Your browser is old and dusty. Try Google Chrome!

Details for slr2049

ORF slr2049
Accession NP_440437.1
Symbol ycf58
Category hypothetical protein YCF58
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -119 -133 2.45787 0.176
NP_441061.1_2 Reverse -333 -347 2.16287 0.178
NP_441061.1_2 Forward -139 -125 -0.000409212 0.219
NP_441061.1_2 Forward -340 -326 -0.787057 0.239
NP_440557.1_1 Reverse -333 -352 14.3558 0.0645
NP_440795.1_7 Forward -340 -333 14.6904 0.0123
NP_440795.1_7 Reverse -333 -340 14.6904 0.0123
NP_440694.1_6 Reverse -115 -134 11.2092 0.203
NP_441418.1_6 Forward -341 -322 -12.3902 0.0643
NP_441418.1_6 Reverse -332 -351 -20.1584 0.106
NP_440815.1_5 Forward -214 -195 3.83436 0.286
NP_442291.1_7 Reverse -376 -390 13.6676 0.211
NP_442272.1_1 Forward -270 -252 14.8032 0.238
NP_440897.1_6 Forward -121 -102 -4.1312 0.267
NP_441453.1_4 Reverse -332 -340 16.539 0.00633
NP_441453.1_4 Forward -341 -333 16.539 0.00633
NP_442151.1_6 Reverse -332 -346 10.4227 0.123
NP_442151.1_6 Forward -341 -327 8.35772 0.175
NP_441818.1_9 Reverse -236 -255 -4.32711 0.235
NP_440226.1_1 Forward -341 -322 15.0441 0.0274
NP_440226.1_1 Reverse -332 -351 3.44104 0.225
NP_440259.1_4 Forward -42 -28 8.9251 0.286
NP_440150.1_2 Reverse -120 -139 14.3549 0.157
NP_442173.1_1 Forward -340 -332 15.4574 0.00633
NP_442173.1_1 Reverse -333 -341 15.4574 0.00633
NP_442752.1_4 Forward -341 -334 13.8055 0.0199
NP_442752.1_4 Reverse -332 -339 13.8055 0.0199
NP_443027.1_4 Forward -343 -333 14.828 0.0437
NP_443027.1_4 Reverse -330 -340 13.943 0.0452
NP_441812.1_3 Forward -342 -328 11.406 0.21
NP_442975.1_10 Forward -345 -331 5.60385 0.216
NP_442975.1_10 Reverse -328 -342 4.32555 0.245
NP_441675.1_4 Reverse -33 -52 4.32602 0.257
NP_440784.1_7 Forward -340 -333 15.9687 0.0123
NP_440784.1_7 Reverse -333 -340 15.9687 0.0123
NP_441054.1_2 Reverse -36 -55 13.7658 0.189
NP_441054.1_2 Reverse -136 -155 11.8975 0.254
NP_441054.1_4 Reverse -322 -340 3.55906 0.168
NP_442074.1_5 Reverse -314 -333 14.6508 0.27
NP_440878.1_9 Reverse -322 -341 -3.63879 0.299
NP_442062.1_8 Forward -341 -331 19.4496 0.000558
NP_442062.1_8 Reverse -332 -342 19.4496 0.000558
NP_440761.1_4 Reverse -327 -346 15.1424 0.0143
NP_441900.1_2 Reverse -202 -220 -3.02983 0.279
NP_440839.1_4 Reverse -120 -139 12.88 0.245
NP_441859.1_3 Forward -342 -323 19.5664 0.0319
NP_440304.1_4 Forward -343 -333 10.8948 0.051
NP_440304.1_4 Reverse -330 -340 9.91146 0.051
NP_440304.1_4 Reverse -378 -388 1.84832 0.299
NP_442242.1_4 Forward -340 -333 14.3954 0.0124
NP_442242.1_4 Reverse -333 -340 14.3954 0.0124
NP_441781.1_5 Forward -331 -317 18.9768 0.196
NP_441781.1_7 Forward -215 -196 8.06259 0.156
NP_441781.1_7 Reverse -124 -143 2.16274 0.21
NP_441581.1_6 Forward -361 -342 9.58335 0.291
NP_441594.1_6 Forward -338 -319 -0.295539 0.298
NP_440370.1_10 Forward -350 -331 19.6656 0.0433
NP_442110.1_7 Reverse -332 -346 12.3893 0.0586
NP_441083.1_3 Forward -390 -380 17.3841 0.0681
NP_441083.1_5 Forward -341 -331 11.3864 0.0159
NP_441083.1_5 Reverse -332 -342 11.3864 0.0159
NP_442827.1_4 Forward -138 -119 11.405 0.145
NP_441738.1_2 Forward -339 -332 15.28 0.0102
NP_441738.1_2 Reverse -334 -341 15.28 0.0102
NP_440209.1_1 Reverse -332 -340 18.1123 0.00295
NP_440209.1_1 Forward -341 -333 18.1123 0.00295
NP_442889.1_8 Reverse -329 -343 11.2087 0.0735
NP_440447.1_1 Forward -346 -328 8.08229 0.194
NP_440447.1_1 Reverse -211 -229 2.0841 0.285
NP_441713.1_1 Reverse -326 -345 -3.44213 0.113
NP_441770.1_4 Reverse -162 -181 -3.73712 0.204
NP_440178.1_7 Reverse -331 -350 -12.6852 0.123
NP_441716.1_1 Reverse -332 -346 3.73617 0.259
NP_442111.1_4 Reverse -331 -345 10.521 0.0535
NP_440906.1_5 Forward -340 -333 15.8704 0.0124
NP_440906.1_5 Reverse -333 -340 15.8704 0.0124
NP_442442.1_2 Forward -225 -206 18.4857 0.112
NP_441924.1_9 Forward -134 -115 12.4867 0.295
NP_440747.1_10 Forward -344 -332 7.70879 0.00236
NP_440747.1_10 Reverse -329 -341 -2.02597 0.0196
NP_441130.1_10 Forward -343 -329 20.3541 0.00768
NP_441854.1_10 Reverse -123 -142 14.5524 0.139
NP_441486.1_1 Reverse -329 -343 10.4227 0.0207
NP_441486.1_1 Forward -344 -330 3.14618 0.0662
NP_442634.1_4 Reverse -330 -344 6.19444 0.0508
NP_440403.1_10 Reverse -371 -390 1.0811 0.291
NP_440057.1_8 Forward -112 -93 12.7825 0.267
NP_441014.1_2 Reverse -124 -143 15.3391 0.245
NP_441014.1_8 Forward -255 -236 -7.57203 0.28
