Your browser is old and dusty. Try Google Chrome!

Details for slr2033

ORF slr2033
Accession NP_440410.1
Symbol rubA
Category membrane-associated rubredoxin, essential for photosystem I assembly
Definition Fatty acid, phospholipid and sterol metabolism
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -350 -364 13.7659 0.166
NP_442100.1_1 Forward -54 -35 8.06865 0.24
NP_442291.1_5 Reverse -211 -227 -4.85801 0.287
NP_441453.1_4 Reverse -212 -220 3.85433 0.284
NP_441453.1_7 Forward -267 -260 12.1338 0.295
NP_442151.1_10 Reverse -356 -374 12.4089 0.289
NP_440561.1_5 Forward -241 -222 10.9142 0.278
NP_441818.1_9 Reverse -361 -380 3.44104 0.18
NP_441818.1_9 Reverse -362 -381 -10.4236 0.293
NP_442287.1_1 Forward -149 -139 14.6309 0.256
NP_442173.1_6 Reverse -132 -146 12.0943 0.19
NP_440074.1_6 Reverse -192 -211 9.93006 0.27
NP_439979.1_9 Reverse -377 -395 13.1955 0.227
NP_441499.1_8 Forward -368 -349 12.1925 0.161
NP_442062.1_3 Reverse -34 -53 -0.000545616 0.242
NP_441995.1_6 Reverse -377 -396 15.3391 0.286
NP_442762.1_10 Forward -361 -342 -12.3902 0.284
NP_439918.1_2 Reverse -362 -381 -1.37718 0.24
NP_441210.1_5 Reverse -248 -267 16.4207 0.286
NP_441200.1_4 Reverse -357 -376 5.80098 0.294
NP_441208.1_9 Forward -332 -318 11.3077 0.156
NP_442742.1_9 Forward -32 -13 -12.0953 0.269
NP_440132.1_1 Reverse -374 -392 9.45892 0.236
NP_442110.1_7 Reverse -81 -95 6.98109 0.128
NP_442110.1_7 Reverse -361 -375 5.40779 0.173
NP_441925.1_4 Forward -369 -350 -13.8659 0.259
NP_440856.1_4 Reverse -98 -117 -1.96717 0.205
NP_441083.1_3 Reverse -387 -397 12.7626 0.248
NP_442827.1_8 Forward -267 -248 -2.06626 0.267
NP_441738.1_2 Forward -252 -245 6.03696 0.295
NP_442765.1_4 Forward -89 -70 13.5691 0.244
NP_440410.1_1 Forward -59 -40 23.1463 0.0214
NP_440447.1_5 Reverse -75 -85 12.9597 0.291
NP_442570.1_3 Reverse -365 -384 -1.86883 0.212
NP_441716.1_2 Forward -53 -34 16.3714 0.122
NP_441387.1_8 Forward -44 -25 15.135 0.196
NP_440343.1_9 Reverse -363 -382 7.17762 0.29
NP_440438.2_8 Reverse -34 -53 3.83436 0.241
NP_440747.1_10 Forward -362 -350 -11.9574 0.178
NP_440747.1_10 Reverse -385 -397 -12.0557 0.199
NP_441486.1_1 Forward -224 -210 -4.62196 0.204
NP_440470.1_5 Reverse -25 -44 6.2543 0.28
NP_440403.1_4 Reverse -341 -360 -4.42544 0.212
NP_443018.1_3 Forward -95 -88 5.34899 0.212
NP_443018.1_3 Forward -220 -213 4.26735 0.267
NP_443018.1_3 Reverse -213 -220 4.07068 0.299
NP_440376.1_1 Reverse -139 -148 1.76968 0.242
NP_441588.1_4 Forward -219 -209 15.6147 0.0404
NP_442730.1_8 Reverse -67 -86 2.9486 0.276
NP_442687.1_7 Forward -398 -388 13.1564 0.0574
NP_442485.1_3 Reverse -351 -370 -6.09707 0.299
NP_441846.1_10 Reverse -362 -381 -4.42544 0.165
NP_440642.1_10 Reverse -74 -88 2.45727 0.277
NP_441013.1_2 Forward -377 -359 9.26226 0.195
