGCCTTCCTACAATGCCCTGTCTAAACGGTTGACGGAATGCAAACAAACAGAGGAGAAAATTTGGCTTACTGATGTTTCGGCAGTTCCATTACAGCAATCGATCAGAAATCTTAGTGCGGCTTACAAAAACTTTTTTGATTCAGTCAACGGGAAACGCAAGGGAAAAAAGGTTAATCCTCCTAAATTCAAAAGTCGAAGATCCAAACAGTCTGCTACTTTTACCAGTGCCGGATTTGTCTTAAAAGATAACGACAGAATTTACCTAGCGAAAATTGGATTTCTCGATGTGGTCTGGAGTCGCCCCTTACCGTCAATACCTAGTTCAGTGACGGTGATTAAGGATAGGGCTAATCGGTACTTTTTAAGCTTTGTTGTCGAAGTTGACCCACAACAATTAGCCGACAATGGGCAGTCCGTAGGGATTGATCTTGGCATCATCGACTTTGCCACTTTGAGTACTGGAGAGAAAATCAAATCTCCCAAACCCTTAAAGGCAAAGCTAAAGCGACTGAGGAAGTGCCAGCGCAATCTTGCTCGTAAACAAAAGGGCAGTAAGCGACGGGAAAAAGCTCGTTTAAGAGTGGCTAAAGTCCATGCCAAGGTAAAAGATACCCGCACTGACTTTTTGCATAAACTGTCCACCAGATTGATCCGTGAGAACCAAACGGTGATTTTGGAGGATTTAAACACCGCCGGGATGATGAAAAATCGTCGTCTCTCCCGTGCCATTTCTGACCTTGGTTGGCGTAGTTTTCGGACGATACTAGAAGCTAAGGCAGTCATGTACGGCAGGGAATTTCGGACGATTTCCCGTTGGGAACCCACTTCTCAACGTTGCTCCTGTTGTGGTGAAATTGGCGGCAAAAAAGAACTCTCTGTTAGAGAATGGACTTGCCTTTTTTGTGGGGCAAACCACGACAGAGATATAAATGCCGCAACAAACATACTGGTCGCCGGAGGGCATTCGGAGACTAAAAACGGACGTGGAGGAAAGCGTCAGACTACTTCGGTAGCGGCATCCGGTGAAGCGTCAACCCACCGAAAAGCTATTCAGTTAACTCTGTTTGCTTCGTAG

Protein

MKLRYQYRFYPTNQQRQGLAQLFGCVRVVWNDALAFCKDSEKLPSYNALSKRLTECKQTEEKIWLTDVSAVPLQQSIRNLSAAYKNFFDSVNGKRKGKKVNPPKFKSRRSKQSATFTSAGFVLKDNDRIYLAKIGFLDVVWSRPLPSIPSSVTVIKDRANRYFLSFVVEVDPQQLADNGQSVGIDLGIIDFATLSTGEKIKSPKPLKAKLKRLRKCQRNLARKQKGSKRREKARLRVAKVHAKVKDTRTDFLHKLSTRLIRENQTVILEDLNTAGMMKNRRLSRAISDLGWRSFRTILEAKAVMYGREFRTISRWEPTSQRCSCCGEIGGKKELSVREWTCLFCGANHDRDINAATNILVAGGHSETKNGRGGKRQTTSVAASGEASTHRKAIQLTLFAS