Your browser is old and dusty. Try Google Chrome!

Details for slr2041

ORF slr2041
Accession NP_440423.1
Symbol
Category probable two-component response regulator
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -188 -202 6.88276 0.112
NP_441061.1_2 Forward -56 -42 5.1128 0.142
NP_441061.1_2 Reverse -343 -357 1.37622 0.191
NP_441061.1_2 Forward -236 -222 -2.65535 0.3
NP_441418.1_6 Reverse -162 -181 -29.1065 0.216
NP_441418.1_6 Reverse -342 -361 -29.7948 0.238
NP_441480.1_5 Reverse -163 -182 14.3558 0.169
NP_442291.1_5 Reverse -132 -148 -2.5964 0.221
NP_440897.1_6 Forward -280 -261 1.37531 0.17
NP_441453.1_4 Reverse -342 -350 11.9175 0.0344
NP_441453.1_4 Forward -390 -382 7.29591 0.0589
NP_441453.1_4 Forward -142 -134 6.80426 0.121
NP_441453.1_4 Reverse -381 -389 6.70593 0.121
NP_441453.1_4 Reverse -133 -141 6.11594 0.121
NP_441453.1_4 Reverse -271 -279 4.24765 0.259
NP_442151.1_6 Reverse -271 -285 6.48943 0.233
NP_442151.1_6 Forward -262 -248 6.48943 0.233
NP_441818.1_1 Reverse -134 -145 13.1362 0.0861
NP_441818.1_9 Reverse -163 -182 -2.95047 0.213
NP_441818.1_9 Reverse -211 -230 -7.96535 0.274
NP_441818.1_9 Forward -351 -332 -8.65367 0.279
NP_441818.1_9 Reverse -36 -55 -10.7186 0.298
NP_440226.1_1 Reverse -381 -400 11.3075 0.0547
NP_441630.1_3 Forward -150 -131 10.8159 0.0877
NP_440150.1_6 Forward -354 -335 4.52268 0.24
NP_442287.1_5 Reverse -227 -237 18.1713 0.19
NP_442173.1_1 Reverse -134 -142 12.0158 0.0316
NP_442173.1_1 Reverse -382 -390 7.59091 0.163
NP_442173.1_1 Forward -389 -381 5.82095 0.2
NP_442173.1_1 Forward -141 -133 4.83764 0.241
NP_442752.1_4 Reverse -381 -388 13.8055 0.0199
NP_442752.1_4 Forward -142 -135 13.8055 0.0199
NP_442752.1_4 Forward -196 -189 12.1338 0.0546
NP_442752.1_4 Forward -351 -344 10.8555 0.0846
NP_442752.1_4 Forward -223 -216 5.25066 0.256
NP_443027.1_4 Reverse -379 -389 11.4848 0.105
NP_443027.1_4 Forward -282 -272 6.66654 0.274
NP_441745.1_3 Reverse -216 -235 13.3716 0.282
NP_442975.1_10 Forward -394 -380 17.3052 0.015
NP_442975.1_10 Reverse -249 -263 6.58715 0.17
NP_440784.1_7 Forward -389 -382 6.23397 0.241
NP_440784.1_7 Forward -141 -134 6.23397 0.241
NP_440784.1_7 Reverse -382 -389 6.13563 0.241
NP_440784.1_7 Reverse -134 -141 6.13563 0.241
NP_440061.1_9 Reverse -121 -135 14.8469 0.0573
NP_440061.1_9 Forward -176 -162 8.3571 0.177
NP_440061.1_9 Forward -282 -268 6.58715 0.239
NP_441054.1_6 Reverse -355 -374 12.4875 0.281
NP_439979.1_2 Reverse -348 -367 5.89931 0.292
NP_442062.1_8 Reverse -381 -391 9.61647 0.0587
NP_442062.1_8 Reverse -271 -281 4.10993 0.232
NP_440761.1_4 Reverse -337 -356 -2.95047 0.132
NP_441900.1_2 Forward -136 -118 -2.14486 0.274
NP_441859.1_3 Reverse -380 -399 2.55527 0.258
NP_441859.1_5 Forward -157 -138 10.9142 0.21
NP_440304.1_4 Reverse -379 -389 9.12481 0.0626
NP_440304.1_10 Reverse -382 -400 12.9005 0.233
NP_442242.1_4 Reverse -382 -389 12.4288 0.0393
NP_440044.1_8 Forward -389 -370 5.50599 0.102
NP_440044.1_8 Reverse -272 -291 1.67108 0.168
NP_441781.1_7 Reverse -180 -199 -0.885524 0.267
NP_439918.1_3 Reverse -165 -184 5.50599 0.264
NP_441935.1_1 Forward -141 -122 6.88262 0.26
NP_441935.1_2 Forward -363 -344 7.07928 0.103
NP_440307.1_2 Reverse -260 -279 18.4857 0.0774
NP_441594.1_6 Reverse -268 -287 10.1275 0.134
NP_442110.1_7 Reverse -342 -356 1.47456 0.226
NP_441925.1_4 Forward -178 -159 -5.1145 0.177
NP_441925.1_4 Forward -61 -42 -10.031 0.235
NP_441925.1_4 Forward -56 -37 -15.4392 0.264
NP_441925.1_4 Forward -181 -162 -15.5375 0.266
NP_440330.1_2 Forward -304 -285 10.2259 0.297
NP_440856.1_7 Forward -211 -192 0.392778 0.167
NP_440856.1_7 Reverse -348 -367 -4.6221 0.223
NP_440856.1_7 Forward -366 -347 -7.27704 0.249
NP_441083.1_5 Reverse -133 -143 16.7946 0.00546
NP_441083.1_5 Reverse -342 -352 -0.0199663 0.251
NP_441083.1_5 Forward -142 -132 -0.904945 0.283
NP_441434.1_3 Forward -250 -231 -0.787193 0.234
NP_441434.1_7 Reverse -135 -149 5.60446 0.225
NP_441738.1_2 Forward -388 -381 15.28 0.0102
NP_441738.1_2 Reverse -135 -142 15.28 0.0102
NP_441558.1_5 Reverse -269 -288 13.5691 0.057
NP_440209.1_1 Reverse -381 -389 14.8674 0.012
NP_440209.1_1 Forward -142 -134 8.57422 0.0425
NP_440209.1_1 Reverse -133 -141 5.52596 0.0821
NP_442889.1_8 Reverse -339 -353 8.06211 0.133
NP_441713.1_4 Forward -279 -260 11.4058 0.225
NP_442570.1_3 Forward -198 -179 -7.27704 0.269
NP_441716.1_1 Forward -280 -266 9.5377 0.112
NP_441716.1_1 Reverse -123 -137 5.80112 0.216
NP_440343.1_9 Reverse -164 -183 9.53756 0.251
NP_440906.1_5 Forward -389 -382 12.0355 0.0724
NP_440906.1_5 Reverse -382 -389 12.0355 0.0724
NP_440906.1_5 Forward -141 -134 6.23397 0.234
NP_440906.1_5 Reverse -134 -141 6.13563 0.241
NP_442596.1_10 Reverse -163 -182 8.06259 0.29
NP_440747.1_10 Reverse -378 -390 -11.8591 0.161
NP_440747.1_10 Forward -354 -342 -12.0557 0.199
NP_440747.1_10 Forward -145 -133 -12.0557 0.199
NP_440747.1_10 Reverse -130 -142 -12.3507 0.27
NP_440747.1_10 Reverse -268 -280 -12.4491 0.282
NP_441130.1_10 Reverse -131 -145 16.6175 0.0225
NP_441486.1_1 Reverse -339 -353 -1.96703 0.175
NP_441486.1_1 Forward -393 -379 -5.80194 0.26
NP_440403.1_4 Forward -151 -132 -9.53865 0.278
NP_440403.1_10 Forward -360 -341 10.8159 0.185
NP_441014.1_8 Reverse -343 -362 -9.63698 0.299
NP_442848.1_1 Reverse -375 -389 -4.22864 0.282
NP_442848.1_9 Forward -179 -160 0.786102 0.265
NP_443018.1_3 Forward -279 -272 12.5271 0.0523
NP_443018.1_3 Reverse -272 -279 12.5271 0.0523
NP_443018.1_3 Reverse -134 -141 11.7405 0.0655
NP_443018.1_3 Reverse -343 -350 10.4622 0.103
NP_443018.1_3 Forward -356 -349 9.38056 0.128
NP_443018.1_3 Forward -141 -134 5.44732 0.193
NP_443018.1_3 Forward -389 -382 5.34899 0.212
NP_443018.1_3 Reverse -382 -389 5.34899 0.212
NP_443018.1_3 Forward -350 -343 4.36568 0.254
NP_441634.1_8 Reverse -269 -283 14.2576 0.0293
NP_441634.1_8 Forward -353 -339 4.52282 0.124