NP_441013.1_3 Reverse -361 -380 6.19431 0.281
NP_441080.1_7 Forward -43 -25 7.3932 0.238
NP_441422.1_7 Forward -364 -347 -4.48438 0.245
NP_441950.1_8 Forward -347 -333 15.2409 0.0987
NP_440617.1_6 Reverse -368 -387 11.6025 0.197
NP_442496.1_5 Forward -85 -67 15.7521 0.139
NP_440184.1_1 Forward -60 -41 11.6809 0.0971
NP_440607.1_8 Reverse -365 -384 8.55425 0.153
NP_440607.1_8 Reverse -371 -390 0.392778 0.28
NP_442653.1_1 Reverse -42 -61 -0.39387 0.29
NP_441127.1_1 Forward -352 -338 8.06273 0.3
NP_442836.1_5 Forward -352 -333 1.57275 0.28
NP_439905.1_1 Forward -351 -338 9.45906 0.219
NP_441338.2_9 Forward -332 -313 9.83255 0.2
NP_442690.1_1 Reverse -35 -54 9.83255 0.0437
NP_442911.1_2 Forward -100 -81 -4.13045 0.126
NP_440153.1_5 Reverse -338 -352 0.687908 0.291
NP_442536.1_4 Reverse -293 -311 5.82068 0.3
NP_443055.1_6 Reverse -245 -263 12.6047 0.109
NP_441129.1_6 Forward -367 -348 -2.95047 0.275
NP_442002.1_1 Reverse -365 -383 -8.24065 0.263
NP_441294.1_2 Reverse -334 -353 3.14605 0.274
NP_442438.1_10 Reverse -345 -359 13.3726 0.0352
NP_440377.1_1 Reverse -194 -211 12.4333 0.26
NP_440147.1_4 Reverse -210 -223 3.16588 0.193
NP_441041.1_4 Forward -349 -330 -12.9802 0.278
NP_440569.1_6 Forward -250 -231 3.24438 0.253
NP_440569.1_10 Forward -316 -297 5.39487 0.24
NP_442996.1_1 Forward -45 -26 8.6416 0.21
NP_442281.1_1 Reverse -249 -263 3.53891 0.228
NP_441079.1_7 Forward -66 -47 1.6703 0.177
NP_440437.1_1 Reverse -341 -360 -2.55715 0.219
NP_440437.1_1 Forward -365 -346 -5.50708 0.286
NP_442500.1_8 Reverse -321 -335 9.98557 0.272
NP_440723.1_8 Reverse -340 -354 11.701 0.215
NP_440375.1_8 Forward -220 -201 4.52268 0.193
NP_441644.1_6 Reverse -350 -360 8.82935 0.0917
NP_442933.1_10 Forward -221 -212 4.81794 0.212
NP_442933.1_10 Reverse -212 -221 4.12963 0.28
NP_442142.1_4 Forward -224 -211 2.772 0.278
NP_440045.1_3 Forward -38 -21 7.51126 0.258
NP_443009.1_5 Forward -360 -349 3.49977 0.292
NP_441865.1_3 Forward -66 -48 13.9821 0.242
NP_442301.1_2 Forward -392 -373 4.91521 0.27
NP_441088.1_1 Forward -362 -343 6.19431 0.243
NP_441448.1_1 Forward -351 -332 8.25926 0.208
NP_441468.1_1 Forward -220 -213 4.07068 0.263
NP_441020.2_6 Reverse -374 -391 6.92201 0.249
NP_441015.1_10 Reverse -348 -367 -3.63879 0.19
NP_441015.1_10 Reverse -377 -396 -8.16202 0.272
NP_441015.1_10 Forward -89 -70 -10.817 0.288
NP_441673.1_1 Reverse -388 -397 -8.06341 0.254
NP_441096.1_5 Reverse -63 -81 13.3914 0.297
NP_441876.1_9 Forward -28 -18 11.5826 0.275
NP_441876.1_9 Reverse -220 -230 10.3043 0.295
NP_441764.1_4 Reverse -42 -59 10.9366 0.232
NP_441764.1_4 Forward -53 -36 10.6501 0.248
NP_442719.1_2 Forward -32 -14 -9.12632 0.259
NP_442719.1_2 Reverse -187 -205 -10.6996 0.28
NP_442719.1_2 Forward -327 -309 -10.9946 0.286
NP_441251.1_7 Forward -208 -195 10.934 0.277
NP_441612.1_2 Reverse -317 -327 8.74291 0.21
