Your browser is old and dusty. Try Google Chrome!

Details for slr2032

ORF slr2032
Accession NP_440408.1
Symbol ycf23
Category hypothetical protein YCF23
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -369 -355 10.3243 0.287
NP_441061.1_1 Reverse -172 -190 16.5746 0.264
NP_441418.1_6 Forward -218 -199 -13.0786 0.073
NP_441418.1_6 Reverse -300 -319 -21.0434 0.136
NP_441418.1_6 Reverse -162 -181 -23.1083 0.191
NP_443032.1_8 Reverse -273 -292 1.37609 0.238
NP_442291.1_5 Forward -310 -294 -0.728113 0.189
NP_441453.1_4 Forward -309 -301 6.70593 0.121
NP_440150.1_2 Forward -176 -157 9.63507 0.217
NP_440996.1_4 Reverse -145 -155 15.418 0.27
NP_442173.1_1 Reverse -301 -309 5.82095 0.2
NP_442173.1_6 Forward -45 -31 9.2427 0.297
NP_442752.1_4 Forward -309 -302 13.8055 0.0199
NP_442752.1_4 Forward -218 -211 4.26735 0.293
NP_443027.1_4 Forward -220 -210 8.4365 0.202
NP_443027.1_4 Forward -311 -301 8.04317 0.219
NP_441812.1_1 Forward -163 -149 13.1753 0.236
NP_442975.1_10 Reverse -205 -219 8.45543 0.0964
NP_440784.1_7 Reverse -301 -308 6.23397 0.241
NP_440784.1_7 Forward -308 -301 6.13563 0.241
NP_441054.1_3 Forward -323 -305 17.0928 0.16
NP_442062.1_8 Forward -309 -299 9.22315 0.0658
NP_442062.1_8 Reverse -162 -172 3.22496 0.279
NP_442062.1_8 Forward -209 -199 2.7333 0.297
NP_440761.1_4 Reverse -195 -214 -12.7836 0.257
NP_441859.1_3 Forward -219 -200 10.7167 0.118
NP_440304.1_4 Forward -173 -163 3.22496 0.299
NP_442242.1_4 Forward -308 -301 12.4288 0.0393
NP_441210.1_8 Forward -58 -39 15.0441 0.1
NP_441082.1_10 Forward -52 -39 8.08242 0.289
NP_441925.1_2 Reverse -144 -163 4.22769 0.262
NP_441925.1_4 Reverse -349 -368 -15.2425 0.263
NP_442827.1_4 Forward -182 -163 9.7334 0.203
NP_441738.1_2 Reverse -302 -309 15.28 0.0102
NP_441738.1_2 Forward -330 -323 6.72528 0.236
NP_440209.1_1 Forward -309 -301 14.8674 0.012
NP_440209.1_1 Reverse -209 -217 2.08437 0.286
NP_442889.1_1 Reverse -156 -175 -2.26216 0.145
NP_440178.1_7 Reverse -163 -182 -2.55715 0.038
NP_442570.1_3 Reverse -173 -192 -2.26216 0.212
NP_441792.1_5 Forward -195 -179 18.5448 0.122
NP_441716.1_1 Forward -205 -191 2.75286 0.294
NP_442111.1_4 Forward -219 -205 2.65453 0.268
NP_442111.1_4 Reverse -299 -313 2.35953 0.28
NP_441624.1_7 Forward -230 -216 8.55439 0.238
NP_440906.1_5 Forward -308 -301 12.0355 0.0724
NP_440906.1_5 Reverse -301 -308 12.0355 0.0724
NP_440747.1_10 Reverse -159 -171 -2.4193 0.0434
NP_440747.1_10 Reverse -297 -309 -2.51763 0.0509
NP_440747.1_10 Forward -312 -300 -12.3507 0.27
NP_440747.1_10 Reverse -172 -184 -12.3507 0.27
NP_441130.1_10 Forward -311 -297 9.73436 0.12
NP_441130.1_10 Reverse -207 -221 6.3911 0.19
NP_440403.1_4 Forward -183 -164 1.96607 0.13
NP_442848.1_9 Forward -189 -170 5.211 0.202
NP_442848.1_9 Forward -224 -205 2.26107 0.252
NP_441012.1_4 Forward -137 -124 14.3756 0.202
NP_441012.1_4 Forward -181 -168 9.45906 0.272
NP_441012.1_4 Reverse -256 -269 9.2624 0.272
NP_443018.1_3 Forward -308 -301 5.34899 0.212
NP_443018.1_3 Reverse -301 -308 5.34899 0.212
NP_441634.1_8 Forward -220 -206 3.44117 0.152
NP_440376.1_1 Reverse -162 -171 4.22796 0.166
NP_440376.1_1 Forward -129 -120 3.53964 0.2
NP_440376.1_1 Forward -309 -300 -0.000272808 0.285
NP_440376.1_1 Reverse -300 -309 -0.0986038 0.285
