Your browser is old and dusty. Try Google Chrome!

Details for slr2044

ORF slr2044
Accession NP_440431.1
Symbol
Category zinc transport system ATP-binding protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -2 -16 10.9143 0.262
NP_441061.1_2 Forward -97 -83 1.27789 0.192
NP_440557.1_1 Reverse -90 -109 -0.39387 0.27
NP_440795.1_7 Forward -97 -90 14.6904 0.0123
NP_440795.1_7 Reverse -90 -97 14.6904 0.0123
NP_441418.1_6 Forward -98 -79 -1.37718 0.0136
NP_441418.1_6 Reverse -89 -108 -12.5869 0.0672
NP_441418.1_6 Forward -86 -67 -29.0082 0.215
NP_441418.1_6 Reverse -77 -96 -29.9915 0.249
NP_441453.1_1 Forward -105 -87 5.22993 0.251
NP_441453.1_1 Reverse -82 -100 5.22993 0.251
NP_441453.1_4 Reverse -89 -97 16.539 0.00633
NP_441453.1_4 Forward -98 -90 16.539 0.00633
NP_442151.1_6 Reverse -89 -103 17.8958 0.00866
NP_442151.1_6 Forward -98 -84 11.2093 0.106
NP_441818.1_1 Forward -243 -232 9.59626 0.232
NP_441818.1_9 Forward -91 -72 -6.68705 0.264
NP_440226.1_1 Reverse -89 -108 14.8474 0.0289
NP_440226.1_1 Forward -98 -79 7.86593 0.0975
NP_442623.1_3 Forward -85 -66 -18.5851 0.263
NP_442655.1_10 Forward -101 -82 -1.18052 0.182
NP_442173.1_1 Forward -97 -89 15.4574 0.00633
NP_442173.1_1 Reverse -90 -98 15.4574 0.00633
NP_442173.1_1 Reverse -26 -34 11.0325 0.0523
NP_442752.1_4 Forward -98 -91 13.8055 0.0199
NP_442752.1_4 Reverse -89 -96 13.8055 0.0199
NP_443027.1_4 Forward -100 -90 15.3197 0.0437
NP_443027.1_4 Reverse -87 -97 13.943 0.0452
NP_439997.1_6 Forward -266 -247 7.96426 0.285
NP_441812.1_1 Forward -322 -308 16.2235 0.193
NP_442975.1_10 Reverse -85 -99 21.6317 0.000774
NP_442975.1_10 Forward -102 -88 3.63724 0.252
NP_440784.1_7 Forward -97 -90 15.9687 0.0123
NP_440784.1_7 Reverse -90 -97 15.9687 0.0123
NP_441054.1_4 Forward -108 -90 0.609134 0.174
NP_441476.1_5 Forward -91 -72 -0.000545616 0.195
NP_441476.1_5 Reverse -84 -103 -1.18052 0.2
NP_441476.1_5 Reverse -72 -91 -3.24547 0.235
NP_441476.1_5 Forward -103 -84 -8.06369 0.296
NP_440878.1_9 Forward -108 -89 -3.44213 0.293
NP_442062.1_8 Forward -98 -88 19.4496 0.000558
NP_442062.1_8 Reverse -89 -99 10.3048 0.0493
NP_440761.1_4 Reverse -84 -103 -4.22878 0.132
NP_440761.1_4 Reverse -9 -28 -14.3569 0.262
NP_441859.1_3 Forward -99 -80 18.6815 0.0348
NP_441859.1_3 Reverse -88 -107 6.78348 0.171
NP_441859.1_3 Reverse -76 -95 6.78348 0.171
NP_440304.1_4 Forward -100 -90 18.9579 0.00406
NP_440304.1_4 Reverse -87 -97 9.91146 0.051
NP_440304.1_4 Reverse -12 -22 3.02829 0.299
NP_442242.1_4 Forward -97 -90 14.3954 0.0124
NP_442242.1_4 Reverse -90 -97 14.3954 0.0124
NP_442242.1_4 Reverse -26 -33 10.7572 0.153
NP_440044.1_8 Forward -97 -78 6.98095 0.0876
NP_440044.1_8 Forward -308 -289 -2.36049 0.262
NP_442048.1_9 Reverse -87 -106 8.45592 0.297
NP_439918.1_3 Reverse -10 -29 4.71934 0.264
NP_441208.1_9 Forward -101 -87 16.8142 0.0647
NP_441208.1_9 Reverse -86 -100 7.76774 0.219
NP_440764.1_10 Forward -95 -76 10.2251 0.266
NP_441594.1_6 Reverse -80 -99 3.53937 0.227
NP_441594.1_6 Forward -95 -76 1.17943 0.272
NP_441594.1_6 Reverse -370 -389 0.786102 0.281
NP_440370.1_10 Forward -107 -88 6.4893 0.291
NP_440132.1_1 Reverse -87 -105 13.0972 0.178
NP_442110.1_7 Reverse -89 -103 11.111 0.0636
NP_442110.1_7 Forward -98 -84 1.37622 0.23
NP_440856.1_4 Forward -105 -86 3.53937 0.124
NP_441083.1_5 Forward -98 -88 11.3864 0.0159
NP_441083.1_5 Reverse -89 -99 11.2881 0.0159
NP_442827.1_8 Reverse -81 -100 -1.67294 0.253
NP_441434.1_8 Reverse -301 -320 8.61937 0.285
NP_441738.1_2 Forward -96 -89 15.28 0.0102
NP_441738.1_2 Reverse -91 -98 15.28 0.0102
NP_441738.1_2 Forward -9 -2 11.8385 0.0469
NP_441558.1_5 Forward -100 -81 14.0608 0.0523
NP_441558.1_5 Reverse -87 -106 12.9791 0.0633
NP_441558.1_5 Forward -199 -180 4.32602 0.283
NP_440209.1_1 Reverse -89 -97 18.1123 0.00295
NP_440209.1_1 Forward -98 -90 18.1123 0.00295
NP_442889.1_8 Reverse -86 -100 3.63724 0.273
NP_440447.1_6 Reverse -81 -99 7.59063 0.14
NP_440447.1_6 Forward -106 -88 6.70565 0.143
NP_441713.1_1 Reverse -83 -102 -4.72043 0.113
NP_441713.1_1 Forward -104 -85 -4.81876 0.113
NP_441716.1_1 Reverse -89 -103 10.6193 0.0936
NP_441716.1_1 Forward -98 -84 3.8345 0.259
NP_442111.1_4 Reverse -88 -102 13.0776 0.0399
NP_442111.1_4 Forward -99 -85 9.83269 0.0575
NP_442111.1_4 Forward -222 -208 5.21113 0.172
NP_441163.1_1 Forward -210 -193 3.87303 0.299
NP_440906.1_5 Forward -97 -90 15.8704 0.0124
NP_440906.1_5 Reverse -90 -97 15.8704 0.0124
NP_440012.1_6 Reverse -14 -33 5.89931 0.299
NP_440747.1_10 Forward -101 -89 7.80712 0.00223
NP_440747.1_10 Reverse -86 -98 -2.02597 0.0196
NP_441130.1_10 Forward -100 -86 10.521 0.112