NP_442227.1_2 Reverse -64 -83 -2.55715 0.276
NP_442227.1_2 Reverse -77 -96 -3.3438 0.29
NP_442361.1_3 Forward -96 -83 9.36073 0.276
NP_442808.1_1 Reverse -307 -317 1.25791 0.289
NP_442542.1_2 Reverse -386 -399 5.03416 0.288
NP_442113.1_10 Forward -305 -286 -2.95047 0.214
NP_442050.1_1 Reverse -369 -388 10.9142 0.233
NP_441114.1_1 Forward -187 -169 13.7847 0.279
NP_441878.1_6 Forward -398 -388 -0.118297 0.167
NP_441878.1_6 Reverse -387 -397 -7.19813 0.21
NP_441590.1_4 Forward -370 -351 8.16011 0.249
NP_442777.1_1 Reverse -225 -244 8.16011 0.229
NP_441914.1_5 Reverse -129 -148 16.9124 0.16
NP_442166.1_3 Reverse -20 -39 -4.72043 0.264
NP_439980.1_2 Reverse -344 -363 14.4541 0.207
NP_440136.1_1 Forward -336 -320 14.3158 0.238
NP_441728.2_4 Forward -54 -35 12.4613 0.273
NP_442998.1_5 Reverse -22 -32 13.7464 0.157
NP_440899.1_1 Reverse -351 -370 8.8954 0.23
NP_440299.1_1 Reverse -208 -221 4.64028 0.205
NP_442334.1_2 Forward -235 -218 -14.0225 0.297
NP_440256.1_1 Forward -362 -343 -5.70374 0.189
NP_440709.1_1 Forward -53 -34 -0.492971 0.295
NP_442283.1_2 Reverse -335 -354 8.55425 0.267
NP_441559.1_8 Reverse -304 -318 -4.91696 0.241
NP_441559.1_8 Reverse -134 -148 -6.29359 0.276
NP_440915.1_6 Reverse -346 -360 -2.85201 0.284
NP_442866.1_1 Forward -274 -255 -5.40875 0.24
NP_441464.1_10 Forward -236 -222 11.0127 0.235
NP_440787.1_5 Forward -122 -108 18.0925 0.112
NP_440695.1_6 Reverse -298 -312 12.7383 0.26
NP_442386.1_10 Reverse -361 -374 3.85419 0.266
NP_441340.1_5 Reverse -213 -220 3.97235 0.274
NP_439976.1_4 Forward -394 -375 5.80018 0.278
NP_442714.1_7 Reverse -140 -159 -1.47551 0.288
NP_441027.1_3 Reverse -318 -337 14.5942 0.289
NP_440586.1_8 Reverse -213 -220 9.57686 0.146
NP_442959.1_5 Forward -214 -195 11.1109 0.224
NP_442959.1_5 Reverse -298 -317 5.50599 0.28
NP_442959.1_7 Forward -383 -364 -5.21209 0.299
NP_440027.1_3 Forward -382 -364 16.6363 0.0899
NP_440027.1_3 Reverse -340 -358 4.04996 0.262
NP_439996.1_4 Reverse -133 -152 12.9791 0.165
NP_439937.1_9 Forward -320 -303 -15.1047 0.287
NP_442239.1_8 Reverse -363 -382 5.11266 0.285
NP_439943.1_4 Reverse -355 -374 4.03102 0.287
NP_441789.1_7 Forward -380 -361 5.60352 0.193
NP_440819.1_5 Reverse -317 -325 7.68924 0.266
NP_439977.1_5 Reverse -75 -94 -2.26216 0.273
NP_441018.1_7 Reverse -378 -397 6.4893 0.286
NP_442262.1_10 Forward -95 -88 7.6106 0.274
NP_442917.1_2 Reverse -361 -380 10.9142 0.136
NP_442750.1_3 Forward -335 -316 -4.03212 0.204
NP_440297.1_9 Reverse -389 -399 -0.41329 0.283
NP_440999.1_9 Forward -142 -128 -2.55701 0.27
NP_440888.1_2 Forward -359 -345 6.39049 0.236
NP_440600.1_9 Reverse -39 -58 10.074 0.297
NP_441178.1_6 Forward -380 -361 1.96529 0.276
NP_442710.1_7 Forward -44 -25 0.273821 0.192
NP_441469.1_4 Reverse -347 -366 7.47261 0.282