NP_442687.1_7 Forward -310 -300 5.19158 0.217
NP_442485.1_3 Forward -220 -201 0.0977854 0.247
NP_442485.1_3 Reverse -289 -308 -1.27885 0.256
NP_442958.1_3 Reverse -189 -208 -1.96717 0.293
NP_441013.1_2 Reverse -170 -188 3.65739 0.23
NP_441422.1_7 Forward -311 -294 -1.63279 0.194
NP_440533.1_6 Forward -68 -49 7.27595 0.297
NP_440667.1_2 Reverse -327 -346 -3.73712 0.236
NP_441763.1_5 Forward -346 -327 -3.83545 0.234
NP_442658.1_1 Reverse -298 -308 11.8776 0.0697
NP_442658.1_1 Forward -173 -163 9.616 0.147
NP_442658.1_1 Forward -311 -301 7.25606 0.214
NP_440141.1_8 Forward -384 -365 4.916 0.278
NP_442782.1_2 Forward -183 -169 5.99778 0.234
NP_442782.1_2 Forward -309 -295 2.16287 0.277
NP_442782.1_2 Forward -368 -354 1.17956 0.282
NP_440656.1_8 Forward -220 -201 -8.85033 0.273
NP_442321.1_4 Forward -181 -162 -6.98204 0.284
NP_441958.1_5 Forward -310 -300 -6.41148 0.28
NP_441127.1_6 Reverse -292 -311 15.1424 0.238
NP_440984.1_7 Reverse -176 -190 7.27608 0.178
NP_441097.1_2 Forward -57 -40 6.43035 0.257
NP_440153.1_5 Reverse -210 -224 4.03116 0.199
NP_440934.1_1 Reverse -167 -186 5.99764 0.235
NP_440471.1_3 Reverse -326 -340 17.6992 0.175
NP_441129.1_6 Forward -226 -207 -0.0988766 0.229
NP_442002.1_9 Forward -310 -303 10.7572 0.185
NP_441654.1_7 Forward -193 -174 15.0503 0.172
NP_442431.1_10 Reverse -321 -339 0.412472 0.275
NP_442885.1_5 Forward -343 -324 17.1082 0.152
NP_441000.1_6 Forward -310 -296 4.42448 0.0953
NP_441000.1_6 Reverse -299 -313 -2.95034 0.221
NP_441674.1_4 Reverse -320 -339 2.26107 0.228
NP_441916.1_7 Reverse -200 -210 5.68323 0.124
NP_440206.1_4 Forward -194 -175 -1.37794 0.29
NP_441041.1_4 Reverse -175 -194 -8.06369 0.196
NP_441041.1_4 Reverse -327 -346 -13.7669 0.295
NP_441041.1_7 Reverse -297 -309 8.87526 0.128
NP_441041.1_7 Forward -174 -162 7.51478 0.162
NP_439966.1_7 Forward -311 -301 8.14104 0.14
NP_439966.1_7 Reverse -298 -308 6.46942 0.18
NP_439966.1_7 Reverse -207 -217 6.0761 0.195
NP_439966.1_9 Forward -311 -302 0.884706 0.253
NP_442941.1_3 Reverse -301 -311 1.06167 0.153
NP_442941.1_3 Reverse -210 -220 -0.118297 0.249
NP_440289.1_2 Forward -174 -161 -0.865694 0.213
NP_442012.1_1 Forward -178 -159 7.07928 0.115
NP_442049.1_3 Reverse -203 -222 13.7658 0.285
NP_442049.1_6 Reverse -40 -59 5.80098 0.231
NP_441556.1_10 Reverse -169 -183 10.3192 0.27
NP_443030.1_4 Forward -178 -159 -7.4737 0.295
NP_442068.1_4 Forward -333 -314 5.99684 0.243
NP_441644.1_6 Reverse -181 -191 7.55106 0.123
NP_441644.1_6 Forward -309 -299 3.32285 0.288
NP_443049.1_6 Forward -219 -209 13.4952 0.162
NP_442029.1_1 Reverse -179 -198 -11.1119 0.229
NP_440253.1_2 Reverse -300 -318 -1.75081 0.249
NP_440929.1_8 Reverse -300 -309 7.86621 0.0522
NP_440929.1_8 Forward -309 -300 7.57121 0.0706
NP_442933.1_10 Forward -309 -300 5.40793 0.19
NP_441751.2_8 Reverse -201 -215 -4.13031 0.163
NP_441751.2_8 Reverse -210 -224 -6.78525 0.283
NP_442554.1_8 Reverse -301 -311 4.40493 0.188
NP_442554.1_8 Forward -189 -179 3.42162 0.226
NP_441762.1_7 Forward -219 -207 -4.87757 0.183
NP_441762.1_7 Forward -310 -298 -5.07423 0.187
NP_441762.1_7 Reverse -299 -311 -5.07423 0.187
NP_442142.1_4 Forward -193 -180 14.375 0.0311
NP_442142.1_4 Reverse -297 -310 11.0318 0.0639