NP_441130.1_10 Reverse -87 -101 9.73436 0.12
NP_442973.1_5 Forward -394 -375 11.8975 0.223
NP_441486.1_1 Reverse -86 -100 -3.44199 0.178
NP_442850.1_6 Forward -91 -72 18.9773 0.177
NP_442634.1_4 Reverse -87 -101 14.3559 0.0195
NP_442634.1_4 Forward -100 -86 4.22782 0.0819
NP_442634.1_4 Reverse -12 -26 -4.52363 0.206
NP_441265.1_3 Forward -104 -90 12.9793 0.0742
NP_441265.1_3 Reverse -83 -97 3.14618 0.181
NP_442848.1_1 Reverse -83 -97 -3.24533 0.263
NP_443018.1_3 Forward -97 -90 14.8871 0.0123
NP_443018.1_3 Reverse -90 -97 14.8871 0.0123
NP_443018.1_3 Forward -220 -213 8.20058 0.153
NP_441316.1_7 Reverse -87 -102 13.7462 0.0486
NP_441316.1_7 Reverse -45 -60 1.45486 0.17
NP_441634.1_8 Forward -100 -86 5.60446 0.114
NP_440376.1_1 Forward -98 -89 19.4693 0.000692
NP_440376.1_1 Reverse -89 -98 19.4693 0.000692
NP_441857.1_5 Reverse -82 -100 6.80398 0.189
NP_441588.1_4 Forward -96 -86 6.96153 0.178
NP_442687.1_7 Reverse -88 -98 15.8113 0.0125
NP_442687.1_7 Forward -99 -89 9.02648 0.0994
NP_442687.1_7 Reverse -13 -23 5.87989 0.183
NP_441846.1_10 Forward -80 -61 -22.0267 0.257
NP_441846.1_10 Forward -86 -67 -22.9117 0.271
NP_441846.1_10 Forward -85 -66 -23.2067 0.279
NP_441080.1_7 Forward -361 -343 6.01657 0.296
NP_441422.1_7 Reverse -87 -104 -1.73112 0.194
NP_440533.1_9 Reverse -89 -108 12.7825 0.0866
NP_442296.1_5 Forward -219 -200 6.4893 0.251
NP_441763.1_10 Reverse -78 -97 14.1583 0.121
NP_442658.1_1 Reverse -87 -97 18.7607 0.00222
NP_442658.1_1 Forward -100 -90 15.9091 0.00966
NP_440662.1_2 Reverse -17 -36 8.45592 0.0924
NP_442782.1_2 Reverse -14 -28 9.73436 0.195
NP_442782.1_2 Reverse -2 -16 0.392915 0.29
NP_440607.1_8 Forward -76 -57 -0.983855 0.296
NP_442937.1_5 Reverse -84 -103 7.07928 0.263
NP_442321.1_4 Forward -32 -13 -7.4737 0.284
NP_441958.1_5 Forward -99 -89 21.2195 0.000805
NP_441958.1_5 Reverse -88 -98 12.2714 0.00183
NP_441958.1_5 Reverse -187 -197 -2.28158 0.27
NP_440203.1_5 Reverse -92 -102 12.7626 0.138
NP_440203.1_5 Forward -224 -214 9.81266 0.245
NP_439990.1_5 Forward -103 -90 19.3905 0.00775
NP_439990.1_5 Reverse -84 -97 11.819 0.126
NP_442376.1_2 Reverse -84 -103 -4.13045 0.238
NP_442376.1_2 Forward -103 -84 -13.5702 0.297
NP_442690.1_1 Forward -240 -221 -16.3235 0.287
NP_442911.1_2 Forward -108 -89 6.29264 0.0295
NP_442911.1_2 Reverse -79 -98 -0.4922 0.0759
NP_442911.1_2 Reverse -15 -34 -2.0655 0.0939
NP_441580.1_6 Reverse -78 -97 11.4058 0.0538
NP_440993.1_2 Forward -103 -87 15.4965 0.0631
NP_440993.1_2 Reverse -84 -100 4.18844 0.256
NP_440993.1_3 Forward -108 -89 6.98015 0.144
NP_441099.1_5 Reverse -79 -98 -0.197208 0.0896
NP_441099.1_5 Forward -108 -89 -7.4737 0.176
NP_442002.1_9 Reverse -88 -95 10.7572 0.185
NP_440809.1_9 Reverse -80 -98 1.98577 0.118
NP_440809.1_9 Forward -107 -89 -7.749 0.225
NP_440475.1_1 Reverse -80 -99 20.2135 0.0906
NP_441294.1_7 Reverse -85 -99 13.0902 0.0747
NP_441646.1_1 Reverse -189 -208 1.0811 0.237
NP_442438.1_10 Reverse -84 -98 9.5377 0.0627
NP_442438.1_10 Forward -103 -89 2.75286 0.168
NP_442438.1_10 Forward -73 -59 -0.393733 0.259
NP_441000.1_6 Forward -99 -85 -3.34366 0.221
NP_440605.1_4 Forward -108 -89 13.2796 0.25
NP_442771.1_1 Reverse -87 -105 -4.70074 0.166
NP_440147.1_4 Reverse -87 -100 12.2123 0.0326
NP_440147.1_4 Forward -100 -87 11.819 0.0326
NP_441550.1_8 Forward -100 -90 17.4824 0.00754
NP_441550.1_8 Reverse -87 -97 10.501 0.066
NP_441916.1_7 Reverse -89 -99 18.9579 0.00144
NP_441916.1_7 Forward -98 -88 18.4663 0.00144
NP_441916.1_7 Reverse -14 -24 2.92996 0.235
NP_440465.1_10 Forward -101 -82 -1.18052 0.29
NP_441041.1_4 Forward -98 -79 3.44104 0.065
NP_441041.1_4 Forward -197 -178 -2.0655 0.106
NP_441041.1_4 Reverse -89 -108 -9.93197 0.226
NP_441041.1_4 Forward -34 -15 -13.9635 0.299
NP_441041.1_7 Reverse -86 -98 19.5648 0.00277
NP_441041.1_7 Forward -101 -89 14.9975 0.0309
NP_442396.1_5 Forward -134 -121 10.5407 0.109
NP_442004.1_6 Forward -61 -47 7.07942 0.165
NP_442004.1_6 Reverse -89 -103 4.12949 0.224
NP_441725.1_4 Forward -16 -2 9.83206 0.144
NP_441725.1_4 Forward -390 -376 9.04542 0.178
NP_441725.1_4 Forward -103 -89 4.03056 0.278
NP_441725.1_5 Forward -97 -87 9.02648 0.0553
NP_441725.1_5 Reverse -90 -100 8.92815 0.0553
NP_439966.1_7 Reverse -87 -97 17.4824 0.00636
NP_439966.1_7 Forward -100 -90 13.8442 0.0234
NP_439966.1_9 Reverse -87 -96 10.7178 0.0863
NP_439966.1_9 Forward -100 -91 0.983037 0.253
NP_442941.1_3 Reverse -90 -100 10.9931 0.0116
NP_442941.1_3 Forward -97 -87 2.53664 0.14
NP_440289.1_2 Reverse -86 -99 12.9006 0.0132
NP_440289.1_2 Forward -101 -88 -4.50394 0.288
NP_440260.1_8 Reverse -186 -204 3.3624 0.17