NP_441634.1_8 Reverse -346 -360 2.65453 0.166
NP_441634.1_8 Forward -144 -130 -4.13031 0.295
NP_440376.1_1 Forward -134 -125 10.9145 0.0276
NP_440376.1_1 Forward -142 -133 5.99792 0.111
NP_440376.1_1 Forward -351 -342 2.65466 0.216
NP_440376.1_1 Forward -390 -381 -0.000272808 0.285
NP_440376.1_1 Reverse -381 -390 -0.0986038 0.285
NP_440376.1_1 Reverse -133 -142 -0.196935 0.285
NP_441588.1_4 Reverse -383 -393 7.35486 0.178
NP_442687.1_7 Forward -143 -133 7.25653 0.136
NP_442687.1_7 Reverse -380 -390 6.46988 0.165
NP_442485.1_3 Forward -153 -134 -5.9004 0.296
NP_441846.1_10 Reverse -153 -172 -21.535 0.256
NP_441846.1_10 Reverse -162 -181 -22.6167 0.264
NP_441846.1_10 Forward -206 -187 -23.6983 0.295
NP_441013.1_2 Reverse -260 -278 -1.35749 0.282
NP_441422.1_7 Forward -392 -375 -2.51776 0.215
NP_441029.1_8 Reverse -187 -206 16.5182 0.242
NP_441950.1_7 Reverse -162 -181 -7.96535 0.283
NP_441763.1_5 Reverse -189 -208 -3.93378 0.234
NP_441763.1_5 Forward -181 -162 -6.29373 0.274
NP_440360.1_5 Forward -399 -380 0.196116 0.297
NP_440360.1_10 Forward -178 -164 3.73617 0.227
NP_442658.1_1 Forward -392 -382 11.6809 0.0768
NP_442658.1_1 Forward -144 -134 6.27276 0.234
NP_442658.1_1 Reverse -379 -389 6.0761 0.238
NP_442658.1_1 Reverse -131 -141 5.28945 0.274
NP_442782.1_2 Reverse -168 -182 1.27789 0.281
NP_441414.1_9 Forward -142 -123 -10.522 0.287
NP_441487.1_9 Forward -143 -124 -0.688862 0.262
NP_441256.1_1 Reverse -348 -367 -7.96535 0.239
NP_441958.1_5 Reverse -380 -390 10.4031 0.0126
NP_441958.1_5 Forward -143 -133 9.12481 0.025
NP_441958.1_5 Forward -352 -342 -1.00328 0.227
NP_441127.1_1 Reverse -348 -362 11.996 0.215
NP_442486.1_4 Forward -388 -369 8.45592 0.27
NP_442836.1_5 Reverse -120 -139 4.81767 0.202
NP_442836.1_5 Forward -148 -129 1.0811 0.288
NP_440203.1_5 Reverse -345 -355 17.6791 0.0611
NP_440203.1_5 Reverse -190 -200 13.3526 0.116
NP_440203.1_5 Forward -387 -377 9.12434 0.271
NP_439905.1_1 Forward -279 -266 8.37742 0.234
NP_440984.1_7 Reverse -223 -237 7.37441 0.175
NP_440984.1_7 Reverse -209 -223 5.30946 0.259
NP_442911.1_2 Reverse -371 -390 -1.57384 0.0871
NP_440153.1_5 Forward -389 -375 0.982901 0.282
NP_440153.1_8 Forward -280 -267 4.34585 0.202
NP_441591.1_10 Forward -144 -125 5.40766 0.297
NP_442536.1_8 Reverse -33 -52 11.8975 0.253
NP_443055.1_6 Forward -288 -270 13.588 0.0955
NP_443055.1_6 Forward -351 -333 0.805058 0.239
NP_443055.1_6 Forward -365 -347 -0.6699 0.265
NP_440993.1_4 Reverse -342 -359 1.90713 0.3
NP_440388.1_7 Forward -266 -247 1.67108 0.251
NP_442002.1_9 Forward -143 -136 14.1004 0.074
NP_442002.1_9 Reverse -180 -187 11.1505 0.185
NP_441294.1_7 Reverse -129 -143 14.146 0.0466
NP_441294.1_7 Forward -394 -380 10.6905 0.177
NP_442431.1_10 Forward -291 -273 -0.374176 0.287
NP_442431.1_10 Reverse -36 -54 -0.669169 0.293
NP_441000.1_6 Reverse -132 -146 12.586 0.0408
NP_441000.1_6 Forward -143 -129 6.48943 0.0933
NP_441000.1_6 Reverse -380 -394 -4.91696 0.254
NP_442771.1_1 Reverse -296 -314 -10.4039 0.258
NP_441674.1_6 Forward -279 -260 10.6192 0.171
NP_440147.1_4 Forward -392 -379 9.65572 0.038
NP_440147.1_4 Forward -144 -131 5.82081 0.112
NP_441295.1_4 Forward -320 -301 -3.63879 0.29
NP_441550.1_8 Forward -144 -134 16.8925 0.00906
NP_441550.1_8 Reverse -379 -389 8.14104 0.132
NP_441916.1_7 Forward -390 -380 10.1081 0.0283
NP_441916.1_7 Reverse -381 -391 6.56821 0.0919
NP_441916.1_7 Forward -351 -341 3.91327 0.198
NP_440206.1_9 Forward -166 -147 12.3892 0.272
NP_441041.1_4 Reverse -342 -361 -3.44213 0.122
NP_441041.1_4 Forward -208 -189 -10.4236 0.232
NP_441041.1_4 Reverse -162 -181 -10.817 0.237
NP_441041.1_4 Reverse -228 -247 -13.5702 0.291
NP_441041.1_7 Forward -145 -133 15.6777 0.0222
NP_441041.1_7 Forward -393 -381 14.22 0.0379
NP_441041.1_7 Reverse -130 -142 5.57123 0.25
NP_442004.1_6 Reverse -265 -279 5.1128 0.197
NP_441725.1_5 Reverse -134 -144 1.94665 0.115
NP_441725.1_5 Forward -389 -379 -0.806614 0.271
NP_441725.1_5 Reverse -343 -353 -1.10161 0.288
NP_439966.1_7 Reverse -131 -141 17.6791 0.00636
NP_439966.1_7 Reverse -340 -350 4.60114 0.265
NP_439966.1_7 Reverse -379 -389 4.01116 0.295
NP_439966.1_9 Reverse -379 -388 0.983037 0.253
NP_440736.1_3 Reverse -379 -398 7.96426 0.169
NP_442941.1_3 Forward -389 -379 1.25834 0.15
NP_442941.1_3 Reverse -134 -144 0.865012 0.163
NP_442941.1_3 Reverse -343 -353 0.275027 0.222
NP_442941.1_3 Forward -279 -269 -0.314959 0.256
NP_440289.1_2 Reverse -130 -143 13.294 0.0132
NP_440289.1_2 Forward -145 -132 4.24752 0.0688
NP_440983.1_5 Reverse -187 -206 -2.36049 0.231
NP_440260.1_8 Forward -360 -342 -5.68405 0.276
NP_442281.1_1 Forward -395 -381 12.6836 0.035
NP_442281.1_1 Reverse -337 -351 5.30886 0.163
NP_442281.1_1 Forward -147 -133 2.06395 0.278
NP_442281.1_1 Forward -44 -30 1.5723 0.296
NP_441334.1_7 Reverse -340 -359 -13.5702 0.217
NP_442847.1_3 Reverse -253 -272 7.27514 0.235
NP_440437.1_1 Reverse -127 -146 3.44104 0.121
NP_440437.1_1 Forward -183 -164 -2.36049 0.218
NP_442012.1_1 Reverse -375 -394 7.27595 0.112
NP_442049.1_4 Forward -356 -337 -4.42544 0.279
NP_440498.1_1 Reverse -372 -390 -4.01242 0.285
NP_441644.1_6 Reverse -342 -352 12.9592 0.0265
NP_441644.1_6 Reverse -133 -143 12.7626 0.0285
NP_441644.1_6 Reverse -271 -281 11.4843 0.0481
NP_441644.1_6 Forward -390 -380 7.84605 0.115
NP_441644.1_6 Forward -357 -347 7.25606 0.132
NP_441644.1_6 Forward -280 -270 4.60114 0.233
NP_443049.1_6 Forward -143 -133 14.5687 0.114
NP_442501.1_2 Forward -239 -220 -3.14714 0.255
NP_440867.1_7 Reverse -164 -182 13.1955 0.299
NP_440867.1_10 Forward -366 -347 4.62101 0.283
NP_442215.1_2 Reverse -340 -356 1.5335 0.132
NP_442029.1_6 Reverse -360 -379 8.94757 0.199
NP_442029.1_6 Forward -285 -266 6.98095 0.231
NP_442029.1_6 Forward -279 -260 5.211 0.255
NP_440253.1_2 Reverse -381 -399 -0.669169 0.218
NP_440253.1_2 Forward -142 -124 -1.06249 0.23