NP_442142.1_4 Forward -221 -208 2.87033 0.273
NP_442292.1_1 Reverse -301 -310 -0.0986038 0.239
NP_442292.1_1 Forward -308 -299 -0.786921 0.287
NP_442476.1_5 Forward -118 -99 12.5858 0.256
NP_442476.1_6 Forward -308 -294 3.63784 0.155
NP_442406.1_2 Reverse -329 -348 9.53756 0.232
NP_441715.1_4 Reverse -301 -311 9.12481 0.103
NP_441198.1_8 Forward -173 -163 11.3181 0.211
NP_441468.1_1 Reverse -301 -308 6.13563 0.209
NP_441468.1_1 Forward -308 -301 6.0373 0.223
NP_441673.1_1 Forward -309 -300 1.27803 0.155
NP_441673.1_1 Reverse -300 -309 1.27803 0.155
NP_441826.1_2 Reverse -203 -217 3.53951 0.109
NP_441826.1_5 Reverse -321 -340 1.47442 0.29
NP_441637.1_9 Reverse -338 -356 4.6407 0.245
NP_442868.1_6 Forward -173 -163 1.06167 0.205
NP_442868.1_6 Forward -311 -301 0.471689 0.226
NP_442719.1_2 Forward -300 -282 -2.83317 0.192
NP_442719.1_2 Forward -341 -323 -4.11147 0.208
NP_442719.1_2 Reverse -338 -356 -10.1096 0.269
NP_442808.1_1 Reverse -299 -309 8.53436 0.0493
NP_442808.1_1 Reverse -208 -218 7.94438 0.0634
NP_442808.1_1 Reverse -119 -129 3.71617 0.227
NP_442808.1_1 Forward -334 -324 3.12618 0.248
NP_442808.1_1 Reverse -36 -46 1.94622 0.281
NP_442542.1_2 Reverse -97 -110 6.31247 0.232
NP_442113.1_10 Forward -343 -324 -8.94866 0.289
NP_442050.1_1 Forward -184 -165 12.8808 0.199
NP_442342.1_9 Reverse -207 -223 4.0901 0.254
NP_440601.1_8 Reverse -171 -190 19.6866 0.111
NP_440558.1_2 Forward -336 -317 1.47442 0.181
NP_440558.1_2 Reverse -159 -178 0.687771 0.188
NP_440558.1_2 Forward -218 -199 -0.39387 0.203
NP_440558.1_2 Reverse -291 -310 -6.1954 0.272
NP_440558.1_2 Forward -193 -174 -6.88371 0.283
NP_441878.1_6 Forward -172 -162 0.57002 0.14
NP_441036.1_8 Reverse -299 -309 15.2213 0.0116
NP_441557.1_5 Reverse -300 -309 7.66954 0.0443
NP_441557.1_5 Forward -309 -300 0.983037 0.0911
NP_441445.1_1 Reverse -207 -226 4.32602 0.195
NP_441445.1_1 Reverse -373 -392 -0.000545616 0.283
NP_441590.1_4 Reverse -67 -86 7.27514 0.249
NP_441590.1_4 Forward -194 -175 5.11187 0.279
NP_441914.1_2 Forward -180 -162 14.9655 0.222
NP_441739.1_2 Reverse -29 -45 2.02449 0.288
NP_441458.1_10 Reverse -121 -140 1.47442 0.288
NP_442183.1_1 Reverse -162 -176 8.75105 0.109
NP_442183.1_1 Forward -218 -204 4.91614 0.239
NP_441549.1_9 Reverse -158 -176 -10.3056 0.274
NP_442347.1_2 Reverse -210 -219 5.40793 0.23
NP_442347.1_2 Forward -259 -250 4.0313 0.284
NP_442645.1_2 Reverse -292 -311 -22.0267 0.29
NP_441037.1_4 Forward -311 -301 5.85583 0.296
NP_442594.1_8 Reverse -322 -341 3.6377 0.279
NP_440151.1_5 Reverse -169 -188 3.24438 0.289
NP_441633.1_3 Reverse -298 -311 5.13249 0.0611
NP_441633.1_3 Reverse -160 -173 -6.07724 0.236
NP_441633.1_3 Forward -311 -298 -6.47056 0.253
NP_440136.1_2 Reverse -301 -308 6.23397 0.171
NP_440136.1_2 Forward -308 -301 6.13563 0.193
NP_442590.1_10 Reverse -209 -228 16.7157 0.113
NP_442590.1_10 Reverse -327 -346 6.19431 0.249
NP_442590.1_10 Reverse -156 -175 3.14605 0.295
NP_442998.1_10 Reverse -302 -309 15.5754 0.0102
NP_442998.1_10 Reverse -211 -218 5.93897 0.206
NP_440299.1_1 Reverse -296 -309 10.0485 0.0615
NP_440299.1_1 Forward -313 -300 6.11523 0.152
NP_442333.2_5 Forward -194 -175 -15.3402 0.291
NP_440256.1_1 Reverse -297 -316 -7.76869 0.245
NP_440256.1_1 Forward -221 -202 -8.16202 0.253