NP_441514.1_6 Forward -206 -199 12.7238 0.29
NP_441678.1_2 Reverse -191 -210 27.8271 0.00242
NP_442281.1_1 Reverse -84 -98 9.6354 0.0684
NP_442281.1_1 Forward -103 -89 6.88214 0.113
NP_442281.1_1 Forward -202 -188 2.06395 0.278
NP_441334.1_7 Reverse -87 -106 -10.227 0.12
NP_442847.1_3 Reverse -183 -202 4.32522 0.281
NP_442575.1_9 Forward -199 -180 12.7825 0.275
NP_442012.1_1 Forward -104 -85 8.06259 0.106
NP_442012.1_1 Reverse -83 -102 -0.688862 0.265
NP_441457.1_7 Forward -100 -81 6.39097 0.174
NP_442982.1_5 Forward -108 -89 -0.787193 0.262
NP_441644.1_6 Reverse -89 -99 19.0557 0.000803
NP_441644.1_6 Forward -98 -88 10.1076 0.0628
NP_441644.1_6 Forward -23 -13 4.99446 0.216
NP_442215.1_1 Reverse -246 -265 2.45773 0.294
NP_442215.1_2 Reverse -87 -103 -3.38305 0.214
NP_440253.1_2 Forward -98 -80 12.4089 0.0281
NP_440253.1_2 Reverse -89 -107 -0.275845 0.207
NP_440929.1_8 Forward -98 -89 19.2726 0.000701
NP_440929.1_8 Reverse -89 -98 19.2726 0.000701
NP_440780.1_1 Reverse -290 -309 8.6416 0.274
NP_442933.1_10 Forward -98 -89 17.601 0.00325
NP_442933.1_10 Reverse -89 -98 17.601 0.00325
NP_441751.2_8 Reverse -90 -104 5.01447 0.0448
NP_441751.2_8 Forward -97 -83 -5.40861 0.206
NP_442554.1_8 Reverse -90 -100 19.1546 0.00369
NP_442554.1_8 Forward -97 -87 16.008 0.0065
NP_442167.1_6 Reverse -124 -140 12.4475 0.229
NP_441762.1_7 Forward -99 -87 12.527 0.0142
NP_441762.1_7 Reverse -88 -100 11.7404 0.0142
NP_442142.1_4 Forward -101 -88 15.4566 0.0264
NP_442142.1_4 Reverse -86 -99 14.4733 0.0311
NP_442142.1_4 Reverse -131 -144 3.7553 0.246
NP_442292.1_1 Reverse -90 -99 17.5026 0.00435
NP_442292.1_1 Forward -97 -88 9.63616 0.0183
NP_440421.1_1 Reverse -80 -94 13.3726 0.297
NP_442381.1_7 Forward -22 -9 17.1289 0.26
NP_442381.1_8 Reverse -86 -105 -12.3902 0.267
NP_441523.1_6 Forward -102 -83 4.42435 0.252
NP_443009.1_5 Forward -99 -88 19.626 0.00102
NP_443009.1_5 Reverse -88 -99 7.82632 0.118
NP_443009.1_5 Forward -130 -119 5.85971 0.185
NP_441715.1_4 Reverse -26 -36 12.2714 0.0684
NP_441715.1_4 Forward -97 -87 9.32148 0.097
NP_441715.1_4 Reverse -90 -100 7.25653 0.108
NP_440881.1_3 Reverse -78 -97 12.7816 0.291
NP_441198.1_8 Forward -100 -90 15.4199 0.0427
NP_441468.1_1 Forward -97 -90 15.8704 0.0124
NP_441468.1_1 Reverse -90 -97 15.8704 0.0124
NP_441015.1_10 Forward -103 -84 -6.1954 0.243
NP_441673.1_1 Forward -98 -89 20.8459 0.000698
NP_441673.1_1 Reverse -89 -98 20.8459 0.000698
NP_441826.1_2 Reverse -83 -97 4.32615 0.104
NP_441826.1_2 Forward -104 -90 -2.55701 0.273
NP_441826.1_2 Forward -143 -129 -4.13031 0.292
NP_441826.1_5 Forward -97 -78 1.67108 0.289
NP_441826.1_5 Forward -91 -72 1.47442 0.29
NP_441637.1_9 Forward -372 -354 -1.55415 0.292
NP_442490.1_9 Forward -98 -79 -7.37537 0.278
NP_442868.1_6 Forward -100 -90 8.63316 0.0555
NP_442868.1_6 Reverse -87 -97 8.53483 0.0555
NP_442677.1_5 Forward -98 -79 14.4541 0.251
NP_441612.1_2 Forward -130 -120 7.38753 0.255
NP_443058.1_7 Reverse -88 -107 1.57275 0.299
NP_442808.1_1 Reverse -88 -98 18.4657 0.00201
NP_442808.1_1 Forward -99 -89 8.73102 0.0481
NP_442775.1_3 Forward -294 -275 15.8307 0.162
NP_440145.1_3 Forward -108 -89 9.24257 0.0446
NP_442820.1_4 Reverse -371 -388 20.0984 0.265
NP_442718.1_1 Reverse -14 -33 8.25926 0.17
NP_442050.1_5 Forward -100 -90 17.1874 0.00812
NP_442050.1_5 Reverse -87 -97 8.23937 0.234
NP_442342.1_9 Reverse -87 -103 17.7581 0.0732
NP_442342.1_9 Forward -100 -84 4.58176 0.247
NP_441114.1_3 Forward -21 -12 15.1427 0.193
NP_440558.1_2 Forward -101 -82 -7.27704 0.291
NP_442576.1_2 Reverse -345 -364 15.3391 0.202
NP_441878.1_6 Forward -99 -89 10.5014 0.0176
NP_441878.1_6 Reverse -88 -98 10.4031 0.0176
NP_441878.1_6 Reverse -187 -197 0.963343 0.128
NP_441878.1_6 Reverse -13 -23 -7.29646 0.217
NP_441878.1_6 Reverse -194 -204 -7.78811 0.266
NP_441036.1_8 Reverse -88 -98 17.7779 0.000554
NP_441036.1_8 Forward -99 -89 15.713 0.00724
NP_441557.1_5 Forward -98 -89 19.9609 0.000699
NP_441557.1_5 Reverse -89 -98 19.9609 0.000699
NP_441445.1_1 Reverse -80 -99 4.22769 0.197
NP_442066.2_4 Forward -98 -79 -3.93378 0.223
NP_442066.2_9 Reverse -85 -98 8.37742 0.185
NP_441308.1_8 Forward -100 -90 12.4681 0.218
NP_441308.1_8 Reverse -87 -97 9.22315 0.226
NP_441458.1_10 Reverse -149 -168 1.47442 0.288
NP_442183.1_1 Forward -98 -84 11.406 0.0702
NP_442183.1_1 Reverse -89 -103 8.45605 0.115
NP_442347.1_2 Forward -97 -88 11.1111 0.056
NP_442347.1_2 Reverse -90 -99 3.34298 0.284
NP_441037.1_4 Forward -100 -90 16.5761 0.0168
NP_441037.1_4 Reverse -87 -97 16.2838 0.0168
NP_441633.1_3 Reverse -87 -100 5.91914 0.0481
NP_441633.1_3 Forward -100 -87 3.95252 0.0699