NP_440253.1_2 Reverse -133 -151 -3.6191 0.297
NP_440929.1_8 Reverse -133 -142 7.07956 0.0713
NP_442933.1_10 Reverse -381 -390 13.9627 0.0192
NP_442933.1_10 Forward -390 -381 8.1612 0.0885
NP_442933.1_10 Forward -351 -342 4.62128 0.227
NP_441751.2_8 Forward -389 -375 6.48943 0.0354
NP_441751.2_8 Reverse -134 -148 3.63784 0.0642
NP_442554.1_8 Forward -279 -269 14.0414 0.0145
NP_442554.1_8 Reverse -272 -282 12.5664 0.0248
NP_442554.1_8 Forward -389 -379 9.41981 0.0594
NP_442554.1_8 Reverse -134 -144 5.28991 0.153
NP_442554.1_8 Reverse -343 -353 4.99491 0.163
NP_442554.1_8 Forward -350 -340 2.92996 0.249
NP_442554.1_8 Forward -365 -355 2.43831 0.272
NP_442554.1_8 Forward -141 -131 2.24165 0.276
NP_442554.1_8 Reverse -349 -359 1.94665 0.288
NP_441762.1_7 Forward -143 -131 3.87389 0.0642
NP_441762.1_7 Forward -391 -379 3.77555 0.0676
NP_441762.1_7 Reverse -380 -392 -7.04085 0.285
NP_442142.1_4 Forward -393 -380 6.60689 0.16
NP_442142.1_4 Reverse -345 -358 6.31189 0.169
NP_442142.1_4 Forward -354 -341 5.52525 0.188
NP_442142.1_4 Forward -231 -218 4.93527 0.206
NP_442142.1_4 Reverse -378 -391 4.14862 0.231
NP_442142.1_4 Forward -283 -270 3.7553 0.246
NP_442142.1_4 Reverse -193 -206 3.36198 0.258
NP_442292.1_1 Forward -389 -380 7.76787 0.0615
NP_442292.1_1 Forward -279 -270 5.80125 0.129
NP_442292.1_1 Reverse -343 -352 5.70292 0.135
NP_442292.1_1 Reverse -272 -281 5.21127 0.152
NP_442292.1_1 Reverse -134 -143 -0.295266 0.24
NP_442381.1_8 Reverse -122 -141 0.491109 0.119
NP_442381.1_8 Forward -145 -126 -13.3736 0.271
NP_442381.1_8 Reverse -130 -149 -14.7502 0.284
NP_443009.1_5 Reverse -380 -391 8.71129 0.102
NP_443009.1_5 Forward -63 -52 4.97473 0.222
NP_440279.1_2 Reverse -370 -389 6.4893 0.25
NP_440183.1_9 Reverse -135 -154 -16.7168 0.276
NP_440183.1_9 Forward -278 -259 -18.2901 0.276
NP_440379.1_5 Reverse -339 -358 -10.7186 0.283
NP_440464.1_10 Forward -131 -121 15.3 0.169
NP_441468.1_1 Forward -389 -382 6.13563 0.209
NP_441468.1_1 Forward -141 -134 6.13563 0.209
NP_441468.1_1 Reverse -382 -389 6.0373 0.223
NP_441468.1_1 Reverse -134 -141 6.0373 0.223
NP_441468.1_1 Forward -350 -343 4.07068 0.263
NP_441468.1_1 Reverse -272 -279 3.97235 0.277
NP_441468.1_1 Forward -279 -272 3.97235 0.277
NP_441020.2_3 Forward -242 -223 16.5191 0.169
NP_441020.2_6 Reverse -50 -67 10.0686 0.154
NP_441015.1_10 Forward -279 -260 -2.75381 0.182
NP_441015.1_10 Forward -285 -266 -4.03212 0.197
NP_441015.1_10 Reverse -157 -176 -4.52377 0.205
NP_441015.1_10 Reverse -352 -371 -7.86702 0.272
NP_441015.1_10 Forward -362 -343 -9.73531 0.282
NP_441015.1_10 Reverse -163 -182 -9.83364 0.282
NP_441015.1_10 Forward -326 -307 -10.6203 0.286
NP_441673.1_1 Forward -390 -381 1.37636 0.114
NP_441673.1_1 Forward -142 -133 1.37636 0.114
NP_441673.1_1 Reverse -381 -390 1.1797 0.163
NP_441673.1_1 Reverse -133 -142 1.1797 0.163
NP_441016.2_6 Forward -366 -347 8.75009 0.222
NP_442253.1_5 Forward -135 -118 0.235503 0.203
NP_442253.1_5 Reverse -50 -67 -7.04099 0.298
NP_441826.1_2 Reverse -342 -356 2.2612 0.132
NP_441826.1_2 Reverse -375 -389 0.196253 0.194
NP_441826.1_2 Forward -357 -343 -3.73699 0.286
NP_441826.1_5 Reverse -222 -241 3.93269 0.259
NP_442490.1_9 Reverse -187 -206 -7.27704 0.278
NP_442490.1_10 Forward -238 -220 10.0489 0.234
NP_442868.1_6 Forward -144 -134 8.82982 0.0555
NP_442868.1_6 Reverse -131 -141 0.176696 0.247
NP_442868.1_6 Reverse -269 -279 -0.118297 0.264
NP_441612.1_2 Forward -262 -252 6.61303 0.283
NP_442227.1_2 Reverse -183 -202 -3.93378 0.3
NP_443058.1_7 Forward -352 -333 4.22769 0.26
NP_442361.1_3 Forward -357 -344 9.36073 0.276
NP_442808.1_1 Reverse -132 -142 19.449 0.00201
NP_442808.1_1 Forward -391 -381 8.63269 0.0481
NP_442808.1_1 Reverse -341 -351 7.94438 0.0634
NP_442808.1_1 Reverse -324 -334 5.09279 0.173
NP_441101.1_10 Forward -311 -292 3.73603 0.173
NP_440918.1_2 Reverse -269 -288 9.0459 0.3
NP_442775.1_4 Reverse -352 -371 12.4875 0.266
NP_442775.1_6 Reverse -31 -50 15.2408 0.236
NP_442775.1_6 Forward -201 -182 12.7825 0.277
NP_440145.1_3 Forward -206 -187 -6.1954 0.292
NP_441906.1_5 Forward -181 -162 9.24175 0.263
NP_442542.1_2 Reverse -131 -144 8.77074 0.149
NP_442542.1_2 Forward -144 -131 6.4108 0.227
NP_442113.1_10 Forward -178 -159 -7.86702 0.271
NP_442050.1_5 Reverse -379 -389 7.35439 0.26
NP_442747.1_1 Reverse -222 -241 -17.1101 0.247
NP_440558.1_2 Forward -283 -264 2.3594 0.169
NP_440558.1_2 Forward -66 -47 -4.42544 0.245
NP_440558.1_2 Reverse -178 -197 -5.60541 0.262
NP_440558.1_2 Reverse -267 -286 -6.29373 0.273
NP_440111.2_2 Forward -362 -343 -0.4922 0.215
NP_440111.2_6 Forward -277 -258 16.3224 0.283
NP_441518.1_3 Forward -290 -271 -15.8318 0.299
NP_441878.1_6 Forward -143 -133 0.766681 0.134
NP_441878.1_6 Reverse -270 -280 0.668351 0.139
NP_441878.1_6 Forward -281 -271 0.57002 0.14
NP_441878.1_6 Forward -63 -53 -7.59145 0.245
NP_441036.1_8 Forward -391 -381 15.9097 0.00724
NP_441036.1_8 Reverse -132 -142 6.07655 0.242
NP_441036.1_8 Forward -147 -137 5.68323 0.265
NP_442721.1_10 Reverse -86 -105 22.0256 0.0113
NP_441557.1_5 Reverse -381 -390 8.84951 0.0343
NP_441557.1_5 Forward -142 -133 1.08137 0.0794
NP_441557.1_5 Forward -390 -381 0.786375 0.106
NP_441557.1_5 Reverse -133 -142 0.589713 0.134
NP_441557.1_5 Forward -351 -342 -0.786921 0.239
NP_441557.1_8 Reverse -188 -198 11.1893 0.26
NP_441445.1_1 Forward -289 -270 2.26107 0.238
NP_441433.1_8 Reverse -343 -362 0.0977854 0.242
NP_442469.1_2 Reverse -362 -380 12.8022 0.298
NP_441574.1_1 Reverse -162 -181 -7.86702 0.297
NP_441549.1_9 Reverse -164 -182 -10.3056 0.274
NP_442347.1_2 Reverse -127 -136 5.01461 0.244
NP_442645.1_2 Forward -198 -179 -18.6834 0.278
NP_441037.1_4 Reverse -379 -389 15.5041 0.028
NP_442594.1_10 Forward -387 -368 10.1267 0.28
NP_441633.1_3 Reverse -131 -144 -2.144 0.173
NP_441633.1_3 Forward -392 -379 -4.01229 0.179