NP_441559.1_8 Forward -337 -323 -3.44199 0.203
NP_441559.1_8 Reverse -158 -172 -4.32697 0.222
NP_441559.1_8 Forward -134 -120 -7.08024 0.283
NP_440748.1_4 Reverse -175 -194 12.4867 0.292
NP_441199.1_5 Forward -179 -160 8.55425 0.259
NP_439985.1_10 Reverse -52 -65 18.0139 0.237
NP_442386.1_9 Forward -310 -301 5.89917 0.233
NP_442386.1_9 Reverse -299 -308 4.81753 0.282
NP_440570.1_5 Reverse -46 -65 -3.93378 0.298
NP_441340.1_5 Forward -308 -301 6.13563 0.175
NP_441340.1_5 Reverse -301 -308 5.93897 0.198
NP_442791.1_5 Reverse -208 -227 -9.83364 0.279
NP_440168.1_9 Reverse -198 -217 5.60432 0.227
NP_440168.1_9 Reverse -173 -192 -5.50708 0.296
NP_440586.1_1 Reverse -329 -348 -1.47551 0.237
NP_440586.1_3 Reverse -279 -298 19.3698 0.203
NP_440586.1_8 Forward -217 -210 12.6251 0.0546
NP_440586.1_8 Forward -308 -301 11.4451 0.0645
NP_440586.1_8 Reverse -182 -189 5.8403 0.283
NP_442251.1_6 Reverse -301 -308 12.0355 0.0627
NP_441912.1_3 Reverse -215 -234 6.09597 0.273
NP_441262.1_3 Forward -309 -302 14.7888 0.0223
NP_441262.1_3 Reverse -300 -307 5.15232 0.265
NP_443051.1_1 Forward -310 -301 0.786375 0.125
NP_443051.1_1 Forward -219 -210 0.29472 0.195
NP_439996.1_6 Reverse -180 -199 8.01048 0.257
NP_439937.1_9 Forward -334 -317 -13.0398 0.279
NP_439937.1_9 Reverse -344 -361 -16.383 0.287
NP_439937.1_9 Reverse -345 -362 -17.3663 0.298
NP_440408.1_5 Forward -315 -296 17.6007 0.27
NP_440408.1_7 Forward -190 -171 17.5024 0.111
NP_440439.1_1 Reverse -159 -172 1.59258 0.148
NP_440439.1_1 Reverse -297 -310 -1.849 0.285
NP_440372.1_2 Forward -308 -301 6.72562 0.0929
NP_440372.1_2 Reverse -301 -308 6.62729 0.151
NP_441181.1_2 Reverse -170 -189 2.94938 0.256
NP_441789.1_7 Forward -182 -163 4.91521 0.193
NP_441803.1_2 Reverse -157 -176 1.96607 0.222
NP_441803.1_2 Forward -214 -195 -1.37718 0.298
NP_440267.1_2 Forward -151 -137 7.07881 0.21
NP_442384.1_10 Reverse -300 -313 7.09911 0.0875
NP_442384.1_10 Reverse -175 -188 2.87088 0.21
NP_442114.1_4 Reverse -300 -311 12.2517 0.107
NP_441018.1_7 Reverse -177 -196 11.0125 0.194
NP_441018.1_7 Forward -313 -294 7.27595 0.273
NP_440344.1_10 Forward -178 -161 -4.18939 0.093
NP_440282.1_3 Forward -182 -163 -4.03212 0.298
NP_440282.1_10 Reverse -171 -190 -8.752 0.263
NP_442832.1_7 Reverse -170 -189 18.4857 0.223
NP_441965.1_10 Forward -174 -158 6.9417 0.159
NP_442693.1_6 Forward -190 -171 2.94938 0.278
NP_441592.1_4 Forward -171 -152 -1.37718 0.254
NP_441896.1_3 Reverse -200 -219 1.86774 0.209
NP_441896.1_5 Reverse -191 -198 12.2322 0.273
NP_441896.1_8 Reverse -88 -107 16.5191 0.188
NP_440894.1_10 Reverse -204 -223 4.916 0.241
NP_440937.1_5 Reverse -168 -187 9.53756 0.275
NP_440937.1_5 Reverse -174 -193 9.3409 0.275
NP_440999.1_1 Forward -226 -207 2.45694 0.249
NP_440999.1_9 Reverse -205 -219 10.6193 0.0502
NP_440999.1_9 Reverse -366 -380 -2.36035 0.268
NP_440491.1_1 Reverse -206 -225 13.1543 0.13
NP_439969.1_3 Reverse -204 -223 -0.688862 0.271
NP_442948.1_4 Forward -303 -289 19.1741 0.21
NP_442818.1_3 Forward -250 -233 -4.48438 0.243
NP_441543.1_2 Reverse -301 -310 8.75118 0.0968
NP_441543.1_2 Forward -217 -208 4.0313 0.293
NP_441543.1_3 Reverse -35 -49 16.5185 0.163
NP_442845.1_2 Reverse -175 -189 7.17775 0.198