NP_443064.1_8 Forward -350 -340 14.8275 0.29
NP_442204.1_1 Forward -363 -352 0.550326 0.281
NP_442204.1_5 Forward -359 -340 0.196116 0.27
NP_441351.1_8 Reverse -348 -367 1.37609 0.276
NP_441033.1_5 Forward -301 -282 17.4032 0.257
NP_440128.1_2 Forward -262 -243 19.764 0.0612
NP_442428.1_5 Forward -220 -213 4.46401 0.267
NP_440818.1_6 Reverse -336 -355 5.40766 0.294
NP_441867.1_2 Forward -87 -68 -2.16383 0.153
NP_440673.1_2 Reverse -340 -359 10.9749 0.19
NP_441052.1_2 Reverse -232 -242 -0.609952 0.288
NP_440436.1_4 Reverse -213 -222 9.73406 0.0871
NP_442705.1_1 Forward -247 -228 10.1275 0.267
NP_441004.1_1 Reverse -364 -383 -7.67036 0.199
NP_441004.1_1 Reverse -376 -395 -13.5702 0.259
NP_441004.1_1 Forward -84 -65 -15.9302 0.279
NP_441004.1_1 Forward -83 -64 -17.5035 0.292
NP_441004.1_2 Forward -89 -70 -3.04881 0.271
NP_442873.1_2 Reverse -336 -355 8.84842 0.28
NP_440296.1_6 Reverse -26 -44 10.6971 0.295
NP_440508.1_2 Reverse -27 -46 13.9661 0.236
NP_441851.1_10 Reverse -92 -102 8.23984 0.12
NP_441683.1_7 Forward -90 -71 -12.1936 0.284
NP_441982.1_6 Reverse -43 -52 12.4854 0.275
NP_442709.1_4 Reverse -25 -44 6.62992 0.183
NP_442689.1_8 Reverse -39 -56 4.16874 0.162
NP_442843.1_1 Forward -262 -243 -3.93378 0.23
NP_439960.1_10 Forward -366 -348 -1.16082 0.242
NP_440726.1_2 Forward -369 -350 29.5971 0.000594
NP_440726.1_9 Forward -396 -377 10.9134 0.144
NP_440726.1_10 Forward -330 -311 16.8141 0.125
NP_441477.1_10 Forward -350 -332 -0.275845 0.291
NP_441124.1_5 Reverse -44 -54 11.1938 0.259
NP_440588.1_2 Forward -368 -349 -4.91709 0.233
NP_441570.1_1 Forward -359 -341 -11.7806 0.203
NP_440078.1_10 Forward -349 -330 1.96607 0.286
NP_441078.1_4 Reverse -388 -397 -1.77023 0.266
NP_442480.1_3 Forward -65 -46 15.326 0.23
NP_442157.1_3 Forward -391 -372 19.7631 0.225
NP_441805.1_2 Reverse -323 -342 -5.01543 0.294
NP_442353.1_4 Reverse -341 -360 1.47364 0.243
NP_442353.1_4 Reverse -213 -232 -0.787962 0.291
NP_442968.1_8 Reverse -358 -377 15.0441 0.145
NP_441072.1_2 Forward -232 -213 12.4875 0.173
NP_442489.1_7 Reverse -388 -397 -1.08191 0.179
NP_440386.1_3 Forward -203 -184 -5.11376 0.241
NP_440559.1_1 Forward -220 -211 4.52295 0.26
NP_441659.2_8 Forward -397 -387 9.81313 0.0269
NP_441659.2_8 Reverse -212 -222 0.865012 0.256
NP_441800.1_3 Reverse -377 -395 3.06741 0.298
NP_442346.1_5 Forward -398 -388 11.5831 0.0634
NP_442346.1_5 Reverse -211 -221 11.4848 0.0663
NP_440352.1_5 Reverse -13 -32 9.73562 0.289
NP_441856.1_3 Forward -346 -327 -0.4922 0.223
NP_442603.1_7 Reverse -287 -301 8.84875 0.162
NP_439970.1_3 Reverse -213 -232 14.7491 0.065
NP_441329.1_1 Reverse -32 -51 6.15881 0.265
NP_441895.1_2 Forward -96 -77 -26.8449 0.256
NP_441895.1_10 Forward -93 -74 -27.8282 0.299
NP_441044.1_9 Forward -71 -52 7.86593 0.0901
NP_441915.1_4 Reverse -339 -358 12.4867 0.229