NP_441405.1_1 Reverse -53 -63 17.3846 0.229
NP_442764.1_8 Reverse -260 -279 3.04771 0.272
NP_440136.1_2 Forward -389 -382 6.23397 0.171
NP_440136.1_2 Forward -141 -134 6.23397 0.171
NP_440136.1_2 Reverse -382 -389 6.13563 0.193
NP_440136.1_2 Reverse -134 -141 6.13563 0.193
NP_442590.1_9 Reverse -341 -360 5.70265 0.269
NP_442590.1_10 Reverse -126 -145 8.65258 0.206
NP_442998.1_5 Forward -250 -240 13.0581 0.158
NP_442998.1_5 Reverse -179 -189 7.55152 0.289
NP_442998.1_10 Forward -388 -381 15.5754 0.0102
NP_442998.1_10 Reverse -135 -142 15.5754 0.0102
NP_442998.1_10 Reverse -344 -351 6.13563 0.181
NP_440299.1_1 Reverse -377 -390 5.23026 0.184
NP_440299.1_1 Forward -355 -342 3.36198 0.247
NP_441799.1_1 Reverse -338 -352 6.78381 0.162
NP_441799.1_1 Reverse -377 -391 6.58715 0.167
NP_441799.1_1 Reverse -267 -281 4.71887 0.238
NP_441007.1_5 Reverse -220 -239 18.7807 0.0913
NP_441007.1_10 Reverse -376 -389 8.37742 0.115
NP_441007.1_10 Forward -285 -272 0.805932 0.216
NP_441435.1_4 Forward -226 -207 8.16093 0.255
NP_440256.1_1 Reverse -378 -397 -3.14714 0.127
NP_440256.1_1 Forward -145 -126 -10.227 0.297
NP_440087.1_1 Forward -151 -132 -7.76869 0.276
NP_441229.1_10 Reverse -44 -63 1.76941 0.288
NP_441090.1_2 Forward -209 -190 2.45773 0.227
NP_442007.1_8 Forward -181 -163 9.26148 0.281
NP_441559.1_8 Reverse -49 -63 -3.93365 0.213
NP_440915.1_6 Forward -146 -132 2.06454 0.126
NP_440915.1_6 Forward -200 -186 0.786239 0.153
NP_440915.1_6 Reverse -129 -143 -1.08205 0.22
NP_442069.1_4 Reverse -122 -141 4.71934 0.254
NP_442069.1_7 Forward -239 -220 12.29 0.219
NP_442866.1_1 Forward -362 -343 -1.7705 0.204
NP_442866.1_1 Reverse -337 -356 -7.27704 0.266
NP_441464.1_8 Forward -56 -42 6.09611 0.247
NP_441464.1_8 Forward -135 -121 4.81781 0.263
NP_441464.1_8 Reverse -271 -285 3.53951 0.296
NP_440702.1_2 Reverse -34 -53 -6.78538 0.261
NP_440026.1_4 Forward -145 -126 10.5209 0.239
NP_440695.1_6 Forward -33 -19 13.514 0.236
NP_439985.1_7 Forward -286 -267 2.94938 0.28
NP_442993.1_1 Forward -351 -335 7.63002 0.0312
NP_442993.1_1 Forward -142 -126 -7.31629 0.146
NP_442993.1_1 Forward -196 -180 -10.3645 0.217
NP_442386.1_9 Reverse -132 -141 13.8639 0.0289
NP_442386.1_9 Reverse -341 -350 11.4057 0.0942
NP_442386.1_9 Reverse -270 -279 10.324 0.132
NP_442386.1_9 Forward -358 -349 10.324 0.132
NP_442386.1_9 Forward -281 -272 9.04574 0.175
NP_442386.1_9 Forward -391 -382 7.07914 0.219
NP_442386.1_10 Forward -142 -129 3.85419 0.266
NP_441750.1_7 Reverse -162 -172 15.418 0.254
NP_441340.1_5 Forward -141 -134 13.5105 0.0314
NP_441340.1_5 Reverse -382 -389 6.13563 0.175
NP_441340.1_5 Forward -389 -382 5.93897 0.198
NP_441340.1_5 Reverse -134 -141 5.84064 0.208
NP_441340.1_5 Reverse -272 -279 4.07068 0.239
NP_441340.1_5 Forward -350 -343 4.07068 0.239
NP_441340.1_5 Forward -279 -272 4.07068 0.239
NP_441947.1_10 Forward -288 -270 1.98577 0.276
NP_440586.1_8 Reverse -382 -389 11.4451 0.0645
NP_440586.1_8 Reverse -134 -141 9.47853 0.146
NP_440586.1_8 Forward -279 -272 7.61025 0.227
NP_440586.1_8 Reverse -343 -350 7.61025 0.227
NP_440586.1_8 Reverse -272 -279 7.61025 0.227
NP_440586.1_8 Forward -141 -134 5.74197 0.283
NP_442251.1_6 Forward -389 -382 12.0355 0.0627
NP_440969.1_3 Forward -54 -36 7.49153 0.278
NP_441262.1_3 Reverse -381 -388 14.7888 0.0223
NP_441262.1_3 Forward -142 -135 14.7888 0.0223
NP_441262.1_3 Forward -351 -344 5.25066 0.215
NP_440027.1_3 Reverse -123 -141 2.96833 0.282
NP_443051.1_1 Forward -143 -134 15.1427 0.00754
NP_443051.1_1 Reverse -380 -389 9.93116 0.0146
NP_439937.1_9 Forward -305 -288 -11.7615 0.264
NP_441595.1_5 Forward -141 -123 6.31233 0.229
NP_440439.1_1 Reverse -378 -391 8.67241 0.0513
NP_440439.1_1 Reverse -130 -143 0.117615 0.202
NP_442239.1_8 Reverse -158 -177 12.9791 0.238
NP_440372.1_2 Forward -141 -134 13.8055 0.0214
NP_440372.1_2 Reverse -382 -389 6.72562 0.0929
NP_440372.1_2 Forward -389 -382 6.62729 0.151
NP_440372.1_2 Reverse -134 -141 6.52896 0.188
NP_440372.1_2 Forward -350 -343 4.07068 0.262
NP_440819.1_5 Forward -251 -243 7.98423 0.228
NP_440316.1_10 Forward -143 -133 13.943 0.199
NP_440316.1_10 Reverse -161 -171 6.76487 0.253
NP_441803.1_2 Forward -267 -248 2.75272 0.204
NP_441803.1_2 Forward -279 -260 1.86774 0.223
NP_439977.1_5 Reverse -336 -355 8.65258 0.103
NP_440139.1_1 Forward -148 -129 11.11 0.0845
NP_442549.1_3 Forward -389 -370 22.2223 0.0236
NP_441903.1_7 Reverse -222 -241 25.5655 0.00684
NP_442384.1_10 Forward -390 -377 4.44418 0.157
NP_442384.1_10 Reverse -342 -355 3.95252 0.172
NP_442384.1_10 Reverse -298 -311 3.65753 0.183
NP_442384.1_10 Forward -280 -267 1.88757 0.243
NP_440364.1_6 Forward -358 -345 15.85 0.275
NP_441018.1_7 Forward -200 -181 10.4225 0.205
NP_442790.1_4 Forward -151 -132 -4.22878 0.13
NP_442262.1_10 Reverse -134 -141 13.2155 0.0213
NP_442262.1_10 Reverse -343 -350 10.6589 0.14
NP_442262.1_10 Forward -279 -272 10.4622 0.145
NP_442262.1_10 Reverse -272 -279 10.4622 0.145
NP_442262.1_10 Forward -356 -349 9.47889 0.187
NP_440163.1_10 Forward -354 -344 14.4347 0.102
NP_440163.1_10 Forward -318 -308 11.6814 0.169
NP_440531.1_6 Forward -150 -131 2.0644 0.164
NP_440531.1_6 Reverse -263 -282 -5.40875 0.297
NP_440531.1_6 Reverse -334 -353 -5.50708 0.299
NP_442123.1_3 Forward -390 -371 12.4875 0.2
NP_441965.1_10 Reverse -309 -325 5.56507 0.203
NP_441640.1_8 Forward -279 -260 -2.26216 0.226
NP_442529.1_4 Forward -399 -380 8.16093 0.278
NP_440297.1_9 Reverse -272 -282 0.0783647 0.282
NP_440297.1_9 Forward -279 -269 -0.118297 0.282
NP_440297.1_9 Reverse -343 -353 -0.216628 0.282
NP_440297.1_9 Reverse -134 -144 -0.216628 0.282
NP_442280.1_10 Reverse -261 -279 8.96084 0.246
NP_440894.1_10 Reverse -337 -356 3.04771 0.279
NP_440999.1_9 Reverse -338 -352 8.84938 0.0709
NP_440999.1_9 Reverse -129 -143 -0.688726 0.214
NP_440888.1_2 Reverse -342 -356 14.1586 0.02