NP_441178.1_6 Forward -193 -174 11.7 0.188
NP_441918.1_7 Reverse -180 -199 -0.787193 0.297
NP_441469.1_8 Reverse -299 -308 6.78456 0.227
NP_441469.1_8 Forward -310 -301 6.29291 0.227
NP_443064.1_6 Forward -38 -28 11.3065 0.13
NP_443064.1_6 Forward -171 -161 9.17338 0.242
NP_442578.1_7 Forward -217 -210 12.6255 0.0418
NP_442578.1_7 Forward -308 -301 5.93897 0.183
NP_443062.1_1 Reverse -209 -227 14.3964 0.048
NP_441601.1_4 Forward -337 -318 -1.37718 0.293
NP_440939.1_5 Forward -164 -148 10.0883 0.296
NP_442204.1_1 Forward -313 -302 2.12362 0.266
NP_442204.1_1 Forward -222 -211 2.02529 0.266
NP_440516.1_2 Reverse -294 -312 -1.94747 0.295
NP_440516.1_8 Forward -309 -300 8.25953 0.0391
NP_440516.1_8 Forward -218 -209 0.786375 0.133
NP_442428.1_5 Reverse -301 -308 6.13563 0.209
NP_442428.1_5 Forward -308 -301 6.0373 0.212
NP_441443.1_7 Reverse -321 -340 -0.983855 0.25
NP_440673.1_3 Reverse -302 -309 12.4288 0.0426
NP_440673.1_3 Reverse -211 -218 10.1672 0.149
NP_440673.1_3 Forward -207 -200 7.80726 0.244
NP_440865.1_9 Forward -224 -205 -9.047 0.273
NP_441052.1_2 Forward -190 -180 4.60159 0.154
NP_442219.1_8 Reverse -372 -391 6.23444 0.3
NP_440436.1_4 Reverse -301 -310 14.9456 0.0103
NP_440436.1_4 Forward -308 -299 5.80084 0.182
NP_441884.1_8 Forward -310 -291 -8.06369 0.259
NP_441884.1_9 Forward -221 -202 -21.24 0.235
NP_441884.1_9 Forward -174 -155 -24.19 0.284
NP_441893.1_5 Forward -175 -161 17.0102 0.207
NP_442864.1_7 Forward -190 -172 5.52568 0.274
NP_440314.1_9 Reverse -349 -368 -9.53865 0.269
NP_440041.1_2 Reverse -173 -192 -6.88371 0.296
NP_441719.1_4 Forward -308 -301 6.72562 0.093
NP_441719.1_4 Reverse -301 -308 6.62729 0.151
NP_441719.1_4 Forward -217 -210 3.77569 0.285
NP_441004.1_1 Reverse -318 -337 -8.55534 0.2
NP_441004.1_1 Reverse -175 -194 -15.0452 0.271
NP_441004.1_1 Forward -189 -170 -17.7001 0.294
NP_441004.1_4 Reverse -97 -107 10.3048 0.254
NP_442366.1_3 Reverse -167 -185 -4.99573 0.28
NP_442206.1_10 Forward -309 -294 1.65152 0.222
NP_443054.1_2 Reverse -160 -174 12.291 0.0722
NP_443054.1_2 Reverse -27 -41 6.6861 0.185
NP_441851.1_10 Forward -310 -300 6.07655 0.187
NP_441851.1_10 Reverse -299 -309 4.69992 0.254
NP_441501.1_9 Reverse -34 -53 17.5015 0.185
NP_442515.1_1 Forward -358 -344 0.687908 0.183
NP_441349.1_10 Forward -122 -103 -6.58872 0.233
NP_440432.1_9 Reverse -301 -316 1.35653 0.147
NP_442843.1_1 Forward -374 -355 -2.65548 0.209
NP_442843.1_1 Forward -373 -354 -11.1119 0.286
NP_442843.1_1 Reverse -182 -201 -11.1119 0.286
NP_439960.1_5 Reverse -172 -191 16.7157 0.151
NP_442168.1_5 Reverse -227 -246 -2.85214 0.27
NP_440588.1_2 Forward -227 -208 -3.3438 0.185
NP_440195.1_4 Forward -321 -302 6.29264 0.273
NP_442335.1_7 Reverse -301 -315 12.9786 0.261
NP_442006.1_3 Reverse -319 -337 -7.65067 0.298
NP_441003.1_9 Forward -193 -174 4.22769 0.285
NP_441570.1_1 Reverse -175 -193 -12.1739 0.209
NP_441570.1_1 Forward -309 -291 -16.3038 0.242
NP_441570.1_1 Reverse -181 -199 -16.4021 0.245
NP_441078.1_4 Reverse -300 -309 0.0980582 0.205
NP_441078.1_4 Forward -309 -300 0.0980582 0.205
NP_441078.1_4 Forward -171 -162 -1.6719 0.266
NP_442729.1_5 Reverse -180 -190 17.6796 0.0748
NP_442348.1_2 Forward -368 -359 7.57121 0.28
NP_442443.1_1 Reverse -319 -338 -3.44213 0.267