NP_441014.1_8 Forward -138 -119 -8.35868 0.283
NP_442848.1_1 Forward -347 -333 -0.983719 0.263
NP_441012.1_4 Forward -345 -332 7.19745 0.272
NP_443018.1_3 Forward -340 -333 14.8871 0.0123
NP_443018.1_3 Reverse -333 -340 14.8871 0.0123
NP_441316.1_7 Forward -343 -328 6.17475 0.107
NP_441634.1_8 Forward -343 -329 12.1926 0.0529
NP_440376.1_1 Forward -341 -332 19.4693 0.000692
NP_440376.1_1 Reverse -332 -341 19.4693 0.000692
NP_440376.1_1 Reverse -379 -388 -0.786921 0.293
NP_441857.1_5 Reverse -325 -343 17.7187 0.113
NP_441588.1_4 Forward -339 -329 6.96153 0.178
NP_442687.1_7 Forward -342 -332 15.8113 0.0125
NP_442687.1_7 Reverse -331 -341 15.8113 0.0125
NP_442191.1_4 Reverse -333 -347 16.4227 0.0378
NP_442485.1_3 Reverse -327 -346 -2.55715 0.262
NP_441846.1_10 Reverse -236 -255 -23.1083 0.277
NP_441013.1_3 Reverse -194 -213 13.3725 0.201
NP_441013.1_3 Forward -215 -196 11.2092 0.204
NP_441422.1_7 Reverse -330 -347 -2.22277 0.21
NP_441950.1_7 Forward -280 -261 -8.85033 0.287
NP_441763.1_10 Reverse -321 -340 11.405 0.143
NP_442658.1_1 Reverse -330 -340 18.7607 0.00222
NP_442658.1_1 Forward -343 -333 15.9091 0.00966
NP_442198.1_7 Reverse -371 -390 8.94676 0.286
NP_440141.1_8 Reverse -338 -357 5.80098 0.271
NP_441855.2_4 Forward -349 -330 9.13744 0.287
NP_442782.1_2 Reverse -332 -346 7.57108 0.202
NP_442782.1_2 Reverse -119 -133 5.50613 0.242
NP_441414.1_9 Reverse -332 -351 -3.93378 0.143
NP_441414.1_9 Forward -341 -322 -7.86702 0.227
NP_441958.1_5 Forward -342 -332 12.2714 0.00183
NP_441958.1_5 Reverse -331 -341 12.2714 0.00183
NP_440203.1_5 Forward -188 -178 8.92768 0.281
NP_442816.1_9 Forward -214 -195 20.0581 0.121
NP_439905.1_1 Forward -340 -327 9.75405 0.216
NP_440984.1_7 Reverse -327 -341 10.226 0.126
NP_439990.1_5 Reverse -327 -340 8.47575 0.17
NP_442911.1_2 Forward -351 -332 11.2092 0.0132
NP_442911.1_2 Reverse -322 -341 6.88262 0.0277
NP_441580.1_6 Reverse -321 -340 -6.88371 0.235
NP_440153.1_5 Reverse -333 -347 10.4227 0.0989
NP_440153.1_8 Forward -256 -243 -3.22564 0.292
NP_442119.1_6 Reverse -330 -349 7.17762 0.21
NP_442236.1_3 Reverse -103 -122 12.3892 0.183
NP_440993.1_2 Forward -346 -330 12.1532 0.0735
NP_443044.1_5 Forward -280 -262 16.4404 0.207
NP_441099.1_5 Reverse -322 -341 -10.0303 0.24
NP_442002.1_9 Forward -342 -335 10.7572 0.185
NP_442002.1_9 Reverse -331 -338 10.7572 0.185
NP_440809.1_9 Reverse -323 -341 -8.04399 0.225
NP_442438.1_10 Forward -346 -332 19.0758 0.0137
NP_442438.1_10 Reverse -327 -341 2.85119 0.168
NP_442431.1_10 Reverse -119 -137 -0.865831 0.296
NP_441000.1_6 Forward -342 -328 4.81781 0.0933
NP_441000.1_6 Reverse -331 -345 -4.03198 0.225
NP_442771.1_1 Reverse -330 -348 -7.06068 0.169
NP_441110.1_1 Forward -202 -183 7.66927 0.219
NP_440147.1_4 Forward -343 -330 11.524 0.0326
NP_440147.1_4 Reverse -330 -343 2.08423 0.21
NP_441175.1_7 Reverse -332 -351 6.39097 0.258
NP_441550.1_8 Reverse -330 -340 10.501 0.066
NP_441550.1_8 Forward -343 -333 6.0761 0.214
NP_441916.1_7 Forward -341 -331 18.4663 0.00144
NP_441916.1_7 Reverse -332 -342 18.4663 0.00144
NP_441041.1_4 Reverse -332 -351 1.37609 0.0808
NP_441041.1_4 Forward -314 -295 -12.9802 0.278
NP_441041.1_4 Forward -341 -322 -13.1769 0.282
NP_441041.1_7 Reverse -329 -341 19.5648 0.00277
NP_441041.1_7 Forward -344 -332 7.61196 0.162
NP_440569.1_10 Forward -63 -44 5.20389 0.24
NP_441725.1_5 Reverse -333 -343 11.2881 0.0247
NP_441725.1_5 Forward -340 -330 9.02648 0.0553
NP_439966.1_7 Forward -343 -333 18.4657 0.00473
NP_439966.1_7 Reverse -330 -340 17.4824 0.00636
NP_439966.1_9 Reverse -330 -339 10.7178 0.0863
NP_439966.1_9 Forward -343 -334 0.983037 0.253
NP_442941.1_3 Reverse -333 -343 11.4848 0.0116
NP_442941.1_3 Forward -340 -330 2.53664 0.14
NP_440289.1_2 Reverse -329 -342 12.999 0.0132
NP_440289.1_2 Forward -344 -331 5.13249 0.0636
NP_440260.1_7 Reverse -381 -400 -4.6221 0.251
NP_440260.1_8 Reverse -121 -139 4.34571 0.154
NP_442281.1_1 Forward -346 -332 19.7634 0.00247
NP_442281.1_1 Reverse -327 -341 9.04542 0.0747
NP_442281.1_1 Forward -132 -118 3.04726 0.246
NP_442281.1_1 Forward -144 -130 2.5556 0.263
NP_440437.1_1 Forward -347 -328 22.6156 0.00964
NP_440437.1_5 Forward -138 -119 24.188 0.028
NP_440437.1_9 Reverse -271 -290 11.2092 0.235
NP_441556.1_10 Forward -220 -206 11.6819 0.219
NP_440498.1_1 Forward -350 -332 -1.16082 0.222
NP_442982.1_5 Forward -351 -332 6.98095 0.135
NP_441644.1_6 Forward -341 -331 10.1076 0.0628