NP_440792.1_5 Forward -141 -122 5.11266 0.254
NP_440600.1_4 Forward -398 -380 -7.55234 0.293
NP_439969.1_1 Reverse -255 -274 -5.60541 0.288
NP_440105.1_3 Forward -239 -225 18.2885 0.245
NP_441543.1_2 Forward -389 -380 6.19458 0.153
NP_441543.1_2 Reverse -382 -391 5.99792 0.159
NP_441543.1_2 Forward -279 -270 5.11294 0.209
NP_441543.1_2 Reverse -343 -352 4.81794 0.219
NP_442845.1_2 Forward -357 -343 7.47274 0.195
NP_442845.1_2 Forward -327 -313 6.6861 0.205
NP_442845.1_2 Reverse -342 -356 5.30946 0.237
NP_442845.1_2 Reverse -370 -384 3.8345 0.275
NP_441178.1_4 Reverse -310 -329 12.0942 0.21
NP_441178.1_6 Forward -181 -162 4.12856 0.269
NP_441178.1_6 Forward -369 -350 3.44025 0.269
NP_441918.1_7 Reverse -227 -246 -0.688862 0.297
NP_441918.1_10 Forward -356 -338 19.882 0.0511
NP_440982.1_1 Forward -172 -153 5.80018 0.294
NP_440982.1_1 Forward -183 -164 5.30853 0.294
NP_441469.1_8 Reverse -132 -141 5.60459 0.258
NP_442315.1_1 Reverse -163 -181 8.7706 0.21
NP_443064.1_6 Reverse -133 -143 8.59164 0.278
NP_442337.1_8 Reverse -260 -279 10.8159 0.149
NP_442578.1_7 Forward -141 -134 6.0373 0.18
NP_442578.1_7 Reverse -382 -389 5.93897 0.183
NP_440710.1_1 Forward -142 -124 -8.14232 0.257
NP_441462.1_2 Forward -142 -132 7.55152 0.0543
NP_441462.1_2 Reverse -381 -391 1.16001 0.0976
NP_441462.1_2 Forward -390 -380 0.766681 0.125
NP_441462.1_2 Reverse -133 -143 0.471689 0.148
NP_441462.1_2 Forward -351 -341 -0.904945 0.265
NP_441621.1_7 Forward -392 -378 -3.54032 0.19
NP_443062.1_1 Reverse -381 -399 12.4462 0.0796
NP_443062.1_1 Forward -390 -372 8.64343 0.15
NP_443062.1_1 Forward -39 -21 4.15809 0.272
NP_442204.1_1 Forward -355 -344 10.6784 0.0697
NP_442204.1_1 Reverse -377 -388 2.22195 0.266
NP_442204.1_1 Reverse -158 -169 1.33697 0.274
NP_442204.1_6 Forward -360 -341 21.2389 0.0515
NP_442204.1_6 Reverse -156 -175 4.22769 0.297
NP_440516.1_6 Forward -366 -352 11.4053 0.204
NP_440516.1_8 Forward -142 -133 18.9776 0.00442
NP_440516.1_8 Reverse -381 -390 8.1612 0.0417
NP_440516.1_8 Reverse -133 -142 5.01461 0.118
NP_440516.1_8 Forward -351 -342 -0.295266 0.232
NP_441033.1_2 Forward -400 -381 1.76941 0.135
NP_442428.1_5 Forward -389 -382 6.13563 0.209
NP_442428.1_5 Forward -141 -134 6.13563 0.209
NP_442428.1_5 Reverse -382 -389 6.0373 0.212
NP_442428.1_5 Reverse -134 -141 6.0373 0.212
NP_442428.1_5 Forward -350 -343 4.46401 0.267
NP_442428.1_5 Forward -279 -272 4.36568 0.271
NP_442428.1_5 Reverse -272 -279 4.36568 0.271
NP_441267.1_1 Reverse -265 -284 5.50599 0.227
NP_442120.1_10 Reverse -271 -290 -15.2418 0.292
NP_442120.1_10 Forward -292 -273 -15.3402 0.294
NP_440673.1_2 Forward -290 -271 8.63366 0.264
NP_440673.1_3 Forward -388 -381 12.4288 0.0426
NP_440673.1_3 Reverse -135 -142 12.4288 0.0426
NP_440673.1_3 Reverse -344 -351 11.6422 0.0724
NP_441052.1_2 Forward -280 -270 5.19158 0.128
NP_441052.1_2 Reverse -271 -281 4.0116 0.168
NP_441052.1_2 Reverse -253 -263 3.61828 0.177
NP_441052.1_2 Forward -132 -122 3.32329 0.181
NP_441052.1_2 Reverse -133 -143 1.16001 0.25
NP_440436.1_4 Reverse -382 -391 13.6673 0.0225
NP_440436.1_4 Reverse -188 -197 8.06244 0.118
NP_440436.1_4 Reverse -134 -143 6.29249 0.164
NP_440436.1_4 Forward -389 -380 5.9975 0.174
NP_440436.1_4 Forward -279 -270 4.7192 0.244
NP_440436.1_4 Reverse -343 -352 4.62087 0.248
NP_441884.1_8 Forward -391 -372 -9.24366 0.268
NP_441884.1_9 Reverse -339 -358 -13.7669 0.138
NP_442414.1_2 Forward -202 -183 9.24257 0.24
NP_441719.1_4 Forward -141 -134 6.82395 0.0855
NP_441719.1_4 Reverse -382 -389 6.72562 0.093
NP_441719.1_4 Forward -389 -382 6.62729 0.151
NP_441719.1_4 Reverse -134 -141 6.52896 0.188
NP_441733.1_10 Forward -145 -132 10.2457 0.106
NP_441733.1_10 Reverse -378 -391 7.6891 0.152
NP_441004.1_1 Reverse -222 -241 -15.7335 0.277
NP_441004.1_2 Forward -73 -54 1.86774 0.217
NP_441004.1_3 Reverse -231 -250 6.29264 0.224
NP_442366.1_3 Reverse -380 -398 -3.81576 0.258
NP_442206.1_1 Forward -366 -347 -10.522 0.219
NP_440328.1_4 Forward -229 -210 5.211 0.151
NP_440094.1_3 Reverse -313 -332 13.3725 0.0296
NP_443054.1_2 Reverse -52 -66 8.25939 0.126
NP_443054.1_2 Reverse -323 -337 5.80112 0.219
NP_443054.1_2 Forward -353 -339 2.16287 0.245
NP_443054.1_2 Forward -64 -50 0.982901 0.251
NP_441851.1_10 Forward -352 -342 5.87989 0.196
NP_441851.1_10 Reverse -270 -280 4.3066 0.277
NP_442622.1_8 Reverse -133 -151 10.1472 0.0626
NP_442515.1_1 Forward -135 -121 5.30946 0.107
NP_441396.1_1 Reverse -44 -63 -1.27885 0.27
NP_441396.1_5 Reverse -163 -172 8.65285 0.21
NP_441349.1_10 Reverse -371 -390 -9.83364 0.297
NP_442314.1_1 Reverse -346 -364 1.88744 0.231
NP_441107.1_10 Reverse -347 -361 12.4876 0.297
NP_440432.1_9 Reverse -134 -149 7.25639 0.0427
NP_440432.1_9 Forward -389 -374 -4.93665 0.228
NP_442843.1_1 Reverse -31 -50 -1.86883 0.202
NP_439960.1_10 Forward -358 -340 0.0191479 0.216
NP_442168.1_5 Forward -389 -370 -0.590531 0.264
NP_440588.1_2 Reverse -44 -63 -5.80207 0.262
NP_440588.1_3 Forward -159 -140 12.2908 0.248
NP_440195.1_5 Forward -286 -267 15.1424 0.13
NP_442006.1_2 Reverse -348 -365 -8.51595 0.197
NP_442006.1_2 Reverse -156 -173 -12.4492 0.197
NP_442006.1_2 Forward -360 -343 -14.9075 0.211
NP_441003.1_9 Forward -375 -356 7.07928 0.237
NP_441570.1_1 Reverse -342 -360 -12.8622 0.219
NP_441570.1_1 Forward -390 -372 -17.6804 0.287
NP_440078.1_4 Reverse -151 -170 11.0125 0.237
NP_441078.1_4 Forward -390 -381 0.196389 0.205
NP_441078.1_4 Forward -142 -133 0.196389 0.205
NP_441078.1_4 Reverse -381 -390 -0.000272808 0.205
NP_441078.1_4 Reverse -133 -142 -0.000272808 0.205
NP_441078.1_4 Reverse -271 -280 -1.6719 0.266
NP_441078.1_4 Forward -280 -271 -1.77023 0.266
NP_442729.1_5 Reverse -347 -357 14.0414 0.22
NP_442729.1_5 Reverse -356 -366 8.4365 0.248
NP_441663.1_8 Forward -229 -210 -2.95047 0.276
NP_440707.1_9 Reverse -163 -182 17.3057 0.0544