NP_441432.1_5 Forward -115 -101 12.4876 0.271
NP_441432.1_8 Forward -219 -210 4.22796 0.235
NP_442320.1_8 Forward -315 -301 -4.52363 0.171
NP_441732.1_2 Forward -213 -197 -16.7561 0.195
NP_440760.1_1 Reverse -300 -319 -23.4033 0.297
NP_442274.1_8 Forward -334 -316 12.8062 0.297
NP_441945.1_10 Reverse -174 -193 10.4225 0.25
NP_441805.1_1 Forward -165 -146 -2.0655 0.193
NP_440913.1_1 Reverse -179 -197 6.90232 0.22
NP_440913.1_1 Reverse -160 -178 3.55906 0.298
NP_442489.1_7 Reverse -300 -309 0.786375 0.152
NP_442489.1_7 Forward -309 -300 0.589713 0.17
NP_442489.1_7 Reverse -162 -171 -1.57357 0.213
NP_440559.1_1 Reverse -301 -310 5.50626 0.14
NP_441659.2_8 Forward -309 -299 5.28991 0.112
NP_442749.1_5 Reverse -301 -318 8.89854 0.225
NP_439956.1_7 Reverse -327 -346 7.96426 0.257
NP_439956.1_7 Reverse -157 -176 1.76941 0.28
NP_439956.1_7 Reverse -194 -213 1.27776 0.292
NP_442008.1_2 Forward -187 -168 2.55606 0.285
NP_440708.1_6 Forward -260 -241 -7.37537 0.248
NP_441800.1_7 Forward -341 -323 1.10079 0.21
NP_442346.1_5 Reverse -199 -209 7.15819 0.178
NP_442346.1_5 Forward -310 -300 6.37155 0.205
NP_442346.1_5 Reverse -180 -190 4.89658 0.269
NP_440545.1_3 Forward -143 -126 -4.48438 0.227
NP_440545.1_5 Forward -51 -34 5.15205 0.244
NP_440025.1_3 Reverse -148 -162 13.612 0.24
NP_440459.1_2 Forward -192 -175 12.6252 0.142
NP_440459.1_2 Forward -186 -169 9.28195 0.23
NP_441653.1_2 Forward -320 -301 3.43298 0.264
NP_442137.1_8 Reverse -313 -331 17.8379 0.227
NP_441888.1_7 Reverse -125 -139 7.07942 0.225
NP_441888.1_7 Forward -314 -300 5.1128 0.225
NP_441888.1_7 Reverse -295 -309 1.76955 0.239
NP_441948.1_4 Reverse -293 -311 7.09898 0.0626
NP_441833.1_4 Reverse -301 -308 14.1004 0.0258
NP_441833.1_4 Forward -308 -301 6.13563 0.198
NP_442162.1_9 Reverse -301 -308 6.62729 0.142
NP_442162.1_9 Forward -308 -301 6.52896 0.178
NP_442055.1_6 Reverse -321 -340 14.5524 0.223
NP_440671.1_2 Reverse -212 -226 15.8309 0.171
NP_442140.1_3 Forward -308 -298 13.7464 0.0542
NP_442140.1_3 Reverse -301 -311 4.79825 0.238
NP_441609.1_1 Reverse -284 -303 -2.75381 0.293
NP_440875.1_9 Reverse -211 -221 11.7788 0.152
NP_440875.1_9 Reverse -302 -312 8.46937 0.233
NP_441813.1_5 Forward -311 -301 9.61647 0.027
NP_441813.1_5 Reverse -298 -308 9.12481 0.0308
NP_440590.1_4 Reverse -301 -314 10.2457 0.0294
NP_442497.1_10 Reverse -301 -310 0.688044 0.141
NP_440821.1_4 Forward -311 -301 0.373358 0.18
NP_440821.1_4 Reverse -298 -308 -0.118297 0.229
NP_441239.1_9 Reverse -298 -310 7.51213 0.158
NP_441239.1_9 Forward -192 -180 3.57889 0.283
NP_441239.1_9 Forward -68 -56 3.2839 0.289
NP_440156.1_4 Forward -31 -21 8.92768 0.242
NP_441508.1_4 Forward -321 -307 15.2903 0.244
NP_442643.1_3 Forward -189 -170 9.93088 0.0839
NP_441617.1_6 Reverse -144 -163 -6.78538 0.288
NP_442052.1_6 Forward -186 -168 16.8329 0.249
NP_440546.1_4 Reverse -181 -191 10.4338 0.109
NP_440462.1_6 Forward -311 -301 7.64985 0.0705
NP_440462.1_6 Forward -220 -210 5.78156 0.138
NP_442340.1_3 Forward -207 -188 -7.86702 0.241
NP_440868.1_4 Reverse -205 -217 2.39892 0.156
NP_440868.1_4 Reverse -296 -308 0.333971 0.217
NP_441249.1_8 Forward -52 -33 6.29264 0.247
NP_442479.1_9 Forward -162 -143 -8.752 0.266
NP_442402.1_4 Reverse -340 -359 -3.14789 0.212