NP_441644.1_6 Reverse -332 -342 10.1076 0.0628
NP_442215.1_2 Reverse -330 -346 13.7265 0.0222
NP_442215.1_2 Reverse -110 -126 -6.03799 0.263
NP_440253.1_2 Forward -341 -323 12.2122 0.0292
NP_440253.1_2 Reverse -332 -350 4.73903 0.1
NP_440929.1_8 Forward -341 -332 19.2726 0.000701
NP_440929.1_8 Reverse -332 -341 19.2726 0.000701
NP_442933.1_10 Forward -341 -332 17.601 0.00325
NP_442933.1_10 Reverse -332 -341 17.601 0.00325
NP_441751.2_8 Forward -340 -326 1.76955 0.0968
NP_442554.1_8 Forward -340 -330 16.008 0.0065
NP_442554.1_8 Reverse -333 -343 13.8447 0.0145
NP_441762.1_7 Forward -342 -330 21.5735 0.00342
NP_441762.1_7 Reverse -331 -343 12.0354 0.0142
NP_442142.1_4 Forward -344 -331 19.6848 0.0179
NP_442142.1_4 Reverse -329 -342 16.4399 0.0264
NP_442292.1_1 Forward -340 -331 9.63616 0.0183
NP_442292.1_1 Reverse -333 -342 9.63616 0.0183
NP_442292.1_5 Reverse -328 -347 1.27776 0.257
NP_440919.1_7 Forward -394 -376 18.1766 0.142
NP_442476.1_6 Forward -340 -326 7.76774 0.112
NP_442476.1_6 Reverse -333 -347 2.2612 0.188
NP_440421.1_1 Forward -311 -297 16.0275 0.184
NP_442381.1_8 Reverse -329 -348 -14.4552 0.28
NP_443009.1_2 Forward -339 -320 0.392778 0.216
NP_443009.1_5 Reverse -331 -342 11.6612 0.0602
NP_443009.1_5 Forward -342 -331 11.6612 0.0602
NP_441715.1_4 Reverse -333 -343 16.303 0.0117
NP_441715.1_4 Forward -340 -330 9.32148 0.097
NP_440970.1_1 Forward -299 -285 18.4858 0.272
NP_440379.1_5 Forward -350 -331 -3.3438 0.204
NP_440379.1_5 Forward -212 -193 -10.0303 0.273
NP_440379.1_8 Forward -138 -119 15.6341 0.192
NP_441468.1_1 Forward -340 -333 15.8704 0.0124
NP_441468.1_1 Reverse -333 -340 15.8704 0.0124
NP_441618.1_6 Forward -202 -183 8.65258 0.3
NP_441020.2_6 Reverse -330 -347 19.705 0.00725
NP_441015.1_8 Reverse -373 -392 7.57094 0.258
NP_441015.1_10 Reverse -327 -346 -3.3438 0.189
NP_441673.1_1 Forward -341 -332 20.8459 0.000698
NP_441673.1_1 Reverse -332 -341 20.8459 0.000698
NP_440265.1_8 Reverse -317 -335 15.0638 0.218
NP_441826.1_1 Forward -126 -110 16.7748 0.261
NP_441826.1_2 Forward -347 -333 21.1407 0.00562
NP_441826.1_5 Reverse -113 -132 9.3409 0.202
NP_441637.1_9 Forward -272 -254 -1.75081 0.292
NP_442868.1_6 Reverse -330 -340 8.53483 0.0555
NP_442868.1_6 Forward -343 -333 0.963343 0.205
NP_442719.1_2 Reverse -380 -398 -0.76823 0.168
NP_442719.1_2 Reverse -278 -296 -11.6829 0.294
NP_441251.1_8 Reverse -22 -35 12.3802 0.267
NP_441056.1_1 Reverse -332 -351 -2.55715 0.211
NP_442361.1_3 Forward -347 -334 15.3589 0.0917
NP_442427.1_8 Reverse -323 -342 5.80098 0.252
NP_442808.1_1 Forward -342 -332 18.4657 0.00201
NP_442808.1_1 Reverse -331 -341 18.4657 0.00201
NP_442808.1_1 Forward -251 -241 1.45457 0.285
NP_440145.1_3 Forward -351 -332 4.12936 0.09
NP_441906.1_2 Forward -375 -356 2.55527 0.286
NP_441906.1_9 Reverse -176 -190 20.7474 0.238
NP_442542.1_2 Reverse -330 -343 12.409 0.114
NP_442113.1_10 Forward -257 -238 -7.27704 0.265
NP_442050.1_1 Forward -134 -115 8.16093 0.253
NP_442050.1_5 Forward -343 -333 9.12434 0.193
NP_442050.1_5 Reverse -330 -340 8.23937 0.234
NP_442342.1_9 Reverse -330 -346 2.32015 0.29
NP_440558.1_2 Forward -350 -331 -3.14714 0.234
NP_442789.1_4 Reverse -330 -349 -2.26216 0.233
NP_441878.1_6 Forward -342 -332 10.4031 0.0176
NP_441878.1_6 Reverse -331 -341 10.4031 0.0176
NP_441878.1_6 Reverse -379 -389 -7.98478 0.285
NP_441036.1_8 Forward -342 -332 17.7779 0.000554
NP_441036.1_8 Reverse -331 -341 17.7779 0.000554
NP_442721.1_3 Forward -259 -240 14.9458 0.22
NP_441557.1_5 Forward -341 -332 19.9609 0.000699
NP_441557.1_5 Reverse -332 -341 19.9609 0.000699
NP_441445.1_1 Reverse -323 -342 12.8808 0.0621
NP_441445.1_8 Reverse -132 -151 -12.8819 0.299
NP_442066.2_4 Reverse -332 -351 -7.4737 0.28
NP_442066.2_9 Reverse -328 -341 17.9155 0.0209
NP_442419.1_2 Forward -255 -236 4.03102 0.188
NP_441308.1_8 Forward -343 -333 10.1081 0.22
NP_441308.1_8 Reverse -330 -340 9.22315 0.226
NP_440101.1_3 Reverse -327 -346 6.98095 0.18
NP_442183.1_1 Forward -341 -327 12.8809 0.05
NP_442183.1_1 Reverse -332 -346 9.93102 0.0903
NP_442397.1_9 Reverse -124 -143 7.17762 0.246
NP_441116.1_6 Forward -214 -195 7.37428 0.29
NP_441116.1_9 Forward -398 -384 16.4209 0.155
NP_441574.1_1 Reverse -247 -266 -4.42544 0.252
NP_441549.1_9 Forward -219 -201 -1.94747 0.183
NP_441549.1_9 Reverse -328 -346 -5.48739 0.198
NP_442347.1_2 Forward -340 -331 11.1111 0.056