NP_442443.1_1 Reverse -223 -242 8.35759 0.124
NP_442443.1_1 Reverse -46 -65 -0.688862 0.226
NP_442443.1_1 Forward -141 -122 -1.37718 0.233
NP_442443.1_1 Reverse -166 -185 -5.40875 0.282
NP_442443.1_1 Forward -70 -51 -5.40875 0.282
NP_442443.1_1 Reverse -154 -173 -6.58872 0.295
NP_440526.1_3 Reverse -188 -199 14.5128 0.0646
NP_440526.1_3 Reverse -272 -283 8.71129 0.116
NP_440526.1_3 Forward -389 -378 6.54802 0.195
NP_440526.1_3 Reverse -12 -23 4.77807 0.267
NP_440526.1_3 Reverse -134 -145 1.3365 0.267
NP_441432.1_8 Forward -352 -343 11.3078 0.0569
NP_441432.1_8 Reverse -380 -389 7.17789 0.102
NP_441432.1_8 Reverse -270 -279 6.19458 0.118
NP_441432.1_8 Forward -143 -134 5.60459 0.147
NP_442320.1_8 Forward -396 -382 -5.01529 0.2
NP_441732.1_2 Forward -181 -165 -17.4444 0.258
NP_442343.1_1 Forward -366 -347 16.8141 0.271
NP_440497.1_6 Forward -356 -337 4.52268 0.227
NP_440759.1_3 Forward -366 -347 5.01433 0.188
NP_440760.1_1 Forward -135 -116 -22.3217 0.253
NP_440578.1_8 Reverse -33 -52 13.0775 0.238
NP_440913.1_1 Reverse -269 -287 11.9172 0.168
NP_443011.1_4 Forward -200 -181 5.89931 0.294
NP_442751.1_2 Reverse -341 -360 8.84842 0.206
NP_441072.1_2 Forward -153 -134 11.2092 0.188
NP_441072.1_2 Reverse -365 -384 6.68596 0.273
NP_440713.1_4 Forward -361 -342 3.04771 0.251
NP_440713.1_4 Reverse -261 -280 1.57275 0.284
NP_442489.1_2 Reverse -260 -279 7.47261 0.172
NP_442489.1_7 Forward -390 -381 0.884706 0.145
NP_442489.1_7 Forward -142 -133 0.688044 0.152
NP_442489.1_7 Reverse -133 -142 0.688044 0.152
NP_442489.1_7 Reverse -381 -390 0.491382 0.178
NP_442489.1_7 Forward -351 -342 -1.6719 0.235
NP_442489.1_7 Reverse -271 -280 -1.6719 0.235
NP_442489.1_7 Forward -280 -271 -1.77023 0.247
NP_440565.1_2 Reverse -136 -150 14.8371 0.292
NP_442079.1_7 Forward -389 -370 6.68596 0.155
NP_440559.1_1 Reverse -134 -143 7.66954 0.0999
NP_440559.1_1 Forward -389 -380 5.40793 0.14
NP_442763.1_10 Reverse -182 -201 1.86774 0.265
NP_441659.2_8 Reverse -342 -352 10.6981 0.022
NP_441659.2_8 Forward -390 -380 9.12481 0.0355
NP_441659.2_8 Reverse -133 -143 6.66654 0.0694
NP_441659.2_8 Reverse -271 -281 3.02829 0.177
NP_441659.2_8 Forward -223 -213 0.865012 0.256
NP_441040.1_5 Reverse -176 -195 5.211 0.237
NP_441800.1_7 Forward -179 -161 1.10079 0.21
NP_441800.1_10 Reverse -348 -367 0.982764 0.283
NP_440779.1_5 Reverse -271 -288 -14.7108 0.269
NP_442346.1_5 Reverse -380 -390 14.4347 0.0134
NP_442346.1_5 Reverse -270 -280 13.4514 0.0235
NP_442346.1_5 Forward -352 -342 6.27322 0.208
NP_442346.1_5 Forward -281 -271 5.28991 0.253
NP_442346.1_10 Forward -282 -263 -2.65548 0.294
NP_440545.1_3 Forward -284 -267 -3.5994 0.208
NP_440831.1_3 Forward -360 -341 11.0468 0.166
NP_440831.1_3 Reverse -140 -159 9.29946 0.202
NP_441923.1_6 Reverse -349 -363 11.406 0.25
NP_440459.1_2 Reverse -262 -279 10.6586 0.193
NP_440010.1_10 Forward -363 -344 8.45592 0.214
NP_440010.1_10 Forward -208 -189 2.85105 0.27
NP_440847.1_3 Reverse -189 -203 10.6187 0.287
NP_442603.1_7 Reverse -342 -356 9.93039 0.137
NP_441585.1_2 Reverse -277 -296 13.7658 0.289
NP_441948.1_4 Forward -149 -131 -2.93078 0.179
NP_441948.1_4 Forward -69 -51 -5.78238 0.278
NP_441833.1_4 Forward -389 -382 14.1004 0.0258
NP_441833.1_4 Reverse -134 -141 6.52896 0.0924
NP_441833.1_4 Forward -141 -134 6.23397 0.163
NP_441833.1_4 Reverse -382 -389 6.13563 0.198
NP_442162.1_8 Reverse -336 -355 -3.83545 0.291
NP_442162.1_9 Forward -141 -134 12.9205 0.0282
NP_442162.1_9 Reverse -134 -141 12.9205 0.0282
NP_442162.1_9 Forward -389 -382 6.62729 0.142
NP_442162.1_9 Reverse -382 -389 6.52896 0.178
NP_440671.1_4 Forward -321 -307 10.6193 0.154
NP_440671.1_4 Forward -357 -343 9.73436 0.172
NP_440671.1_4 Forward -148 -134 5.99778 0.266
NP_440671.1_4 Reverse -342 -356 5.21113 0.289
NP_442045.1_5 Forward -360 -341 1.37609 0.261
NP_442199.1_5 Forward -288 -269 -4.6221 0.229
NP_442140.1_3 Reverse -382 -392 14.4347 0.0486
NP_442140.1_3 Reverse -272 -282 9.7148 0.103
NP_442140.1_3 Reverse -134 -144 9.51814 0.107
NP_442140.1_3 Forward -350 -340 6.96153 0.156
NP_442140.1_3 Forward -141 -131 6.76487 0.159
NP_442140.1_3 Forward -279 -269 5.48657 0.207
NP_442140.1_3 Reverse -349 -359 5.19158 0.221
NP_441609.1_5 Reverse -230 -249 9.0459 0.279
NP_441671.1_4 Reverse -122 -141 13.2741 0.149
NP_440875.1_9 Forward -388 -378 17.5217 0.0116
NP_440875.1_9 Reverse -216 -226 12.5575 0.113
NP_440875.1_9 Forward -226 -216 10.8055 0.196
NP_440875.1_9 Reverse -135 -145 7.59334 0.255
NP_441813.1_5 Reverse -131 -141 16.303 0.01
NP_441813.1_5 Forward -144 -134 8.63316 0.0367
NP_441813.1_5 Forward -392 -382 -0.41329 0.242
NP_440590.1_4 Forward -141 -128 3.75586 0.0686
NP_440590.1_4 Forward -350 -337 -5.97891 0.296
NP_440590.1_4 Forward -279 -266 -6.07724 0.299
NP_440567.1_1 Forward -389 -375 0.491246 0.244
NP_440567.1_1 Reverse -98 -112 -0.492064 0.287
NP_442497.1_10 Reverse -134 -143 10.0295 0.0222
NP_442497.1_10 Forward -389 -380 7.86621 0.0695
NP_440821.1_4 Forward -144 -134 1.25834 0.139
NP_440821.1_4 Reverse -379 -389 0.963343 0.145
NP_441239.1_9 Reverse -131 -143 16.1653 0.0175
NP_441239.1_9 Reverse -340 -352 13.8053 0.0352
NP_441239.1_9 Forward -282 -270 7.21714 0.169
NP_441239.1_9 Forward -387 -375 5.25052 0.223
NP_441239.1_9 Forward -359 -347 5.05386 0.231
NP_441239.1_9 Reverse -379 -391 3.48056 0.285
NP_441951.1_4 Reverse -221 -240 0.884433 0.293
NP_441951.1_4 Forward -357 -338 0.786102 0.294
NP_442691.1_7 Reverse -331 -350 9.53674 0.286
NP_441727.1_3 Forward -287 -268 5.211 0.256
NP_440400.1_1 Forward -180 -161 1.27698 0.263
NP_441892.1_1 Forward -151 -134 -2.12444 0.218
NP_441892.1_1 Forward -289 -272 -5.07437 0.273
NP_440665.1_1 Forward -363 -344 -2.16383 0.177
NP_440665.1_1 Reverse -187 -206 -10.0303 0.244
NP_442044.1_1 Forward -111 -92 -10.0303 0.271
NP_442270.1_9 Reverse -260 -279 -7.67036 0.214
NP_442629.1_5 Reverse -44 -58 15.2409 0.279