NP_440136.1_2 Forward -97 -90 15.9687 0.0123
NP_440136.1_2 Reverse -90 -97 15.9687 0.0123
NP_440136.1_2 Reverse -26 -33 3.97235 0.288
NP_442998.1_5 Forward -230 -220 11.6814 0.179
NP_442998.1_5 Forward -205 -195 9.12481 0.252
NP_442998.1_10 Forward -96 -89 15.5754 0.0102
NP_442998.1_10 Reverse -91 -98 15.5754 0.0102
NP_440299.1_1 Forward -102 -89 12.7034 0.0356
NP_440299.1_1 Reverse -85 -98 11.4251 0.0489
NP_441799.1_1 Forward -102 -88 9.34041 0.0942
NP_441799.1_1 Reverse -85 -99 3.44058 0.298
NP_442802.1_6 Forward -99 -80 11.1109 0.0905
NP_441007.1_10 Forward -103 -90 3.85419 0.182
NP_442334.1_2 Forward -395 -378 -8.22096 0.297
NP_440256.1_1 Forward -101 -82 0.58944 0.0818
NP_440256.1_1 Reverse -22 -41 -10.3253 0.299
NP_441362.1_5 Forward -155 -137 11.8108 0.23
NP_441559.1_8 Forward -103 -89 10.7177 0.0574
NP_441559.1_8 Reverse -84 -98 3.24451 0.143
NP_441559.1_8 Forward -27 -13 -6.19526 0.275
NP_441559.1_8 Reverse -115 -129 -7.08024 0.283
NP_440915.1_6 Reverse -85 -99 24.9757 0.000297
NP_440915.1_6 Forward -102 -88 13.3726 0.0187
NP_440915.1_6 Forward -78 -64 -0.983719 0.217
NP_442158.1_4 Reverse -149 -159 14.533 0.176
NP_440717.1_1 Forward -97 -78 4.32602 0.296
NP_442069.1_4 Reverse -78 -97 6.4893 0.245
NP_442452.1_8 Forward -104 -90 13.7653 0.273
NP_442866.1_1 Reverse -371 -390 -5.60541 0.243
NP_440748.1_5 Reverse -16 -35 0.0977854 0.252
NP_441464.1_10 Reverse -186 -200 14.8476 0.166
NP_441199.1_6 Reverse -85 -104 6.68596 0.131
NP_441199.1_6 Forward -102 -83 5.01433 0.156
NP_441494.1_6 Forward -103 -90 8.9674 0.227
NP_442993.1_1 Reverse -188 -204 -1.51476 0.0935
NP_442993.1_1 Forward -98 -82 -7.70961 0.146
NP_442993.1_1 Reverse -89 -105 -9.28291 0.181
NP_442386.1_9 Reverse -88 -97 15.7322 0.0144
NP_442386.1_9 Forward -99 -90 6.39082 0.219
NP_441340.1_5 Forward -97 -90 15.6737 0.0124
NP_441340.1_5 Reverse -90 -97 15.6737 0.0124
NP_441271.1_1 Reverse -83 -101 15.653 0.202
NP_441271.1_1 Forward -104 -86 14.768 0.202
NP_442484.1_2 Forward -45 -26 -1.57384 0.294
NP_440146.1_4 Reverse -4 -23 9.63589 0.129
NP_442714.1_7 Forward -22 -3 -0.885524 0.274
NP_440211.1_3 Reverse -91 -110 15.3391 0.287
NP_440586.1_1 Reverse -82 -101 -4.91709 0.278
NP_440586.1_8 Forward -97 -90 13.2151 0.026
NP_440586.1_8 Reverse -90 -97 13.2151 0.026
NP_440586.1_8 Forward -220 -213 9.08521 0.178
NP_442251.1_6 Forward -97 -90 15.2804 0.0124
NP_442251.1_6 Reverse -90 -97 15.2804 0.0124
NP_442251.1_6 Reverse -26 -33 9.67555 0.174
NP_440192.1_4 Forward -100 -81 13.2784 0.169
NP_441262.1_3 Reverse -89 -96 14.7888 0.0223
NP_441262.1_3 Forward -98 -91 14.7888 0.0223
NP_443051.1_1 Forward -99 -90 19.5676 0.00335
NP_443051.1_1 Reverse -88 -97 10.4228 0.00754
NP_439937.1_8 Reverse -75 -94 -2.16383 0.256
NP_439937.1_9 Forward -99 -82 10.6578 0.0407
NP_439937.1_9 Reverse -88 -105 1.11978 0.0948
NP_442294.1_3 Forward -355 -341 13.2736 0.274
NP_442294.1_3 Reverse -191 -205 12.2903 0.29
NP_441595.1_2 Reverse -348 -361 9.70646 0.277
NP_441665.1_2 Reverse -140 -159 11.5042 0.191
NP_440408.1_10 Forward -104 -85 12.3892 0.167
NP_440439.1_1 Forward -101 -88 17.5222 0.0105
NP_440439.1_1 Reverse -86 -99 9.36073 0.0465
NP_440439.1_1 Forward -49 -36 -0.275709 0.211
NP_439943.1_7 Reverse -20 -39 3.93269 0.285
NP_440372.1_2 Forward -97 -90 16.3621 0.0124
NP_440372.1_2 Reverse -90 -97 16.3621 0.0124
NP_440316.1_10 Reverse -187 -197 8.04317 0.24
NP_441803.1_2 Forward -103 -84 16.6174 0.0334
NP_439977.1_5 Reverse -83 -102 21.0423 0.0193
NP_439977.1_5 Forward -104 -85 13.1758 0.0531
NP_441572.1_7 Reverse -83 -102 -3.73712 0.219
NP_442384.1_10 Reverse -89 -102 9.36073 0.054
NP_442384.1_10 Forward -98 -85 2.2809 0.23
NP_442384.1_10 Forward -22 -9 0.412608 0.291
NP_442114.1_4 Forward -98 -87 12.1534 0.107
NP_442790.1_4 Reverse -80 -99 -8.45701 0.17
NP_442262.1_10 Forward -97 -90 14.1988 0.0123
NP_442262.1_10 Reverse -90 -97 14.1988 0.0123
NP_442262.1_10 Forward -220 -213 9.38056 0.202
NP_442262.1_10 Reverse -26 -33 8.8889 0.219
NP_441689.1_5 Forward -100 -90 8.43603 0.132
NP_440344.1_10 Reverse -82 -99 20.59 0.00176
NP_440344.1_10 Forward -105 -88 -0.0594896 0.0381
NP_440344.1_10 Forward -29 -12 -11.1709 0.205
NP_440282.1_10 Forward -33 -14 -7.86702 0.254
NP_440189.1_2 Forward -132 -113 1.86774 0.268
NP_440562.1_3 Reverse -90 -107 12.4285 0.0927
NP_440562.1_3 Forward -378 -361 2.20212 0.298
NP_441965.1_10 Reverse -86 -102 2.8118 0.282
NP_441640.1_8 Forward -97 -78 -0.39387 0.197
NP_442529.1_4 Reverse -80 -99 8.06259 0.278
NP_440297.1_9 Forward -97 -87 -0.216628 0.282
NP_440297.1_9 Reverse -90 -100 -0.314959 0.282
NP_441896.1_3 Reverse -80 -99 6.88262 0.1
NP_441896.1_3 Forward -107 -88 6.09597 0.108