NP_442347.1_2 Reverse -333 -342 11.1111 0.056
NP_442645.1_2 Forward -349 -330 -5.31042 0.0661
NP_442645.1_2 Reverse -285 -304 -16.8151 0.242
NP_441037.1_4 Reverse -330 -340 16.2838 0.0168
NP_441037.1_4 Forward -343 -333 7.02532 0.237
NP_441633.1_3 Forward -343 -330 13.3923 0.018
NP_441633.1_3 Reverse -330 -343 3.5592 0.0699
NP_440136.1_2 Forward -340 -333 15.9687 0.0123
NP_440136.1_2 Reverse -333 -340 15.9687 0.0123
NP_442590.1_10 Forward -221 -202 8.16093 0.213
NP_442998.1_10 Forward -339 -332 15.5754 0.0102
NP_442998.1_10 Reverse -334 -341 15.5754 0.0102
NP_440899.1_2 Forward -352 -333 5.2102 0.295
NP_440299.1_1 Forward -345 -332 20.1765 0.00128
NP_441799.1_1 Reverse -328 -342 13.8636 0.0293
NP_441799.1_1 Forward -345 -331 6.58715 0.167
NP_441799.1_1 Forward -213 -199 4.32555 0.255
NP_440640.1_6 Reverse -113 -132 -0.983855 0.297
NP_441007.1_10 Reverse -327 -340 5.72248 0.18
NP_440256.1_1 Reverse -329 -348 -4.81876 0.166
NP_440256.1_1 Forward -72 -53 -7.37537 0.234
NP_440256.1_1 Forward -344 -325 -10.227 0.297
NP_441559.1_8 Forward -346 -332 2.45787 0.143
NP_441559.1_8 Reverse -282 -296 -5.50694 0.264
NP_441559.1_8 Reverse -327 -341 -6.29359 0.276
NP_441559.1_8 Reverse -120 -134 -6.49025 0.279
NP_440915.1_6 Reverse -328 -342 6.29277 0.0828
NP_440915.1_6 Forward -345 -331 5.70279 0.0879
NP_440915.1_6 Reverse -121 -135 2.35953 0.119
NP_442785.1_7 Forward -142 -128 12.0943 0.228
NP_442785.1_9 Reverse -196 -215 13.3716 0.261
NP_441866.1_7 Reverse -236 -255 18.1907 0.0943
NP_442069.1_3 Reverse -121 -140 17.3057 0.236
NP_442866.1_1 Reverse -327 -346 0.196116 0.183
NP_442866.1_1 Reverse -125 -144 -1.47551 0.204
NP_440748.1_5 Reverse -316 -335 -1.67217 0.267
NP_441464.1_8 Forward -341 -327 7.66941 0.206
NP_441939.1_3 Reverse -333 -352 5.40766 0.276
NP_441199.1_6 Forward -345 -326 6.4893 0.134
NP_442993.1_1 Forward -341 -325 -0.236458 0.071
NP_442993.1_1 Reverse -118 -134 -8.98791 0.178
NP_442386.1_9 Reverse -331 -340 15.7322 0.0144
NP_442386.1_9 Forward -342 -333 15.7322 0.0144
NP_441340.1_5 Forward -340 -333 15.6737 0.0124
NP_441340.1_5 Reverse -333 -340 15.6737 0.0124
NP_441271.1_1 Reverse -326 -344 16.7346 0.202
NP_442484.1_2 Forward -132 -113 4.62101 0.184
NP_442240.1_2 Reverse -333 -352 14.2574 0.00914
NP_440586.1_1 Reverse -325 -344 3.53937 0.202
NP_440586.1_8 Forward -340 -333 13.2151 0.026
NP_440586.1_8 Reverse -333 -340 13.2151 0.026
NP_440586.1_9 Forward -138 -119 5.60432 0.288
NP_442251.1_6 Forward -340 -333 15.2804 0.0124
NP_442251.1_6 Reverse -333 -340 15.2804 0.0124
NP_441262.1_3 Reverse -332 -339 14.7888 0.0223
NP_441262.1_3 Forward -341 -334 14.7888 0.0223
NP_440027.1_3 Forward -351 -333 8.86816 0.188
NP_443051.1_1 Reverse -331 -340 10.4228 0.00754
NP_443051.1_1 Forward -342 -333 10.4228 0.00754
NP_439937.1_9 Forward -342 -325 10.6578 0.0407
NP_440408.1_7 Forward -140 -121 10.9142 0.239
NP_440439.1_1 Forward -344 -331 15.5556 0.0137
NP_440439.1_1 Reverse -329 -342 9.65572 0.0447
NP_439943.1_1 Reverse -155 -174 -9.34199 0.28
NP_440372.1_2 Forward -340 -333 16.3621 0.0124
NP_440372.1_2 Reverse -333 -340 16.3621 0.0124
NP_440171.1_3 Forward -137 -118 2.94938 0.284
NP_440171.1_3 Reverse -343 -362 2.55606 0.285
NP_442511.1_5 Forward -152 -133 11.5187 0.265
NP_441803.1_2 Forward -346 -327 18.6823 0.0309
NP_441803.1_2 Forward -139 -120 8.35759 0.116
NP_439977.1_5 Reverse -326 -345 13.6675 0.0531
NP_441572.1_7 Reverse -326 -345 1.57275 0.147
NP_441572.1_7 Reverse -119 -138 -4.42544 0.235
NP_442384.1_10 Reverse -332 -345 15.7522 0.00946
NP_442384.1_10 Reverse -125 -138 5.52582 0.127
NP_442384.1_10 Forward -352 -339 0.412608 0.291
NP_442384.1_10 Forward -341 -328 0.412608 0.291
NP_442114.1_4 Forward -341 -330 12.1534 0.107
NP_440364.1_2 Reverse -125 -144 14.8109 0.278
NP_441604.1_7 Forward -240 -221 10.2259 0.295
NP_441877.1_9 Reverse -140 -157 3.57876 0.284
NP_441018.1_7 Reverse -328 -347 13.9625 0.131
NP_441018.1_7 Forward -125 -106 9.14423 0.233
NP_442262.1_10 Forward -340 -333 14.1988 0.0123
NP_442262.1_10 Reverse -333 -340 14.1988 0.0123
NP_441689.1_5 Forward -343 -333 8.53436 0.132
NP_440163.1_10 Forward -344 -334 16.303 0.0762
NP_440344.1_10 Reverse -325 -342 18.2301 0.00262
NP_440344.1_10 Forward -348 -331 -6.64766 0.114
NP_440531.1_1 Forward -133 -114 5.50599 0.233
NP_440531.1_8 Forward -400 -381 10.9142 0.177
NP_441060.1_3 Reverse -280 -299 12.6841 0.184