NP_442140.1_3 Forward -351 -341 5.19158 0.221
NP_442140.1_3 Reverse -213 -223 4.69992 0.238
NP_440590.1_4 Forward -358 -345 0.0192843 0.173
NP_441951.1_4 Forward -362 -343 3.04771 0.279
NP_440156.1_4 Forward -33 -23 14.8275 0.176
NP_440400.1_1 Forward -380 -361 -2.06626 0.285
NP_441541.1_1 Reverse -33 -51 8.59626 0.116
NP_440833.1_6 Reverse -223 -237 6.78381 0.296
NP_441617.1_6 Forward -32 -13 -6.98204 0.29
NP_440546.1_4 Reverse -212 -222 8.78555 0.171
NP_440546.1_4 Reverse -362 -372 6.55553 0.291
NP_440546.1_7 Forward -352 -342 14.533 0.279
NP_441249.1_8 Reverse -362 -381 11.0125 0.173
NP_441474.1_1 Forward -369 -350 4.81688 0.218
NP_441474.1_1 Forward -380 -361 2.16195 0.247
NP_442402.1_1 Reverse -63 -82 9.14423 0.271
NP_442402.1_2 Reverse -68 -82 14.2569 0.263
NP_442402.1_4 Reverse -210 -229 5.60352 0.144
NP_442402.1_4 Forward -39 -20 -0.984623 0.189
NP_442402.1_4 Reverse -110 -129 -1.18128 0.189
NP_442402.1_4 Reverse -63 -82 -1.37794 0.189
NP_442402.1_4 Reverse -98 -117 -6.98278 0.268
NP_442402.1_6 Forward -83 -74 14.1594 0.241
NP_440036.1_10 Reverse -367 -379 12.4287 0.284
NP_441848.1_4 Reverse -186 -202 12.8027 0.195
NP_440653.1_10 Reverse -82 -101 4.52268 0.25
NP_441053.1_3 Reverse -162 -181 3.93269 0.178
NP_440160.1_2 Forward -377 -358 -2.55715 0.245
NP_442533.1_1 Reverse -373 -392 -14.6519 0.247
NP_442533.1_1 Reverse -364 -383 -15.5368 0.256
NP_442533.1_6 Reverse -388 -397 4.0313 0.194
NP_442533.1_6 Reverse -350 -359 2.16301 0.27
NP_442322.1_4 Forward -379 -362 9.87119 0.141
NP_442322.1_9 Reverse -151 -169 11.6214 0.251
NP_442269.1_10 Reverse -351 -370 5.211 0.238
NP_441697.1_5 Forward -66 -47 -5.10924 0.224
NP_440816.1_2 Forward -217 -198 11.1788 0.202
NP_441028.1_6 Forward -29 -19 15.2208 0.152
NP_441028.1_6 Reverse -72 -82 12.6642 0.183
NP_442664.1_8 Reverse -71 -90 8.84842 0.283
NP_440116.1_4 Reverse -131 -150 9.3409 0.251
NP_441106.1_1 Forward -360 -351 2.55633 0.28
NP_441106.1_1 Forward -222 -213 2.26134 0.293
NP_439903.1_5 Forward -61 -42 13.6959 0.223
NP_441186.1_4 Forward -49 -39 15.0242 0.274
NP_441286.1_1 Reverse -387 -399 -4.9759 0.183
NP_442463.1_10 Forward -326 -308 14.1788 0.279
NP_441930.1_2 Reverse -246 -256 12.3697 0.262
NP_440886.1_7 Reverse -349 -359 3.8145 0.265
NP_440268.1_8 Reverse -289 -308 11.4058 0.291
NP_440828.1_1 Forward -380 -361 2.45694 0.231
NP_440513.1_8 Forward -226 -207 17.6846 0.205
NP_440028.1_6 Forward -95 -77 10.7372 0.277
NP_442963.1_6 Reverse -335 -354 16.0762 0.266
NP_440907.2_9 Forward -37 -18 3.34192 0.244
NP_441021.1_1 Reverse -213 -232 -9.44032 0.216
NP_440107.1_5 Forward -369 -350 -2.16383 0.178
NP_442794.1_1 Forward -94 -82 5.15219 0.231
NP_442647.1_7 Reverse -255 -268 6.60746 0.257
NP_440492.1_9 Forward -283 -269 12.9639 0.294
NP_440293.1_3 Reverse -355 -374 -4.72043 0.264