NP_440894.1_10 Reverse -84 -103 14.4541 0.0965
NP_440894.1_10 Forward -103 -84 6.39097 0.215
NP_440999.1_9 Reverse -85 -99 21.1407 0.0083
NP_440999.1_9 Forward -102 -88 3.93283 0.12
NP_440888.1_2 Forward -98 -84 19.2718 0.00157
NP_440888.1_2 Reverse -89 -103 16.0269 0.00832
NP_440491.1_1 Forward -89 -70 8.86616 0.226
NP_439969.1_3 Reverse -84 -103 -0.4922 0.271
NP_442948.1_2 Forward -99 -80 5.80098 0.25
NP_442277.1_4 Reverse -80 -99 5.30853 0.175
NP_442033.1_10 Reverse -87 -106 19.469 0.0224
NP_442033.1_10 Forward -100 -81 -14.3569 0.298
NP_440575.1_1 Forward -283 -264 -0.29631 0.29
NP_442077.1_4 Reverse -303 -322 6.09597 0.289
NP_441543.1_2 Forward -97 -88 18.486 0.00236
NP_441543.1_2 Reverse -90 -99 15.9293 0.00518
NP_442845.1_2 Forward -104 -90 10.226 0.156
NP_441319.1_5 Forward -97 -78 10.5209 0.25
NP_441469.1_8 Reverse -88 -97 16.126 0.00797
NP_441469.1_8 Forward -99 -90 6.5879 0.227
NP_442315.1_2 Forward -135 -123 13.6087 0.291
NP_442315.1_2 Reverse -9 -21 10.1671 0.291
NP_443064.1_6 Reverse -89 -99 10.8217 0.13
NP_442578.1_7 Forward -97 -90 14.5921 0.026
NP_442578.1_7 Reverse -90 -97 14.5921 0.026
NP_441462.1_2 Reverse -89 -99 20.2362 0.000805
NP_441462.1_2 Forward -98 -88 11.5831 0.00406
NP_441621.1_7 Reverse -87 -101 23.7957 0.00827
NP_441621.1_7 Forward -100 -86 6.48943 0.068
NP_443062.1_1 Forward -98 -80 15.3714 0.0385
NP_443062.1_1 Reverse -212 -230 9.521 0.133
NP_443062.1_6 Reverse -81 -100 3.6377 0.231
NP_442204.1_1 Forward -102 -91 11.9567 0.0565
NP_442204.1_1 Reverse -184 -195 0.255333 0.282
NP_441560.1_8 Forward -103 -84 21.2515 0.00383
NP_440516.1_8 Forward -98 -89 16.9127 0.00442
NP_440516.1_8 Reverse -89 -98 16.9127 0.00442
NP_441785.1_1 Forward -98 -84 13.0292 0.231
NP_442428.1_4 Reverse -88 -107 6.88262 0.194
NP_442428.1_5 Forward -97 -90 15.8704 0.0124
NP_442428.1_5 Reverse -90 -97 15.8704 0.0124
NP_441443.1_1 Forward -74 -55 2.16274 0.194
NP_442120.1_10 Reverse -83 -102 -5.21209 0.199
NP_442120.1_10 Reverse -14 -33 -15.8318 0.296
NP_440673.1_3 Forward -96 -89 12.4288 0.0426
NP_440673.1_3 Reverse -91 -98 12.4288 0.0426
NP_440673.1_3 Reverse -372 -379 8.10225 0.24
NP_440673.1_3 Forward -21 -14 6.23397 0.283
NP_440865.1_9 Forward -104 -85 -3.14714 0.191
NP_440865.1_9 Reverse -83 -102 -7.96535 0.254
NP_441052.1_2 Forward -98 -88 10.5014 0.0285
NP_441052.1_2 Reverse -89 -99 10.4031 0.0285
NP_442219.1_9 Forward -97 -88 8.35786 0.0681
NP_442219.1_9 Reverse -90 -99 8.25953 0.0681
NP_442219.1_9 Reverse -236 -245 2.458 0.27
NP_440436.1_4 Forward -97 -88 18.1905 0.00233
NP_440436.1_4 Reverse -90 -99 9.24241 0.0871
NP_441884.1_9 Reverse -86 -105 -12.7836 0.138
NP_440314.1_9 Forward -97 -78 -7.57203 0.241
NP_440314.1_9 Reverse -90 -109 -8.45701 0.248
NP_441719.1_4 Forward -97 -90 16.3621 0.0124
NP_441719.1_4 Reverse -90 -97 16.3621 0.0124
NP_441733.1_10 Forward -101 -88 15.6539 0.0564
NP_441733.1_10 Reverse -86 -99 10.5407 0.106
NP_441004.1_1 Reverse -104 -123 -17.8968 0.295
NP_441004.1_2 Reverse -3 -22 -1.27885 0.259
NP_441004.1_2 Reverse -185 -204 -1.96717 0.263
NP_441004.1_2 Forward -139 -120 -3.73712 0.283
NP_441004.1_4 Reverse -11 -21 14.828 0.175
NP_441004.1_4 Reverse -288 -298 9.61647 0.259
NP_442813.1_4 Reverse -200 -219 -8.94866 0.299
NP_442813.1_5 Reverse -190 -209 2.0644 0.276
NP_442366.1_3 Reverse -88 -106 -4.11075 0.264
NP_441115.1_4 Forward -99 -81 21.8478 0.00196
NP_441115.1_4 Reverse -88 -106 18.7995 0.012
NP_442694.1_9 Reverse -237 -256 15.4374 0.174
NP_442206.1_10 Reverse -89 -104 2.8315 0.198
NP_443054.1_2 Forward -100 -86 12.586 0.0722
NP_441851.1_10 Reverse -88 -98 16.008 0.00552
NP_441851.1_10 Forward -99 -89 8.53483 0.114
NP_441851.1_10 Reverse -24 -34 4.50326 0.266
NP_441501.1_6 Reverse -186 -205 13.6675 0.279
NP_441982.1_6 Forward -17 -8 11.1485 0.288
NP_440165.1_5 Forward -99 -80 -7.67036 0.274
NP_441046.1_2 Reverse -2 -21 -1.57384 0.292
NP_442689.1_8 Reverse -336 -353 -3.30441 0.249
NP_441409.1_6 Forward -104 -85 0.58944 0.0648
NP_441409.1_6 Reverse -83 -102 -7.4737 0.151
NP_441409.1_6 Forward -250 -231 -11.3086 0.217
NP_440389.1_5 Forward -105 -86 13.3793 0.261
NP_440474.1_8 Forward -97 -83 8.16044 0.189
NP_440431.1_1 Forward -208 -189 32.9403 0.0000743
NP_440431.1_2 Forward -265 -246 29.7937 0.000517
NP_440431.1_3 Forward -24 -5 25.1722 0.0049
NP_440431.1_3 Forward -99 -80 -2.55715 0.171
NP_440431.1_3 Forward -198 -179 -7.37537 0.204
NP_440431.1_3 Reverse -88 -107 -11.5053 0.286
NP_440431.1_4 Forward -157 -138 19.5277 0.0281
NP_440431.1_5 Forward -49 -30 26.7455 0.00428
NP_440431.1_6 Forward -229 -210 26.9421 0.00398
NP_440431.1_7 Forward -285 -266 30.9737 0.000296