NP_440487.1_1 Reverse -329 -348 -3.14714 0.214
NP_440562.1_5 Reverse -279 -298 10.0292 0.261
NP_441965.1_10 Reverse -329 -345 9.20332 0.123
NP_440297.1_9 Reverse -333 -343 9.32148 0.0917
NP_440297.1_9 Forward -340 -330 -0.216628 0.282
NP_440297.1_9 Reverse -131 -141 -0.216628 0.282
NP_441896.1_3 Reverse -323 -342 11.5042 0.0816
NP_440894.1_10 Reverse -327 -346 19.9606 0.034
NP_442067.1_4 Forward -352 -333 11.7008 0.129
NP_442067.1_4 Reverse -107 -126 4.62101 0.256
NP_440999.1_9 Reverse -328 -342 11.6026 0.0438
NP_440999.1_9 Forward -345 -331 4.12949 0.117
NP_440999.1_9 Forward -122 -108 -1.18038 0.229
NP_440888.1_2 Reverse -332 -346 17.6002 0.00354
NP_440888.1_2 Forward -341 -327 15.6336 0.00976
NP_440888.1_2 Reverse -112 -126 11.897 0.0562
NP_440491.1_1 Reverse -329 -348 8.67125 0.232
NP_440052.1_5 Forward -352 -333 -5.80207 0.298
NP_439969.1_3 Forward -357 -338 6.98095 0.162
NP_442033.1_10 Reverse -330 -349 -6.68705 0.186
NP_440575.1_1 Reverse -145 -164 -1.96793 0.29
NP_441543.1_2 Forward -340 -331 18.486 0.00236
NP_441543.1_2 Reverse -333 -342 18.486 0.00236
NP_442845.1_2 Reverse -332 -346 7.47274 0.195
NP_442845.1_2 Reverse -364 -378 4.62115 0.256
NP_441551.1_5 Reverse -370 -386 10.3826 0.193
NP_441469.1_8 Reverse -331 -340 16.126 0.00797
NP_441469.1_8 Forward -342 -333 16.126 0.00797
NP_442578.1_7 Forward -340 -333 14.5921 0.026
NP_442578.1_7 Reverse -333 -340 14.5921 0.026
NP_441462.1_2 Forward -341 -331 11.5831 0.00406
NP_441462.1_2 Reverse -332 -342 11.5831 0.00406
NP_441621.1_7 Reverse -330 -344 15.8309 0.0266
NP_441621.1_7 Forward -343 -329 6.09611 0.068
NP_443062.1_1 Reverse -332 -350 10.3011 0.12
NP_443062.1_1 Forward -341 -323 6.20575 0.206
NP_443062.1_6 Reverse -324 -343 12.7825 0.0949
NP_442204.1_1 Forward -345 -334 9.69511 0.0736
NP_442204.1_5 Reverse -115 -134 -0.0988766 0.278
NP_440516.1_8 Forward -341 -332 16.9127 0.00442
NP_440516.1_8 Reverse -332 -341 16.9127 0.00442
NP_441033.1_2 Forward -252 -233 -4.6221 0.293
NP_442428.1_5 Forward -340 -333 15.8704 0.0124
NP_442428.1_5 Reverse -333 -340 15.8704 0.0124
NP_441790.1_3 Reverse -333 -352 1.57275 0.181
NP_441267.1_1 Reverse -65 -84 6.19431 0.227
NP_440673.1_3 Forward -339 -332 12.4288 0.0426
NP_440673.1_3 Reverse -334 -341 12.4288 0.0426
NP_440673.1_3 Reverse -348 -355 7.41394 0.263
NP_440865.1_9 Reverse -326 -345 -9.047 0.273
NP_441052.1_2 Forward -341 -331 10.5014 0.0285
NP_441052.1_2 Reverse -332 -342 10.5014 0.0285
NP_440992.1_5 Reverse -269 -288 14.4204 0.272
NP_442219.1_8 Reverse -283 -302 11.7425 0.172
NP_442219.1_9 Forward -340 -331 8.35786 0.0681
NP_442219.1_9 Reverse -333 -342 8.35786 0.0681
NP_440436.1_4 Forward -340 -331 18.1905 0.00233
NP_440436.1_4 Reverse -333 -342 18.1905 0.00233
NP_441884.1_9 Reverse -329 -348 -13.4719 0.138
NP_441336.1_3 Forward -389 -375 15.3392 0.277
NP_441719.1_4 Forward -340 -333 16.3621 0.0124
NP_441719.1_4 Reverse -333 -340 16.3621 0.0124
NP_441733.1_10 Reverse -329 -342 19.9805 0.0151
NP_441733.1_10 Forward -344 -331 7.78743 0.15
NP_441004.1_1 Forward -139 -120 -14.5535 0.268
NP_442366.1_1 Reverse -23 -36 15.4572 0.272
NP_442366.1_3 Reverse -331 -349 6.80398 0.0773
NP_442366.1_3 Reverse -117 -135 -2.14413 0.221
NP_442695.1_3 Reverse -5 -19 20.6484 0.131
NP_442695.1_3 Forward -187 -173 15.2402 0.24
NP_441115.1_4 Forward -342 -324 17.8162 0.0158
NP_441115.1_4 Forward -135 -117 8.76983 0.237
NP_442206.1_10 Reverse -332 -347 2.14318 0.205
NP_440328.1_4 Forward -347 -328 -0.197208 0.27
NP_443054.1_2 Forward -343 -329 22.0257 0.00482
NP_441851.1_10 Forward -342 -332 16.008 0.00552
NP_441851.1_10 Reverse -331 -341 16.008 0.00552
NP_441851.1_10 Forward -215 -205 11.4848 0.0715
NP_441542.1_4 Reverse -382 -396 4.22782 0.264
NP_441668.1_4 Forward -398 -379 2.0644 0.205
NP_441668.1_4 Forward -188 -169 -2.0655 0.286
NP_441668.1_4 Forward -312 -293 -2.36049 0.288
NP_442515.1_1 Forward -342 -328 -2.16369 0.271
NP_441683.1_5 Forward -126 -107 11.3075 0.187
NP_440593.1_3 Forward -126 -107 -7.67036 0.298
NP_441982.1_6 Forward -180 -171 12.5809 0.274
NP_441046.1_2 Reverse -165 -184 0.196116 0.271
NP_441409.1_6 Reverse -326 -345 -13.6686 0.241
NP_441409.1_8 Reverse -16 -35 7.2093 0.293
NP_439960.1_4 Reverse -129 -148 12.585 0.28
NP_440474.1_8 Forward -340 -326 15.6336 0.0566
NP_441477.1_10 Forward -348 -330 1.00246 0.267
NP_440431.1_3 Forward -204 -185 -11.4069 0.286