NP_440949.1_7 Forward -365 -346 12.0933 0.214
NP_442138.1_10 Reverse -133 -152 -7.67036 0.29
NP_440546.1_4 Forward -142 -132 14.0213 0.0459
NP_440546.1_4 Forward -351 -341 13.9243 0.0459
NP_440546.1_4 Reverse -381 -391 11.5004 0.0806
NP_440546.1_4 Reverse -348 -358 9.07643 0.156
NP_440546.1_4 Reverse -133 -143 7.52511 0.235
NP_440546.1_4 Reverse -342 -352 6.55553 0.291
NP_440675.1_1 Reverse -210 -229 1.37609 0.292
NP_440462.1_6 Reverse -131 -141 13.353 0.0279
NP_440462.1_6 Reverse -379 -389 9.81313 0.0429
NP_440462.1_6 Reverse -340 -350 4.50326 0.197
NP_442340.1_3 Reverse -314 -333 -10.9153 0.295
NP_442340.1_3 Forward -278 -259 -11.1119 0.299
NP_440868.1_4 Reverse -377 -389 4.8572 0.109
NP_440868.1_4 Reverse -129 -141 2.59558 0.151
NP_441474.1_1 Forward -49 -30 -0.689632 0.255
NP_441474.1_1 Reverse -341 -360 -1.27961 0.261
NP_441474.1_1 Forward -55 -36 -1.67294 0.262
NP_442402.1_4 Reverse -245 -264 -4.1312 0.223
NP_441084.1_6 Reverse -379 -393 10.6046 0.234
NP_440696.1_3 Forward -361 -343 3.26407 0.21
NP_440696.1_3 Reverse -261 -279 -0.0791831 0.238
NP_442039.1_4 Forward -141 -134 11.6422 0.0747
NP_442039.1_7 Reverse -350 -360 9.81313 0.257
NP_441811.1_1 Reverse -124 -143 5.01433 0.28
NP_442837.1_3 Forward -389 -382 6.13563 0.25
NP_442837.1_3 Forward -141 -134 6.0373 0.25
NP_442837.1_3 Reverse -134 -141 6.0373 0.25
NP_442837.1_3 Reverse -382 -389 5.93897 0.265
NP_440160.1_3 Forward -177 -158 8.35677 0.284
NP_439994.1_1 Forward -196 -177 7.96426 0.271
NP_442053.1_1 Reverse -133 -142 14.4544 0.0114
NP_442053.1_1 Forward -142 -133 7.86621 0.0863
NP_440505.1_3 Reverse -379 -389 14.1397 0.0235
NP_440505.1_3 Forward -144 -134 8.04317 0.147
NP_440505.1_3 Forward -225 -215 5.78156 0.211
NP_440505.1_3 Forward -353 -343 5.68323 0.217
NP_440505.1_3 Forward -198 -188 5.48657 0.227
NP_441252.1_6 Reverse -178 -185 14.3954 0.168
NP_440914.1_1 Forward -390 -380 13.4947 0.0297
NP_441011.1_8 Forward -141 -132 11.7994 0.0629
NP_441011.1_8 Forward -350 -341 11.1111 0.0855
NP_441011.1_8 Reverse -382 -391 8.45619 0.144
NP_441011.1_8 Reverse -254 -263 7.57121 0.17
NP_441011.1_8 Forward -389 -380 6.8829 0.18
NP_442533.1_1 Reverse -162 -181 4.71934 0.0798
NP_442533.1_1 Reverse -36 -55 -5.11376 0.155
NP_442533.1_1 Forward -211 -192 -17.3068 0.285
NP_442533.1_6 Reverse -271 -280 7.17789 0.0948
NP_442533.1_6 Forward -280 -271 6.68623 0.105
NP_442533.1_6 Reverse -381 -390 5.3096 0.145
NP_442533.1_6 Reverse -342 -351 4.81794 0.172
NP_442533.1_6 Forward -351 -342 4.42462 0.179
NP_442533.1_6 Reverse -133 -142 4.42462 0.179
NP_442533.1_6 Forward -132 -123 4.32629 0.184
NP_442541.1_10 Forward -280 -266 14.7486 0.182
NP_442541.1_10 Forward -63 -49 1.76896 0.279
NP_442541.1_10 Reverse -271 -285 1.27731 0.287
NP_442322.1_4 Forward -65 -48 -1.7318 0.228
NP_442322.1_4 Forward -173 -156 -5.2717 0.266
NP_442322.1_4 Forward -172 -155 -8.41828 0.286
NP_442322.1_4 Forward -186 -169 -10.1882 0.298
NP_442229.1_1 Reverse -379 -393 10.9137 0.18
NP_443016.1_1 Forward -123 -104 -6.88371 0.265
NP_441482.1_7 Reverse -375 -389 -3.34366 0.118
NP_441482.1_7 Forward -148 -134 -12.3901 0.295
NP_439944.1_9 Forward -389 -379 8.04317 0.121
NP_439944.1_9 Reverse -272 -282 4.79825 0.296
NP_440116.1_8 Forward -141 -122 3.83436 0.0769
NP_440116.1_8 Forward -389 -370 -6.68705 0.215
NP_440115.1_6 Reverse -378 -388 16.9913 0.0288
NP_440115.1_6 Forward -145 -135 7.15819 0.158
NP_440007.1_9 Forward -355 -341 1.08123 0.29
NP_442728.1_5 Reverse -154 -173 21.2389 0.112
NP_440608.1_6 Reverse -343 -362 6.48849 0.238
NP_441972.1_5 Reverse -124 -143 -8.26035 0.26
NP_441106.1_1 Forward -391 -382 13.9627 0.0279
NP_441106.1_1 Reverse -380 -389 8.65285 0.0522
NP_440429.1_9 Reverse -53 -72 4.03102 0.254
NP_442306.1_10 Reverse -266 -285 -11.0136 0.114
NP_441286.1_1 Reverse -270 -282 -7.04085 0.3
NP_440670.1_8 Forward -142 -133 8.75118 0.0606
NP_440670.1_8 Forward -390 -381 6.98123 0.0882
NP_440670.1_8 Reverse -133 -142 6.19458 0.124
NP_440886.1_7 Reverse -132 -142 16.4991 0.0104
NP_440886.1_7 Forward -172 -162 14.6309 0.0467
NP_440886.1_7 Reverse -341 -351 7.45273 0.093
NP_440886.1_7 Forward -358 -348 5.19112 0.194
NP_440828.1_4 Reverse -186 -205 -5.80282 0.258
NP_442614.1_2 Forward -223 -209 11.111 0.213
NP_442614.1_2 Forward -135 -121 10.1277 0.234
NP_442614.1_2 Forward -142 -128 6.19444 0.291
NP_442072.1_9 Forward -143 -125 -23.0886 0.277
NP_442072.1_9 Forward -391 -373 -23.2853 0.288
NP_441753.1_10 Forward -271 -252 5.99764 0.186
NP_441753.1_10 Forward -366 -347 4.62101 0.196
NP_440907.2_8 Forward -389 -379 9.81266 0.103
NP_440907.2_8 Reverse -134 -144 8.14104 0.117
NP_440907.2_8 Reverse -254 -264 5.28945 0.209
NP_442264.1_2 Forward -206 -189 8.00365 0.223
NP_441021.1_1 Reverse -272 -291 -11.7019 0.272
NP_441463.1_3 Reverse -371 -390 -5.40875 0.226
NP_441626.1_2 Forward -141 -134 12.2322 0.0511
NP_441626.1_2 Forward -389 -382 6.0373 0.212
NP_441626.1_2 Reverse -382 -389 6.0373 0.212
NP_441626.1_2 Reverse -134 -141 5.93897 0.231
NP_442211.1_3 Forward -297 -278 7.56927 0.28
NP_441988.1_5 Forward -155 -136 12.3892 0.274
NP_442794.1_1 Forward -355 -343 7.4138 0.138
NP_442615.1_1 Reverse -372 -390 -2.83245 0.151
NP_442615.1_1 Forward -399 -381 -5.38906 0.212
NP_441962.1_4 Forward -111 -92 -6.49039 0.177
NP_441962.1_4 Reverse -266 -285 -12.9802 0.268
NP_441962.1_4 Forward -261 -242 -14.2585 0.285
NP_440387.1_1 Forward -390 -374 -4.56302 0.19
NP_441431.1_2 Reverse -378 -392 7.57046 0.238
NP_441431.1_2 Reverse -339 -353 5.80051 0.288
NP_441431.1_2 Reverse -130 -144 5.50552 0.298
NP_441431.1_3 Reverse -216 -235 5.70265 0.255
NP_441488.1_7 Reverse -120 -139 0.786102 0.296
NP_441836.1_1 Reverse -266 -285 12.8629 0.235
NP_441836.1_2 Reverse -336 -355 1.67108 0.19
NP_441836.1_2 Reverse -265 -284 -0.885524 0.215
NP_442224.1_1 Reverse -340 -359 1.57275 0.233