NP_440431.1_8 Forward -130 -111 24.6805 0.00316
NP_440431.1_10 Forward -347 -333 19.7641 0.126
NP_440588.1_2 Reverse -186 -205 -3.04881 0.177
NP_440588.1_2 Forward -107 -88 -3.44213 0.186
NP_440588.1_2 Forward -394 -375 -3.54046 0.189
NP_440195.1_4 Reverse -77 -96 4.03102 0.297
NP_442038.1_1 Forward -361 -342 7.37428 0.164
NP_441078.1_4 Forward -98 -89 19.6659 0.0007
NP_441078.1_4 Reverse -89 -98 19.6659 0.0007
NP_442729.1_8 Reverse -85 -98 8.47575 0.125
NP_442348.1_2 Reverse -218 -227 14.356 0.159
NP_442348.1_2 Reverse -2 -11 7.17789 0.285
NP_440526.1_3 Forward -97 -86 11.7595 0.0646
NP_440526.1_3 Reverse -90 -101 9.3996 0.0876
NP_440526.1_7 Reverse -306 -325 13.7282 0.255
NP_441432.1_8 Forward -99 -90 16.8143 0.00595
NP_441432.1_8 Reverse -88 -97 8.25953 0.0755
NP_441333.1_1 Forward -280 -270 12.3526 0.237
NP_442320.1_8 Reverse -83 -97 17.0108 0.00635
NP_442320.1_8 Forward -104 -90 -0.688726 0.0817
NP_441732.1_2 Forward -102 -86 3.30346 0.0141
NP_441732.1_2 Reverse -85 -101 -14.9861 0.145
NP_440629.1_4 Reverse -342 -361 10.7175 0.238
NP_442797.1_6 Reverse -190 -209 7.64329 0.281
NP_442353.1_6 Reverse -368 -387 8.84924 0.298
NP_440913.1_1 Forward -145 -127 10.9339 0.168
NP_440713.1_4 Reverse -79 -98 3.73603 0.239
NP_442489.1_7 Forward -98 -89 20.1576 0.000695
NP_442489.1_7 Reverse -89 -98 20.1576 0.000695
NP_442079.1_7 Forward -97 -78 8.65258 0.119
NP_440559.1_1 Forward -97 -88 8.75118 0.0586
NP_440559.1_1 Reverse -90 -99 8.65285 0.0586
NP_441659.2_8 Reverse -89 -99 20.9245 0.000805
NP_441659.2_8 Forward -98 -88 11.9764 0.0147
NP_441659.2_8 Forward -197 -187 2.53664 0.198
NP_441800.1_7 Forward -308 -290 -3.12744 0.268
NP_442776.1_1 Forward -22 -3 3.24438 0.29
NP_442346.1_5 Forward -99 -89 16.303 0.00248
NP_442346.1_5 Reverse -13 -23 10.1081 0.107
NP_442346.1_5 Reverse -88 -98 9.02648 0.118
NP_440545.1_3 Forward -102 -85 17.6401 0.0108
NP_440545.1_3 Reverse -85 -102 10.6586 0.031
NP_441856.1_3 Reverse -86 -105 0.58944 0.213
NP_441856.1_3 Reverse -11 -30 -0.590531 0.225
NP_440025.1_3 Forward -232 -218 14.2897 0.235
NP_441629.1_3 Forward -204 -185 6.09517 0.2
NP_440459.1_2 Forward -219 -202 9.97027 0.212
NP_442603.1_7 Reverse -89 -103 10.0287 0.134
NP_442603.1_7 Forward -379 -365 9.43874 0.146
NP_441888.1_7 Reverse -84 -98 2.5562 0.225
NP_441050.1_7 Forward -196 -178 25.0935 0.00723
NP_440449.1_6 Reverse -81 -99 11.3683 0.131
NP_441502.1_3 Forward -100 -81 18.289 0.112
NP_441833.1_4 Forward -97 -90 15.9687 0.0124
NP_441833.1_4 Reverse -90 -97 15.9687 0.0124
NP_441329.1_6 Reverse -259 -278 3.00757 0.217
NP_441895.1_10 Forward -318 -299 -19.0768 0.282
NP_442162.1_9 Forward -97 -90 16.2637 0.0124
NP_442162.1_9 Reverse -90 -97 16.2637 0.0124
NP_440671.1_4 Forward -104 -90 7.9644 0.205
NP_440671.1_4 Reverse -83 -97 7.76774 0.208
NP_440671.1_4 Forward -143 -129 6.48943 0.245
NP_440671.1_4 Reverse -206 -220 5.99778 0.266
NP_442404.1_9 Forward -95 -81 13.5686 0.263
NP_442199.1_5 Reverse -81 -100 2.75272 0.142
NP_442199.1_5 Forward -169 -150 2.55606 0.145
NP_442199.1_5 Forward -106 -87 -2.45882 0.185
NP_442199.1_7 Forward -31 -12 -0.689632 0.3
NP_442140.1_3 Forward -97 -87 17.4829 0.0159
NP_442140.1_3 Reverse -90 -100 7.94484 0.124
NP_441609.1_1 Reverse -304 -323 1.17943 0.196
NP_440875.1_9 Forward -96 -86 17.619 0.0104
NP_440875.1_9 Reverse -91 -101 17.5217 0.0116
NP_441813.1_5 Reverse -87 -97 10.0098 0.0208
NP_441813.1_5 Forward -100 -90 8.73149 0.0367
NP_441227.1_5 Reverse -78 -97 15.3391 0.202
NP_440590.1_4 Forward -97 -84 23.717 0.00216
NP_440590.1_4 Reverse -90 -103 6.4108 0.0575
NP_440567.1_1 Forward -97 -83 10.9143 0.0313
NP_440567.1_1 Reverse -90 -104 9.83269 0.0414
NP_440567.1_4 Reverse -2 -21 1.17943 0.261
NP_442497.1_10 Reverse -90 -99 17.601 0.00813
NP_442497.1_10 Forward -97 -88 10.4228 0.0087
NP_440821.1_4 Reverse -87 -97 18.7612 0.00422
NP_440821.1_4 Forward -100 -90 10.7964 0.0146
NP_441239.1_9 Forward -100 -88 17.4436 0.0146
NP_441239.1_9 Reverse -87 -99 16.0669 0.0175
NP_441239.1_9 Forward -199 -187 6.72548 0.178
NP_441727.1_3 Reverse -82 -101 6.4893 0.244
NP_441892.1_1 Forward -107 -90 -5.86102 0.29
NP_442044.1_1 Forward -103 -84 -11.5053 0.271
NP_442643.1_1 Reverse -83 -102 -11.1119 0.231
NP_442643.1_8 Reverse -70 -88 13.4897 0.216
NP_441017.1_8 Reverse -373 -388 14.1396 0.174
NP_441769.1_1 Reverse -81 -100 7.37428 0.279
NP_441874.1_1 Forward -140 -126 9.43936 0.277
NP_442052.1_8 Reverse -12 -22 16.1063 0.207
NP_440546.1_4 Reverse -89 -99 13.5365 0.0459
NP_440546.1_4 Forward -98 -88 11.8882 0.0679
NP_440546.1_4 Reverse -188 -198 11.5004 0.0806
NP_441230.1_5 Forward -202 -183 14.9458 0.0602