NP_442450.1_5 Forward -343 -333 9.32148 0.115
NP_440588.1_2 Forward -350 -331 -1.47551 0.155
NP_440195.1_4 Reverse -320 -339 9.43923 0.184
NP_440195.1_4 Forward -139 -120 7.27595 0.26
NP_441570.1_1 Reverse -332 -350 -8.24065 0.107
NP_441078.1_4 Forward -341 -332 19.6659 0.0007
NP_441078.1_4 Reverse -332 -341 19.6659 0.0007
NP_442729.1_8 Reverse -328 -341 9.75405 0.125
NP_442729.1_8 Forward -345 -332 8.08242 0.125
NP_442443.1_1 Reverse -117 -136 -4.13045 0.268
NP_440526.1_3 Forward -340 -329 11.7595 0.0646
NP_440526.1_3 Forward -294 -283 2.51647 0.267
NP_441432.1_8 Reverse -331 -340 8.25953 0.0755
NP_441432.1_8 Forward -342 -333 8.25953 0.0755
NP_441432.1_8 Forward -122 -113 2.75299 0.287
NP_441432.1_9 Forward -44 -31 9.95576 0.26
NP_442320.1_8 Reverse -326 -340 8.16106 0.0184
NP_442320.1_8 Forward -347 -333 5.01447 0.0442
NP_441732.1_2 Forward -345 -329 2.22182 0.0253
NP_441732.1_2 Reverse -202 -218 -17.4444 0.258
NP_440629.1_4 Reverse -213 -232 11.5042 0.217
NP_440629.1_4 Reverse -375 -394 9.83255 0.244
NP_440760.1_1 Reverse -332 -351 -10.227 0.084
NP_441131.1_6 Forward -289 -271 3.26407 0.267
NP_441057.1_4 Forward -398 -380 2.87075 0.253
NP_442353.1_4 Forward -127 -108 8.35677 0.156
NP_442489.1_7 Forward -341 -332 20.1576 0.000695
NP_442489.1_7 Reverse -332 -341 20.1576 0.000695
NP_442079.1_7 Forward -340 -321 1.67108 0.244
NP_440559.1_1 Reverse -333 -342 8.75118 0.0586
NP_440559.1_1 Forward -340 -331 8.75118 0.0586
NP_441659.2_8 Forward -341 -331 11.9764 0.0147
NP_441659.2_8 Reverse -332 -342 11.9764 0.0147
NP_441022.1_1 Forward -154 -145 12.0258 0.255
NP_440363.1_9 Forward -130 -112 13.6872 0.249
NP_441040.1_2 Reverse -330 -349 -15.6352 0.286
NP_440708.1_6 Reverse -196 -215 -10.522 0.282
NP_441800.1_3 Reverse -131 -149 3.26407 0.298
NP_442346.1_1 Reverse -119 -138 18.6823 0.181
NP_442346.1_5 Forward -342 -332 9.02648 0.118
NP_442346.1_5 Reverse -331 -341 9.02648 0.118
NP_440545.1_3 Reverse -328 -345 -1.23946 0.165
NP_440545.1_3 Forward -345 -328 -1.53445 0.17
NP_440459.1_2 Reverse -330 -347 9.08529 0.239
NP_440010.1_4 Forward -348 -329 0.195343 0.25
NP_442603.1_7 Reverse -332 -346 11.602 0.114
NP_441585.1_5 Reverse -268 -287 8.94676 0.211
NP_441888.1_7 Forward -346 -332 3.8345 0.225
NP_440449.1_6 Reverse -117 -135 8.83941 0.194
NP_441948.1_4 Forward -348 -330 5.82068 0.0709
NP_441047.1_2 Forward -346 -327 -2.85214 0.281
NP_441833.1_4 Forward -340 -333 15.9687 0.0124
NP_441833.1_4 Reverse -333 -340 15.9687 0.0124
NP_442699.1_8 Reverse -378 -397 -12.4886 0.253
NP_442162.1_9 Forward -340 -333 16.2637 0.0124
NP_442162.1_9 Reverse -333 -340 16.2637 0.0124
NP_440671.1_4 Forward -347 -333 19.7641 0.00827
NP_440671.1_4 Forward -133 -119 6.6861 0.239
NP_442404.1_9 Forward -338 -324 12.6836 0.263
NP_442045.1_5 Reverse -109 -128 6.09597 0.203
NP_442199.1_5 Reverse -324 -343 -3.63879 0.209
NP_442140.1_3 Forward -340 -330 17.4829 0.0159
NP_442140.1_3 Reverse -333 -343 8.33817 0.119
NP_441671.1_10 Forward -181 -162 2.75272 0.247
NP_440875.1_9 Forward -339 -329 17.619 0.0104
NP_440875.1_9 Reverse -334 -344 9.05339 0.233
NP_440875.1_9 Reverse -133 -143 7.59334 0.255
NP_441813.1_5 Forward -343 -333 17.188 0.00979
NP_441813.1_5 Reverse -330 -340 10.0098 0.0208
NP_442089.1_6 Reverse -125 -144 17.2074 0.0715
NP_440590.1_4 Forward -340 -327 13.9823 0.0112
NP_440590.1_4 Reverse -333 -346 4.8375 0.0585
NP_440567.1_1 Forward -340 -326 10.7177 0.033
NP_440567.1_1 Reverse -333 -347 6.78443 0.0803
NP_442497.1_10 Forward -340 -331 10.4228 0.0087
NP_442497.1_10 Reverse -333 -342 10.4228 0.0087
NP_440821.1_4 Forward -343 -333 19.0562 0.00399
NP_440821.1_4 Reverse -330 -340 18.7612 0.00422
NP_441239.1_9 Reverse -330 -342 18.6235 0.0114
NP_441239.1_9 Forward -343 -331 15.8703 0.0178
NP_441239.1_9 Forward -129 -117 7.4138 0.161
NP_441951.1_4 Reverse -332 -351 4.52268 0.273
NP_441951.1_7 Reverse -134 -148 16.3258 0.275
NP_440400.1_1 Forward -131 -112 -2.45958 0.285
NP_440665.1_2 Forward -222 -203 1.57275 0.188
NP_442270.1_7 Forward -113 -94 10.1275 0.273
NP_441769.1_1 Reverse -324 -343 10.1275 0.195
NP_440833.1_6 Forward -193 -179 10.6187 0.242
NP_441617.1_6 Forward -395 -376 -7.57203 0.292
NP_440546.1_4 Forward -341 -331 11.8882 0.0679
NP_440546.1_4 Reverse -332 -342 11.8882 0.0679
NP_439974.1_4 Forward -352 -333 8.06259 0.287
NP_441230.1_5 Reverse -327 -346 -1.18052 0.298
NP_440462.1_4 Reverse -58 -72 5.70279 0.29