NP_442352.1_1 Forward -363 -350 15.0721 0.249
NP_442805.1_5 Forward -181 -162 -5.80282 0.277
NP_440114.1_10 Reverse -133 -147 13.0776 0.0662
NP_440114.1_10 Forward -142 -128 10.3243 0.148
NP_440114.1_10 Forward -351 -337 8.84938 0.192
NP_441510.2_7 Forward -357 -343 12.8803 0.28
NP_441510.2_7 Reverse -342 -356 9.93039 0.281
NP_440766.1_4 Forward -355 -341 11.6026 0.0645
NP_440766.1_4 Forward -146 -132 3.73617 0.143
NP_440766.1_4 Reverse -344 -358 2.06454 0.2
NP_440766.1_4 Reverse -377 -391 0.88457 0.263
NP_439988.1_3 Reverse -344 -358 5.01447 0.292
NP_441237.1_9 Forward -222 -212 11.6814 0.164
NP_442743.1_4 Reverse -40 -59 -4.91709 0.255
NP_442743.1_5 Forward -279 -260 4.03102 0.237
NP_439910.1_2 Forward -398 -381 -13.6292 0.162
NP_442867.1_8 Forward -278 -259 10.7175 0.206
NP_440457.1_1 Forward -146 -134 11.4454 0.092
NP_440457.1_1 Forward -355 -343 8.00379 0.101
NP_440457.1_1 Reverse -158 -170 5.25052 0.142
NP_440457.1_1 Reverse -377 -389 2.20226 0.216
NP_440457.1_1 Forward -319 -307 1.31728 0.241
NP_440942.1_8 Forward -153 -134 7.37428 0.277
NP_441984.1_3 Reverse -338 -356 7.19731 0.255
NP_441332.1_6 Forward -172 -162 11.7436 0.252
NP_441889.1_4 Forward -199 -180 3.04771 0.244
NP_440473.1_9 Forward -153 -134 -9.44032 0.26
NP_442509.1_9 Forward -142 -132 11.9759 0.107
NP_442509.1_9 Reverse -133 -143 10.8943 0.152
NP_440554.1_4 Forward -389 -379 5.87989 0.129
NP_440554.1_4 Reverse -134 -144 5.87989 0.129
NP_441885.1_5 Reverse -381 -391 0.668351 0.133
NP_441885.1_5 Forward -142 -132 0.0783647 0.183
NP_441885.1_5 Forward -351 -341 -1.78992 0.284
NP_440478.1_2 Forward -61 -42 4.32602 0.123
NP_440478.1_10 Forward -282 -268 7.86607 0.257
NP_442341.1_7 Reverse -341 -355 6.09611 0.135
NP_442341.1_9 Reverse -131 -145 4.62054 0.296
NP_441756.1_5 Reverse -192 -211 -4.03212 0.29
NP_442395.2_4 Forward -172 -153 1.27698 0.245
NP_440423.1_1 Forward -50 -31 37.2669 0.00000466
NP_440423.1_2 Forward -23 -4 32.0554 0.000145
NP_440423.1_3 Forward -207 -188 22.4189 0.0658
NP_440423.1_4 Forward -74 -55 30.4821 0.000109
NP_440423.1_5 Forward -125 -106 29.2038 0.000934
NP_440423.1_6 Forward -150 -131 35.7919 0.0000135
NP_440423.1_7 Forward -102 -83 33.9236 0.0000198
NP_440423.1_8 Forward -184 -165 29.7928 0.000456
NP_440423.1_10 Forward -358 -339 18.7807 0.117
NP_443000.1_7 Forward -144 -134 1.94665 0.226
NP_443000.1_7 Reverse -379 -389 0.963343 0.278
NP_442513.1_5 Forward -288 -269 11.11 0.266
NP_440275.1_3 Forward -144 -134 14.4347 0.0216
NP_440275.1_3 Reverse -379 -389 9.02648 0.0563
NP_440091.1_1 Forward -394 -382 11.1504 0.0429
NP_439962.1_4 Reverse -340 -359 -4.22878 0.269
NP_439962.1_4 Forward -359 -340 -6.78538 0.285
NP_440149.1_6 Forward -296 -277 6.88262 0.294
NP_440149.1_8 Reverse -24 -43 -7.86702 0.294
NP_442373.1_1 Forward -141 -122 -2.0655 0.183
NP_442373.1_2 Reverse -162 -181 -5.99873 0.227
NP_442373.1_2 Reverse -153 -172 -9.34199 0.26
NP_440216.1_1 Reverse -133 -147 4.03116 0.0279
NP_440216.1_1 Forward -142 -128 -1.96703 0.0431
NP_440216.1_1 Forward -390 -376 -12.5868 0.288
NP_440216.1_9 Reverse -273 -282 7.76787 0.286
NP_440216.1_9 Forward -278 -269 5.89959 0.289
NP_440172.1_1 Reverse -133 -143 3.51995 0.224
NP_442015.1_3 Forward -173 -154 12.585 0.255
NP_441226.1_7 Forward -141 -134 12.7234 0.0312
NP_441226.1_7 Reverse -134 -141 11.5435 0.0757
NP_441226.1_7 Reverse -343 -350 11.2485 0.0971
NP_441111.1_7 Forward -389 -381 8.96754 0.0463
NP_441111.1_7 Reverse -134 -142 8.86921 0.0589
NP_440244.1_1 Reverse -362 -381 7.37428 0.186
NP_441766.1_2 Reverse -133 -142 14.7494 0.00772
NP_441766.1_2 Reverse -381 -390 8.06287 0.0691
NP_442417.1_5 Forward -274 -260 8.65272 0.15
NP_442417.1_5 Reverse -342 -356 5.21113 0.271
NP_440416.1_9 Reverse -192 -211 -9.93197 0.135
NP_440416.1_9 Forward -358 -339 -11.8003 0.154
NP_440416.1_9 Forward -281 -262 -20.65 0.287
NP_443052.1_9 Forward -181 -162 -2.55715 0.239
NP_440072.1_5 Reverse -219 -237 -2.14413 0.269
NP_442154.1_1 Reverse -349 -367 -7.06068 0.141
NP_442154.1_1 Reverse -220 -238 -7.15901 0.141
NP_442154.1_1 Reverse -160 -178 -8.24065 0.158
NP_442154.1_1 Reverse -163 -181 -13.6489 0.217
NP_442154.1_1 Reverse -40 -58 -16.0088 0.229
NP_442154.1_1 Forward -350 -332 -16.6971 0.244
NP_442154.1_1 Reverse -31 -49 -18.2704 0.279
NP_442564.1_9 Reverse -271 -285 13.6387 0.275
NP_440261.1_5 Forward -279 -266 -8.14219 0.201
NP_440261.1_5 Forward -389 -376 -10.9938 0.23
NP_440261.1_5 Reverse -134 -147 -12.2721 0.277
NP_440988.1_10 Forward -282 -268 11.7725 0.187
NP_440988.1_10 Reverse -346 -360 8.67452 0.205
NP_440988.1_10 Reverse -191 -205 7.60958 0.216
NP_440988.1_10 Reverse -269 -283 4.80201 0.25
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGTAAAATCAACGATCGCCTCGCTTATGCCTTCCAACATGGCCCCCATGGCGATGGGTGCTAAGCGGGTTTCGGTGTAACGCATGGCGGCCGGAGGATCATTGTCCACGGAACCGAAGTTGCCATGGCCAGCCAGGAGGGGATAACGACTGGAAAAATCCTGCACCATCCGCACCAGGGCATCGTACACAGACTGGTCACCGTGGGGATGGTATTTGCCCAACACGTCCCCCACCACCCGGGCACATTTCCGAAACGGGCGATCGGGGGTCAGCCCCAACTCGTACATGGCGTAGAGAATGCGACGATGCACCGGTTTTAGACCGTCCCGCACATCGGGTAATGCCCGCCCCACAATCACACTCATGGCATATTCCAGGTAGGAACGTTCCATTTCTTC

CDS

GTGGAGATCGGTGGGGATAATTTGACCGCTGGGGAAAGATTTTCTGGCCATGCCGCTGGGAACCTGTGCGCTCGTCAATTCGCGGCCAATGTTAGCATTGGAAAGGCTGATTCTCCTCCCCACTTTGCCGGGTACAGTTTTATGACAACGGTTCTCATCGTCGAAGACGACCCCATGAACTTCCGGGTTTTTTCCAAAATTCTCACTAAGCGGGGGGGCTTCACCGTCAAGGGCAGCGAGGATGTGGCGGAGGTGTTGGCCTTAGCTCGGAGCAAGGCGGTGGACGTGATTTTGATCGATGTGTCTCTGTCCCGCAGTCATTACCAAGGTAAGGCCTATAACGGCATTCAAATTACCCAACTGCTCAAACAAGACCCTGCCACGGCCAGCCTACCAGTGATTTTGGTCACAGCCCATGCCATGGTCGGCGATCGGGAGTCTTTATTGGCCCAAAGTGGCGCAGAAGGCTACATAGCTAAACCGGTGGTGGACCACCAAGCTTTTGTAAACCAAATTCAAACCATGGCTGGAGGCGATCGGGCGGTTTAA

Protein

MEIGGDNLTAGERFSGHAAGNLCARQFAANVSIGKADSPPHFAGYSFMTTVLIVEDDPMNFRVFSKILTKRGGFTVKGSEDVAEVLALARSKAVDVILIDVSLSRSHYQGKAYNGIQITQLLKQDPATASLPVILVTAHAMVGDRESLLAQSGAEGYIAKPVVDHQAFVNQIQTMAGGDRAV