NP_440462.1_6 Forward -100 -90 19.4496 0.00371
NP_440462.1_6 Reverse -87 -97 17.9746 0.00578
NP_442611.1_1 Forward -103 -84 13.0775 0.07
NP_440868.1_4 Forward -102 -90 7.4138 0.0691
NP_440868.1_4 Reverse -85 -97 2.98891 0.142
NP_442499.1_3 Reverse -88 -106 7.39397 0.282
NP_442787.1_9 Reverse -8 -27 11.9958 0.296
NP_442402.1_4 Reverse -113 -132 -6.68779 0.263
NP_442402.1_6 Forward -133 -124 13.4711 0.284
NP_442402.1_10 Reverse -122 -132 14.0409 0.182
NP_441848.1_4 Forward -319 -303 11.8478 0.213
NP_441084.1_6 Forward -100 -86 11.2833 0.208
NP_442039.1_4 Forward -97 -90 15.1821 0.0124
NP_442039.1_4 Reverse -90 -97 15.1821 0.0124
NP_442039.1_4 Reverse -26 -33 10.5605 0.121
NP_442679.1_1 Forward -335 -316 -0.688862 0.223
NP_442837.1_3 Forward -97 -90 15.7721 0.0124
NP_442837.1_3 Reverse -90 -97 15.7721 0.0124
NP_439994.1_3 Reverse -88 -107 7.75569 0.3
NP_442053.1_1 Forward -98 -89 18.3876 0.0007
NP_442053.1_1 Reverse -89 -98 18.3876 0.0007
NP_440505.1_3 Forward -100 -90 15.418 0.0114
NP_440505.1_3 Reverse -87 -97 14.1397 0.0235
NP_442360.1_5 Reverse -284 -294 12.5664 0.298
NP_441252.1_6 Reverse -11 -18 14.3954 0.168
NP_441252.1_6 Forward -132 -125 11.6422 0.288
NP_441203.1_1 Reverse -90 -109 -12.3902 0.143
NP_440914.1_1 Reverse -89 -99 16.3248 0.00196
NP_440914.1_1 Forward -34 -24 9.68861 0.178
NP_440914.1_1 Forward -98 -88 8.6151 0.186
NP_440914.1_1 Reverse -128 -138 6.17532 0.293
NP_441011.1_8 Forward -97 -88 16.9127 0.00602
NP_441011.1_8 Reverse -90 -99 16.6177 0.00602
NP_442533.1_6 Forward -98 -89 17.2076 0.00137
NP_442533.1_6 Reverse -89 -98 17.2076 0.00137
NP_442533.1_6 Forward -22 -13 3.24465 0.219
NP_442533.1_6 Forward -197 -188 2.16301 0.27
NP_442322.1_4 Reverse -62 -79 -2.91177 0.237
NP_442229.1_1 Forward -100 -86 8.94708 0.184
NP_443016.1_10 Reverse -80 -99 15.3391 0.169
NP_441482.1_7 Forward -104 -90 -0.885388 0.0612
NP_439944.1_9 Reverse -90 -100 17.7779 0.00341
NP_439944.1_9 Forward -97 -87 10.4031 0.0887
NP_442664.1_10 Forward -185 -166 8.25926 0.263
NP_440116.1_8 Forward -97 -78 12.6841 0.0278
NP_440116.1_8 Reverse -90 -109 -8.16202 0.247
NP_441527.1_4 Reverse -259 -278 -10.2658 0.268
NP_440115.1_6 Forward -101 -91 16.9913 0.0288
NP_440007.1_9 Forward -26 -12 9.73436 0.167
NP_441059.1_10 Forward -213 -200 20.2755 0.167
NP_441602.1_3 Reverse -84 -103 -1.96717 0.231
NP_441602.1_3 Forward -91 -72 -4.03212 0.258
NP_441972.1_5 Forward -97 -78 -1.37718 0.177
NP_441106.1_1 Forward -99 -90 18.486 0.0028
NP_441106.1_1 Reverse -88 -97 18.191 0.0028
NP_440429.1_2 Forward -97 -78 13.6675 0.177
NP_442306.1_10 Forward -103 -84 -19.3717 0.197
NP_441286.1_1 Forward -99 -87 5.34885 0.0259
NP_441286.1_1 Reverse -88 -100 5.15219 0.0259
NP_440670.1_8 Forward -98 -89 18.3876 0.000699
NP_440670.1_8 Reverse -89 -98 18.3876 0.000699
NP_440670.1_8 Reverse -77 -86 4.0313 0.207
NP_442908.1_1 Forward -276 -257 0.491109 0.293
NP_440886.1_7 Reverse -88 -98 17.7774 0.0011
NP_440886.1_7 Forward -99 -89 8.04271 0.0805
NP_440886.1_7 Reverse -127 -137 4.40448 0.237
NP_440404.1_9 Reverse -266 -285 7.78217 0.268
NP_442072.1_9 Forward -99 -81 -3.71743 0.0374
NP_442072.1_9 Reverse -88 -106 -12.6655 0.0877
NP_442072.1_9 Reverse -187 -205 -21.8103 0.212
NP_441753.1_10 Forward -107 -88 2.94938 0.225
NP_440907.2_8 Reverse -90 -100 19.1541 0.00362
NP_440907.2_8 Forward -97 -87 17.4824 0.00685
NP_441463.1_3 Reverse -79 -98 8.25926 0.0487
NP_441626.1_2 Forward -97 -90 15.7721 0.0124
NP_441626.1_2 Reverse -90 -97 15.7721 0.0124
NP_442238.1_1 Reverse -14 -33 3.44104 0.215
NP_442794.1_1 Forward -389 -377 4.46387 0.261
NP_442794.1_1 Forward -102 -90 3.57889 0.286
NP_442615.1_1 Reverse -80 -98 13.2938 0.0118
NP_442615.1_1 Forward -107 -89 5.03403 0.0413
NP_441962.1_4 Forward -103 -84 -0.295539 0.117
NP_441962.1_4 Reverse -84 -103 -10.0303 0.223
NP_440387.1_1 Reverse -89 -105 8.22001 0.0282
NP_441431.1_2 Reverse -86 -100 15.0436 0.0537
NP_441431.1_2 Forward -101 -87 13.7653 0.0806
NP_442020.1_1 Forward -236 -217 -1.67294 0.294
NP_441488.1_7 Forward -104 -85 10.2259 0.113
NP_441836.1_2 Reverse -83 -102 -1.96717 0.224
NP_441993.1_1 Reverse -83 -102 2.72635 0.254
NP_441993.1_1 Reverse -182 -201 2.33652 0.26
NP_441993.1_1 Forward -104 -85 2.04414 0.265
NP_441174.1_2 Forward -101 -87 21.4357 0.00137
NP_440814.1_4 Reverse -80 -99 -13.6686 0.296
NP_440467.1_3 Forward -45 -26 12.0375 0.252
NP_442437.1_8 Reverse -78 -97 10.2259 0.189
NP_440287.1_6 Reverse -80 -99 9.53756 0.144
NP_442833.1_2 Reverse -282 -300 16.4396 0.27
NP_441272.1_10 Forward -92 -78 14.4542 0.244
NP_440766.1_4 Forward -102 -88 16.4209 0.0256
NP_440766.1_4 Reverse -85 -99 8.35772 0.0871