NP_442867.1_8 Forward -275 -256 5.70265 0.276
NP_442867.1_8 Forward -370 -351 4.03102 0.293
NP_441984.1_6 Forward -173 -161 13.707 0.27
NP_441332.1_6 Forward -142 -132 11.7436 0.252
NP_442509.1_9 Forward -359 -349 7.25606 0.229
NP_442509.1_9 Forward -103 -93 6.27276 0.279
NP_442784.1_9 Forward -358 -339 22.3206 0.0407
NP_441765.1_7 Forward -114 -95 9.53756 0.254
NP_441159.1_4 Forward -232 -213 -2.36049 0.297
NP_442862.1_3 Forward -328 -311 6.03703 0.267
NP_441756.1_5 Reverse -346 -365 4.42435 0.199
NP_441173.1_9 Reverse -73 -81 13.1954 0.184
NP_441173.1_9 Reverse -162 -170 12.0154 0.214
NP_441173.1_9 Forward -179 -171 11.7204 0.226
NP_441173.1_9 Forward -50 -42 10.6388 0.261
NP_442395.2_4 Reverse -349 -368 6.1935 0.151
NP_440409.1_8 Reverse -165 -184 19.174 0.294
NP_440409.1_10 Reverse -122 -141 27.9255 0.00115
NP_440750.1_5 Reverse -185 -199 16.6175 0.0569
NP_440552.1_8 Forward -59 -42 10.0788 0.281
NP_440275.1_3 Forward -361 -351 2.43831 0.268
NP_442932.1_9 Reverse -179 -198 6.19431 0.249
NP_440091.1_1 Forward -225 -213 1.41561 0.197
NP_440149.1_8 Forward -362 -343 -3.73712 0.196
NP_441105.1_3 Forward -232 -213 -4.13045 0.192
NP_440216.1_1 Reverse -350 -364 -11.8985 0.228
NP_442015.1_10 Forward -353 -340 4.73917 0.162
NP_441226.1_7 Forward -375 -368 5.34865 0.289
NP_440416.1_9 Forward -97 -78 -0.885524 0.0621
NP_440416.1_9 Forward -383 -364 -15.7335 0.198
NP_443052.1_8 Reverse -340 -359 -13.1769 0.276
NP_443052.1_9 Forward -383 -364 1.76941 0.181
NP_443052.1_9 Forward -392 -373 -0.39387 0.209
NP_443052.1_9 Forward -395 -376 -4.22878 0.255
NP_443052.1_9 Forward -374 -355 -5.01543 0.265
NP_442116.1_6 Forward -211 -194 9.12387 0.235
NP_442116.1_6 Forward -55 -38 7.69149 0.254
NP_442154.1_1 Reverse -374 -392 -3.6191 0.125
NP_442154.1_1 Reverse -365 -383 -7.65067 0.146
NP_440988.1_10 Forward -98 -84 4.02751 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAGGGCCACCGTCAGTTCCACCACTCCCAACCCAGGCCCCAGATGACCGCCGCTGGTGGCCACAGTTTGGAGATGTTTTTCTCGGATTTGCCGGGAAACTTCCTCCAGCTCACGGATAGATAAACCCTTTAACTCATTGGGGTGGGTCAGTTCGCTGATGTGCATGGTGGATTGGGACTAACGATGGCTAAATTATGGAACTTTTTTCAGACTTCTCACACTTTAACCCATTGGGTGAAGGGAAGTTAGGTTGGAAAACCCCAGTCACAGTCTGGACAAAACATTCGGTGAACCAATGATGAATCCCCATTGAGAAGGCTGGGGAAAAGGGTAGCGAAGATGTCATAATTTTTAACAAAGATTACTAAAGATTTACCCCCAGTTCTCTGCTGTAGTAGCC

CDS

ATGAGTGAGCGTCCCCCTGAAAAGACCCTGGCGGAGTTGGCATCCCCAAACCATGAATGCCGGGCCTGCGGTTATGTTTACATTCCCAGCCAAGGGGATCAAAAGACTAGTGTTTCCCCCGGCACTCCCTTTGAGGCCCTACCCCTTAATTGGAAATGTCCGGTGTGTGGCGCCCCCCGCAACTACTTCATCAGCACCGGGGAGACCGATGCTCCCTCTGGTTTTGCCGAGAACCTTAACTACGGTTTTGGTTTTAACCGTATGAGTGGTGGTAAAAAGAATTTACTAATTTTCGGTAGTCTTTTCGTCATTTTCCTATTTTTCCTGAGCCTTTACGGCATGGGATAA

Protein

MSERPPEKTLAELASPNHECRACGYVYIPSQGDQKTSVSPGTPFEALPLNWKCPVCGAPRNYFISTGETDAPSGFAENLNYGFGFNRMSGGKKNLLIFGSLFVIFLFFLSLYGMG