NP_440462.1_6 Reverse -330 -340 17.9746 0.00578
NP_440462.1_6 Forward -343 -333 15.418 0.0142
NP_442611.1_1 Reverse -332 -351 -3.24547 0.3
NP_440868.1_4 Reverse -328 -340 12.0354 0.0254
NP_440868.1_4 Forward -345 -333 8.6921 0.0582
NP_442402.1_10 Reverse -207 -217 13.3526 0.204
NP_441848.1_4 Reverse -379 -395 7.35968 0.29
NP_441084.1_6 Forward -142 -128 11.962 0.179
NP_440696.1_3 Reverse -328 -346 0.314141 0.233
NP_442039.1_4 Forward -340 -333 15.1821 0.0124
NP_442039.1_4 Reverse -333 -340 15.1821 0.0124
NP_442837.1_3 Forward -340 -333 15.7721 0.0124
NP_442837.1_3 Reverse -333 -340 15.7721 0.0124
NP_440160.1_2 Forward -134 -115 -2.36049 0.245
NP_442053.1_1 Forward -341 -332 18.3876 0.0007
NP_442053.1_1 Reverse -332 -341 18.3876 0.0007
NP_440505.1_3 Reverse -330 -340 14.1397 0.0235
NP_440505.1_3 Forward -343 -333 13.8447 0.0247
NP_442360.1_5 Forward -168 -158 14.3364 0.233
NP_441701.1_7 Forward -340 -321 16.8141 0.122
NP_441959.1_5 Forward -399 -380 14.6508 0.103
NP_441959.1_5 Reverse -200 -219 14.3558 0.103
NP_441252.1_6 Forward -165 -158 11.6422 0.288
NP_441203.1_1 Reverse -333 -352 -20.2567 0.297
NP_442009.1_9 Reverse -321 -340 11.4058 0.226
NP_441408.2_7 Forward -211 -192 -5.70374 0.299
NP_440914.1_1 Forward -341 -331 8.6151 0.186
NP_440914.1_1 Reverse -332 -342 8.6151 0.186
NP_441011.1_8 Forward -340 -331 16.9127 0.00602
NP_441011.1_8 Reverse -333 -342 16.9127 0.00602
NP_442101.1_10 Forward -349 -330 -10.1286 0.255
NP_442533.1_6 Forward -341 -332 17.2076 0.00137
NP_442533.1_6 Reverse -332 -341 17.2076 0.00137
NP_442533.1_6 Forward -121 -112 2.458 0.255
NP_442533.1_6 Reverse -131 -140 1.57302 0.294
NP_442533.1_6 Forward -139 -130 1.57302 0.294
NP_442232.1_3 Forward -217 -198 -13.0786 0.282
NP_442229.1_1 Reverse -330 -344 10.5204 0.184
NP_441482.1_7 Forward -347 -333 10.1277 0.0135
NP_439944.1_9 Forward -340 -330 10.4031 0.0887
NP_439944.1_9 Reverse -333 -343 10.3048 0.0887
NP_440816.1_2 Forward -165 -146 5.66045 0.296
NP_442202.1_4 Reverse -330 -344 15.4531 0.183
NP_440116.1_8 Forward -340 -321 -4.32711 0.168
NP_441527.1_4 Reverse -22 -41 -1.86252 0.15
NP_441527.1_4 Reverse -15 -34 -8.45146 0.244
NP_441527.1_4 Reverse -16 -35 -13.0351 0.298
NP_440007.1_9 Forward -143 -129 2.5562 0.277
NP_439965.1_1 Forward -350 -331 -8.55534 0.273
NP_441680.1_4 Forward -346 -327 -0.590531 0.255
NP_441602.1_3 Reverse -327 -346 -0.39387 0.224
NP_441106.1_1 Reverse -331 -340 18.191 0.0028
NP_441106.1_1 Forward -342 -333 18.191 0.0028
NP_441286.1_1 Forward -342 -330 5.25052 0.0259
NP_441286.1_1 Reverse -331 -343 4.95553 0.027
NP_440670.1_8 Forward -341 -332 18.3876 0.000699
NP_440670.1_8 Reverse -332 -341 18.3876 0.000699
NP_440886.1_7 Forward -342 -332 17.7774 0.0011
NP_440886.1_7 Reverse -331 -341 17.7774 0.0011
NP_442614.1_2 Forward -341 -327 6.48943 0.291
NP_439995.1_4 Reverse -179 -198 15.6332 0.28
NP_439995.1_5 Reverse -322 -341 3.73603 0.291
NP_442072.1_9 Reverse -331 -349 -5.58572 0.0658
NP_442072.1_9 Forward -342 -324 -11.9772 0.0799
NP_440513.1_6 Forward -20 -1 9.63507 0.26
NP_441753.1_10 Forward -356 -337 0.491109 0.291
NP_440907.2_8 Forward -340 -330 17.4824 0.00685
NP_440907.2_8 Reverse -333 -343 7.84605 0.117
NP_441021.1_8 Forward -346 -328 7.4923 0.187
NP_441463.1_3 Reverse -322 -341 -0.295539 0.132
NP_441626.1_2 Forward -340 -333 15.7721 0.0124
NP_441626.1_2 Reverse -333 -340 15.7721 0.0124
NP_442211.1_3 Reverse -113 -132 9.22274 0.257
NP_442912.1_9 Reverse -133 -152 15.0441 0.267
NP_442365.1_7 Forward -125 -106 -5.99873 0.284
NP_442794.1_1 Forward -345 -333 10.1671 0.0721
NP_442615.1_1 Reverse -323 -341 10.8356 0.0193
NP_441962.1_4 Forward -346 -327 -7.67036 0.192
NP_441962.1_9 Forward -67 -48 8.25926 0.258
NP_441962.1_9 Reverse -119 -138 5.60432 0.264
NP_440387.1_1 Reverse -332 -348 12.6449 0.0112
NP_441431.1_2 Reverse -329 -343 9.43874 0.186
NP_441431.1_2 Forward -344 -330 8.65209 0.209
NP_441836.1_2 Reverse -326 -345 -1.86883 0.223
NP_441836.1_2 Reverse -106 -125 -5.40875 0.279
NP_441993.1_1 Reverse -332 -351 12.0823 0.106
NP_441993.1_1 Reverse -125 -144 4.67549 0.215
NP_441993.1_1 Reverse -119 -138 1.16703 0.284
NP_441993.1_4 Forward -383 -364 8.94676 0.285
NP_441174.1_2 Forward -344 -330 17.8958 0.0405
NP_440114.1_10 Forward -341 -327 12.8809 0.0698
NP_442684.1_3 Forward -399 -380 13.3725 0.256
NP_442437.1_8 Reverse -321 -340 6.39097 0.242