NP_440766.1_4 Forward -90 -76 3.93283 0.139
NP_441311.1_4 Reverse -171 -188 7.31533 0.298
NP_442930.1_1 Forward -228 -218 12.2709 0.239
NP_439910.1_2 Reverse -81 -98 -2.91109 0.0305
NP_439910.1_2 Forward -106 -89 -22.0856 0.207
NP_440457.1_1 Forward -102 -90 6.72548 0.113
NP_440457.1_1 Reverse -85 -97 5.34885 0.141
NP_440457.1_1 Forward -78 -66 0.23564 0.25
NP_440457.1_1 Reverse -184 -196 -0.256015 0.259
NP_441984.1_3 Reverse -177 -195 8.86894 0.218
NP_441889.1_4 Reverse -186 -205 3.44104 0.244
NP_442509.1_9 Forward -98 -88 16.2041 0.00739
NP_442509.1_9 Reverse -89 -99 8.04271 0.192
NP_442509.1_9 Forward -129 -119 6.76441 0.254
NP_441489.1_3 Forward -317 -303 10.2293 0.232
NP_441159.1_8 Forward -267 -248 1.86696 0.236
NP_440554.1_4 Reverse -90 -100 15.418 0.0199
NP_440554.1_4 Forward -97 -87 13.943 0.0218
NP_441845.1_6 Reverse -77 -95 4.05072 0.214
NP_441885.1_5 Forward -98 -88 11.4848 0.00668
NP_441885.1_5 Reverse -89 -99 11.3864 0.00668
NP_441428.1_8 Reverse -81 -100 6.19431 0.226
NP_442341.1_7 Forward -99 -85 13.5693 0.0338
NP_442341.1_7 Reverse -88 -102 10.816 0.0596
NP_441173.1_9 Reverse -124 -132 12.507 0.206
NP_441173.1_9 Forward -296 -288 12.0154 0.214
NP_442395.2_4 Reverse -88 -107 7.07848 0.141
NP_443000.1_7 Forward -100 -90 10.7964 0.0345
NP_443000.1_7 Reverse -87 -97 2.04498 0.226
NP_440507.2_3 Forward -107 -88 8.65176 0.247
NP_441842.1_10 Reverse -82 -96 10.226 0.167
NP_440275.1_3 Forward -100 -90 18.6629 0.0082
NP_440275.1_3 Reverse -87 -97 17.9746 0.0082
NP_440091.1_1 Reverse -85 -97 12.6253 0.0353
NP_441359.1_5 Forward -101 -82 0.58944 0.29
NP_439962.1_4 Reverse -69 -88 0.392778 0.197
NP_439962.1_4 Forward -94 -75 -5.70374 0.28
NP_441105.1_3 Forward -109 -90 4.62101 0.077
NP_441105.1_3 Reverse -78 -97 3.93269 0.0851
NP_441105.1_3 Forward -45 -26 -7.37537 0.251
NP_440216.1_1 Forward -98 -84 -1.47537 0.0328
NP_440216.1_1 Reverse -89 -103 -2.45868 0.0513
NP_440216.1_6 Reverse -82 -98 5.36841 0.189
NP_440216.1_9 Forward -159 -150 15.536 0.128
NP_440172.1_1 Reverse -89 -99 17.5813 0.00421
NP_440172.1_1 Forward -98 -88 8.73149 0.0586
NP_440172.1_1 Reverse -2 -12 5.09324 0.153
NP_440172.1_1 Reverse -14 -24 4.3066 0.194
NP_442015.1_10 Forward -102 -89 4.54251 0.167
NP_442015.1_10 Reverse -85 -98 3.95252 0.178
NP_441226.1_1 Forward -199 -185 16.6169 0.256
NP_441226.1_7 Forward -97 -90 14.4934 0.0123
NP_441226.1_7 Reverse -90 -97 14.4934 0.0123
NP_441485.1_2 Reverse -108 -127 10.6192 0.274
NP_441111.1_7 Forward -97 -89 18.7023 0.00294
NP_441111.1_7 Reverse -90 -98 18.7023 0.00294
NP_441766.1_2 Forward -98 -89 17.5026 0.00297
NP_441766.1_2 Reverse -89 -98 17.5026 0.00297
NP_440416.1_9 Forward -93 -74 -14.9469 0.182
NP_440416.1_9 Reverse -18 -37 -17.5035 0.241
NP_443052.1_8 Reverse -79 -98 -8.45701 0.175
NP_443052.1_9 Reverse -72 -91 -1.37718 0.227
NP_442403.1_8 Reverse -372 -391 1.57275 0.239
NP_440261.1_5 Reverse -90 -103 6.4108 0.0368
NP_440261.1_5 Forward -97 -84 -2.93064 0.0983
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCGGAATTGGACCCGGATAATCGCGACCAGTATGAGGCTAATTTAGCTGCATTTTTAGCGGAACTAGAGCGGTTAAATCAAGAATTAGGACAAATATTGCAACCTTTACCCCAAAGGAAATTTATTGTTTTCCATCCTTCTTGGGCTTACTTTGCTCGGGATTACAACTTGGTACAAATTCCCATCGAAGTGGAAGGGCAAGAACCCAGCGCCCAGGAATTGAAACAGTTAATTGATACGGCCAAGGAAAATAATCTAACCATGGTGTTTGGGGAAACCCAGTTCAGTACCAAAAGTTCCGAGGCGATCGCCGCTGAAATCGGAGCGGGGGTGGAGTTACTCGATCCTTTAGCCGCTGATTGGTCTAGCAATCTCAAAGCCGTTGCCCAAAAAATCGCCA

CDS

ATGCTAACAGTGCCCAGCCCTAATGCCAACGTCCCCATGGTTGATTCCCTACTCTCCCAACCAGTAATTGCCGTTGAAAATTTATTCGCTGGTTATGGCGCGACGCCAGTGCTAGAAAATATTAATCTGCGGGTGGAGGAAAGGGATTTTCTGGGCTTAATTGGCCCTAACGGCGGGGGAAAAACCACTCTGCTCAAAGTACTGTTGGGATTAATTCAACCCCAGCAAGGTACGGTACAAATTCTCGGGCGGTCAGTGGAACAGGGGCGGCGTTACGTGGGCTATGTACCCCAATGGTTAGAGTTTGACCGGGCGTTTCCAGTGCGGGTGTTGGACGTGGTCAGGATGGGCCGTTTGGGGCGGGGTAAATTATTTCGCCGTTATCACCAGCAGGATGAAGCCATTGTACGCCGTTGTTTAGAGCAGGTGGGCATGGGAGATTTAGGCGATCGCCCCTTGGGGACCCTGTCTGGAGGACAACGGCAACGGGTTTACATTGCCAGGGCCCTAGCTTCCCAACCGCAGATTTTATTGCTGGACGAACCCACCGCCAATGTAGACAGCAAAGTGCAAAGAAGTATTTACGAGTTATTGGGGGAACTGAATCAAACCATGACCATTGTGATGATTTCCCACGACCTGGGGGCCATTTCCCGCTATGTCAAAACCGTTGGTTGCCTCAACCGTAGTTTGCACTATCACCAGGAGAAATTTATTACGCCCCAGATGATTGAAGCCACCTATCAATGTCCGGTGGATTTAATTGCCCATGGTGTGCCCCATCGGGTTTTCCCTAGCCATGATCCGGCTTTACCCGGGTTAGATGCAACCAATGGCCAGGGGCATACAGCGGAGTGTCACCATGATTGA

Protein

MLTVPSPNANVPMVDSLLSQPVIAVENLFAGYGATPVLENINLRVEERDFLGLIGPNGGGKTTLLKVLLGLIQPQQGTVQILGRSVEQGRRYVGYVPQWLEFDRAFPVRVLDVVRMGRLGRGKLFRRYHQQDEAIVRRCLEQVGMGDLGDRPLGTLSGGQRQRVYIARALASQPQILLLDEPTANVDSKVQRSIYELLGELNQTMTIVMISHDLGAISRYVKTVGCLNRSLHYHQEKFITPQMIEATYQCPVDLIAHGVPHRVFPSHDPALPGLDATNGQGHTAECHHD