NP_441848.1_4 Forward -160 -144 9.4605 0.283
NP_441848.1_7 Reverse -356 -375 1.27698 0.228
NP_441848.1_9 Reverse -35 -46 11.4645 0.268
NP_440653.1_10 Forward -230 -211 10.4225 0.151
NP_440696.1_3 Reverse -164 -182 1.10079 0.22
NP_440696.1_3 Reverse -206 -224 -2.73412 0.279
NP_442039.1_10 Reverse -350 -368 14.6697 0.227
NP_441926.1_3 Reverse -209 -225 2.71347 0.257
NP_442837.1_3 Reverse -210 -217 9.87221 0.106
NP_442837.1_3 Reverse -301 -308 6.13563 0.25
NP_442837.1_3 Forward -308 -301 5.93897 0.265
NP_440160.1_2 Forward -178 -159 -9.24366 0.293
NP_440160.1_3 Forward -187 -168 7.76679 0.284
NP_442053.1_1 Reverse -209 -218 4.42462 0.249
NP_442053.1_1 Reverse -162 -171 4.12963 0.267
NP_440505.1_3 Forward -311 -301 14.6313 0.019
NP_440505.1_3 Reverse -160 -170 5.09324 0.246
NP_441959.1_8 Forward -158 -145 8.03444 0.298
NP_442532.1_7 Forward -218 -204 4.12949 0.178
NP_442532.1_7 Reverse -300 -314 1.47456 0.285
NP_441011.1_8 Reverse -301 -310 7.17789 0.179
NP_442533.1_1 Reverse -327 -346 -14.5535 0.246
NP_442533.1_6 Forward -209 -200 3.53964 0.21
NP_442541.1_3 Forward -182 -163 5.89931 0.244
NP_441219.1_4 Reverse -222 -241 4.62101 0.283
NP_441482.1_7 Forward -315 -301 4.71948 0.0454
NP_441028.1_6 Reverse -350 -360 8.04271 0.217
NP_440007.1_9 Reverse -171 -185 3.53951 0.269
NP_440007.1_9 Forward -212 -198 1.76955 0.285
NP_441347.1_5 Forward -306 -292 8.75042 0.283
NP_441106.1_1 Forward -310 -301 8.35786 0.0585
NP_441106.1_1 Reverse -299 -308 5.70292 0.131
NP_439903.1_7 Reverse -217 -236 3.14605 0.281
NP_441286.1_1 Reverse -161 -173 -4.77924 0.175
NP_440670.1_8 Reverse -300 -309 13.2744 0.0157
NP_440670.1_8 Forward -309 -300 7.37455 0.0774
NP_440886.1_7 Forward -310 -300 4.60114 0.227
NP_442382.1_9 Reverse -170 -189 8.84842 0.281
NP_442072.1_9 Reverse -208 -226 -23.482 0.297
NP_442022.1_4 Reverse -321 -340 9.83255 0.242
NP_441021.1_1 Reverse -301 -320 -7.4737 0.184
NP_441021.1_1 Forward -242 -223 -12.6852 0.293
NP_441021.1_8 Forward -123 -105 0.805796 0.295
NP_441626.1_2 Forward -308 -301 6.0373 0.212
NP_441626.1_2 Reverse -301 -308 6.0373 0.212
NP_442209.1_9 Forward -181 -162 20.1564 0.123
NP_442794.1_1 Reverse -171 -183 3.67722 0.286
NP_441962.1_4 Forward -176 -157 -6.1954 0.175
NP_441962.1_4 Reverse -195 -214 -11.8003 0.245
NP_440387.1_1 Reverse -300 -316 -3.97304 0.171
NP_440387.1_1 Forward -218 -202 -5.84132 0.254
NP_441488.1_7 Forward -224 -205 7.17762 0.131
NP_441993.1_1 Reverse -216 -235 2.8238 0.25
NP_440358.1_8 Reverse -278 -297 15.1424 0.0876
NP_442684.1_2 Forward -199 -180 19.174 0.288
NP_440293.1_3 Reverse -214 -233 1.96607 0.206
NP_440293.1_3 Reverse -49 -68 0.294447 0.221
NP_440293.1_3 Forward -53 -34 -2.16383 0.239
NP_440457.1_1 Forward -313 -301 -0.74767 0.273
NP_441801.1_4 Forward -169 -159 12.3697 0.201
NP_440801.1_8 Forward -326 -307 2.85105 0.229
NP_441984.1_3 Forward -235 -217 17.5221 0.0928
NP_441984.1_6 Reverse -51 -63 16.5586 0.166
NP_441332.1_6 Reverse -36 -46 10.7754 0.287
NP_442509.1_9 Reverse -300 -310 12.0743 0.105
NP_441489.1_3 Forward -158 -144 6.98253 0.287
NP_442439.1_8 Forward -191 -172 9.63589 0.253
NP_442514.1_5 Forward -335 -316 -9.44104 0.296
NP_440554.1_4 Forward -308 -298 7.94484 0.0898