NP_442323.1_7 Forward -346 -327 1.96529 0.276
NP_441510.2_7 Forward -347 -333 10.8154 0.28
NP_440287.1_6 Reverse -344 -363 1.47442 0.27
NP_440293.1_3 Reverse -123 -142 -3.63879 0.251
NP_440293.1_9 Reverse -125 -139 10.3779 0.275
NP_440766.1_4 Forward -345 -331 17.7975 0.0255
NP_440766.1_4 Reverse -328 -342 8.16106 0.0871
NP_439988.1_3 Reverse -126 -140 6.6861 0.278
NP_441979.1_5 Forward -347 -328 -12.5869 0.228
NP_439910.1_2 Reverse -324 -341 -2.91109 0.0305
NP_439910.1_2 Forward -349 -332 -13.4325 0.162
NP_440457.1_1 Forward -345 -333 8.29878 0.101
NP_440798.1_6 Reverse -333 -346 3.85419 0.147
NP_442509.1_8 Forward -255 -239 16.8724 0.276
NP_442509.1_9 Forward -341 -331 16.2041 0.00739
NP_442509.1_9 Reverse -332 -342 16.2041 0.00739
NP_441253.1_1 Forward -137 -118 8.55425 0.205
NP_442514.1_5 Forward -147 -128 -6.88445 0.275
NP_440554.1_4 Reverse -333 -343 14.6313 0.02
NP_440554.1_4 Forward -340 -330 13.943 0.0218
NP_441885.1_5 Forward -341 -331 11.4848 0.00668
NP_441885.1_5 Reverse -332 -342 11.4848 0.00668
NP_441885.1_5 Reverse -206 -216 -1.69159 0.277
NP_441428.1_8 Reverse -324 -343 2.45773 0.269
NP_442341.1_7 Forward -342 -328 18.2892 0.0111
NP_442341.1_7 Reverse -331 -345 17.7975 0.0111
NP_442341.1_7 Forward -135 -121 1.37622 0.292
NP_441756.1_5 Reverse -121 -140 3.6377 0.199
NP_442395.2_4 Forward -122 -103 -0.591301 0.298
NP_440686.1_7 Forward -182 -163 16.8303 0.292
NP_443000.1_7 Forward -343 -333 8.73149 0.0437
NP_443000.1_7 Reverse -330 -340 2.04498 0.226
NP_441842.1_1 Forward -339 -326 11.8184 0.241
NP_441842.1_10 Reverse -325 -339 8.35772 0.225
NP_440275.1_3 Reverse -330 -340 17.9746 0.0082
NP_440275.1_3 Forward -343 -333 8.4365 0.0602
NP_440091.1_1 Reverse -328 -340 12.6253 0.0353
NP_440091.1_1 Forward -345 -333 1.41561 0.197
NP_442275.1_1 Forward -398 -379 0.58944 0.285
NP_441397.1_8 Forward -200 -187 12.5712 0.256
NP_441902.1_3 Forward -164 -154 12.6902 0.236
NP_441902.1_3 Reverse -50 -60 12.2043 0.259
NP_443010.1_10 Forward -344 -327 5.76644 0.198
NP_441359.1_5 Forward -344 -325 8.25926 0.167
NP_441359.1_5 Forward -137 -118 1.76941 0.289
NP_442451.1_2 Forward -349 -330 1.67108 0.144
NP_439962.1_4 Forward -349 -330 -5.60541 0.28
NP_440149.1_8 Reverse -332 -351 3.14605 0.1
NP_440149.1_8 Reverse -112 -131 -5.99873 0.238
NP_441105.1_3 Forward -394 -375 -0.000545616 0.131
NP_441105.1_3 Reverse -321 -340 -5.01543 0.211
NP_441105.1_3 Forward -220 -201 -5.80207 0.224
NP_440216.1_1 Reverse -332 -346 7.57108 0.00935
NP_440216.1_1 Forward -341 -327 -1.47537 0.0328
NP_440172.1_1 Forward -341 -331 8.73149 0.0586
NP_440172.1_1 Reverse -332 -342 8.73149 0.0586
NP_442015.1_10 Forward -345 -332 19.1938 0.00444
NP_441226.1_7 Forward -340 -333 14.4934 0.0123
NP_441226.1_7 Reverse -333 -340 14.4934 0.0123
NP_441111.1_7 Forward -340 -332 18.7023 0.00294
NP_441111.1_7 Reverse -333 -341 18.7023 0.00294
NP_441766.1_2 Forward -341 -332 17.5026 0.00297
NP_441766.1_2 Reverse -332 -341 17.5026 0.00297
NP_442417.1_5 Reverse -332 -346 19.4691 0.0165
NP_440416.1_9 Forward -348 -329 -6.39206 0.0899
NP_440261.1_5 Forward -340 -327 6.50913 0.0332
NP_440261.1_5 Reverse -333 -346 -1.06236 0.0655
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAGGGAAATTTTGCCGGAGCCCTGGATGCCTATAAACAAGCTCTCCGCAATGAACCCACGGCGATCGCCGCTAAAATTGGCACTGGTCGGATGTATTTGGAATTGGACAATCCTGCCGAAGCTGTTTGGGTTTTCCGTGATTTAACCCGCCTCCAACCCAGTAACGCTGATTTTTATTACCTGCTGGGGGAAGCCTACGCTGTGGACGAAAAAATTGACTTGGCCAAAAAATCCTTTGGGGAAGCGAAAAAACTTTACCAGGCCCAGGGCAACACCGCTGGCAGTGACCGGACCCAAGAAAAGCTGGATAATCTCTAGTGGAAGTTAGCCAGACCAATGCTTGCTGACCAACTTTCAACAATCTATTTTTACCCTTTTCAGTTTTCAGGAGTTAATCACC

CDS

GTGGATGCAATGGAATTCTTTCGCAATAGTTCCGGCAACTGGCGATCGCAACGTACCACCCATCACCTGGCCTTCCGTCGGGCAGAAACCGGCACCTCGGAAATTTTTGTTGAAGCTCTGGGTGCTGATGATCAAAAAATTGTCGAGATTTGTGAAATGCACGACTGCGACCCAGCCAAAGCCGTGGGGGGAGCCTTTGTCCGCTGGGAAAGCGCCATGGCCTGGGATAAAGAGGATGAAAATCATGAAGGAACAACTGTATTTGCCCTCATTCCCGATGAAGACAATCCCCAACAGGGACTACTACTGCGGGAGAGGGGCTATGCGGAAATTGTCCCCATTGCCGGTCGCTATCACATCGACGAAGAGGAAGCCCTGGTGCTAGTGACGGAGTATGAGACCATGACCACCATTGAACGGTTCTGGTTTGCCAACCCGGATATGCGCCTTAGAACCAGTACTGTGCAAAGGTTTGGGGGATTCAATACCGCCACCTACTGTACGGAAATGCGGGTCAAAGAGGAAAACACCGTGTCTGCGTCCCCTGCCCCTGCCTACGAACAATTTTGTGGCTGGTAG

Protein

MDAMEFFRNSSGNWRSQRTTHHLAFRRAETGTSEIFVEALGADDQKIVEICEMHDCDPAKAVGGAFVRWESAMAWDKEDENHEGTTVFALIPDEDNPQQGLLLRERGYAEIVPIAGRYHIDEEEALVLVTEYETMTTIERFWFANPDMRLRTSTVQRFGGFNTATYCTEMRVKEENTVSASPAPAYEQFCGW