NP_440554.1_4 Reverse -301 -311 6.96153 0.107
NP_441845.1_6 Forward -230 -212 2.47742 0.249
NP_441885.1_5 Forward -171 -161 -0.0199663 0.186
NP_440478.1_10 Reverse -214 -228 9.04604 0.257
NP_441756.1_5 Reverse -205 -224 -0.787193 0.249
NP_441756.1_5 Reverse -160 -179 -4.42544 0.294
NP_440191.1_8 Reverse -204 -222 16.3413 0.254
NP_443000.1_7 Forward -220 -210 7.74818 0.0666
NP_443000.1_7 Forward -311 -301 1.74999 0.229
NP_443059.1_10 Forward -198 -179 7.4718 0.194
NP_441842.1_7 Reverse -69 -88 11.3067 0.259
NP_440275.1_3 Reverse -298 -308 12.6647 0.0315
NP_440275.1_3 Forward -311 -301 5.78156 0.131
NP_440091.1_1 Reverse -296 -308 1.12062 0.212
NP_441307.1_4 Reverse -207 -226 3.73603 0.218
NP_441397.1_6 Forward -370 -356 22.0257 0.0688
NP_441902.1_3 Forward -360 -350 12.3986 0.253
NP_440127.1_5 Reverse -132 -150 12.7038 0.226
NP_442451.1_2 Forward -340 -321 -7.27704 0.232
NP_439962.1_4 Forward -340 -321 -2.26216 0.226
NP_440175.1_7 Forward -310 -292 12.0957 0.228
NP_441105.1_3 Reverse -157 -176 -8.55534 0.274
NP_440216.1_1 Forward -309 -295 -2.85201 0.0608
NP_440216.1_1 Reverse -209 -223 -11.4068 0.184
NP_440216.1_1 Reverse -300 -314 -11.9968 0.236
NP_440216.1_1 Reverse -164 -178 -12.5868 0.288
NP_440216.1_9 Forward -188 -179 7.37455 0.286
NP_442015.1_10 Reverse -296 -309 4.44418 0.169
NP_442015.1_10 Reverse -171 -184 3.95252 0.178
NP_442015.1_10 Forward -313 -300 0.215946 0.237
NP_441111.1_7 Reverse -301 -309 8.96754 0.0463
NP_439971.2_3 Forward -195 -176 18.4634 0.134
NP_441766.1_2 Reverse -300 -309 6.5879 0.0918
NP_440416.1_9 Reverse -293 -312 -15.0452 0.184
NP_440416.1_9 Forward -191 -172 -18.2901 0.256
NP_442154.1_1 Forward -308 -290 -16.2055 0.236
NP_442154.1_1 Reverse -325 -343 -17.8771 0.272
NP_442154.1_1 Reverse -182 -200 -17.8771 0.272
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGGAAAGGAGCATTGACTATGTAGGTCAAAGGGGGATATTTGGGGGACAACATCCAAAAGCTCCGCCACCATTCCCCGCTCAAAAACTCCGGCGATCGTAGGGCTTGCAAATATTCCAGGCCGTAGGATAAGTGGTTACTCTGGTCCCAAGCTGGCACCGTTTGATCCATCCCTAGCCACAGGCGATCAAGGCCGTTGCTACCAAGCCACACCATGGCCAACAGCAGGGGCACTCCCCAGGATTTAGACAAAATTTGCTTAACCATAGCAGGGGTTAGACGTAAGATGGATACCAACAGCCCATCTTTTATGATTGGGCACCGAGAGTCTTCCTGGCCTGACCCAAACGGTTAGGGTTAGGGGGGCTTACCATTTAGCATTAATCATTTTGGTAATCCT

CDS

ATGAGTGCAAACCTTGCCCAACTCCACCAGGCCCTGGAAAATCGTACCGCCTTAAAGGTAATTAGCGGTTTAAATAACTTCGATAGCGCCAATGTTTTAGCCGTGGCCCGGGCTGCCCAGGCTGGGGGAGCTACTTTTGTGGACATTGCAGCCGATCGCCAATTGATCCAACAGGTGCGCCACGCCATTGATTTGCCCATCTGTGTGTCGGCGGTGGAAGCAGAATTATTAGCCGAAGCGGTGGCCGCCGGAGCTGACTTGGTGGAAATTGGTAACTTTGACAGTTTTTACGCCCAGGGTCGTCGTTTTGAAGGGCCGGAAGTGTTGGCCCTCACCAAAGCCACCCGTCAATTGTTGCCCCATACTTTGCTCTCCGTTACCGTGCCCCACATCCTTGCTCTGGACGAACAGGTACAGTTAGCCGAAGCTTTAGTGGCCGCTGGAGCCGACATCATCCAAACTGAAGGGGGGACCAGTGCCGAACCCCATCACCCTGGAGTTTTGGGTTTGATTGAGAAAGCCGCTCCCACTTTGGCCGCTGCCCACGCTATCAGTCGAGCCGTTAATGTCCCCGTACTATGTGCTTCTGGCCTATCCGATGTCACCGTTCCCATGGCGATCGCTGCTGGAGCCAGTGGAGTAGGGGTTGGTTCCGCCATTAACCAATTGAACGACCAAGTGGCCATGGTGGCCGCTGTCCGTCGCCTGGCCGATGCCTTGGTGGCCCAGCCTGTGCGGGTTGCCTAA

Protein

MSANLAQLHQALENRTALKVISGLNNFDSANVLAVARAAQAGGATFVDIAADRQLIQQVRHAIDLPICVSAVEAELLAEAVAAGADLVEIGNFDSFYAQGRRFEGPEVLALTKATRQLLPHTLLSVTVPHILALDEQVQLAEALVAAGADIIQTEGGTSAEPHHPGVLGLIEKAAPTLAAAHAISRAVNVPVLCASGLSDVTVPMAIAAGASGVGVGSAINQLNDQVAMVAAVRRLADALVAQPVRVA