Your browser is old and dusty. Try Google Chrome!

Details for slr2026

ORF slr2026
Accession NP_440595.1
Symbol folP
Category Folic acid
Definition dihydropteroate synthase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -73 -87 11.0127 0.256
NP_442711.1_1 Reverse -132 -146 10.816 0.264
NP_441061.1_2 Forward -327 -313 5.30946 0.138
NP_441061.1_2 Reverse -320 -334 3.34284 0.165
NP_441061.1_2 Forward -246 -232 0.687908 0.202
NP_440795.1_7 Forward -327 -320 14.6904 0.0123
NP_440795.1_7 Reverse -320 -327 14.6904 0.0123
NP_440795.1_7 Reverse -93 -100 10.2655 0.154
NP_441418.1_6 Reverse -352 -371 -10.522 0.0362
NP_441418.1_6 Forward -328 -309 -28.9099 0.213
NP_441418.1_6 Reverse -319 -338 -29.8932 0.245
NP_442291.1_5 Forward -329 -313 8.90832 0.055
NP_441453.1_4 Reverse -319 -327 16.539 0.00633
NP_441453.1_4 Forward -328 -320 16.539 0.00633
NP_441453.1_7 Forward -60 -53 11.6422 0.298
NP_442151.1_6 Reverse -319 -333 17.5025 0.00997
NP_442151.1_6 Forward -328 -314 6.19444 0.244
NP_442328.1_8 Reverse -4 -23 18.6823 0.166
NP_441818.1_1 Forward -327 -316 9.79292 0.232
NP_441818.1_9 Reverse -229 -248 0.196116 0.191
NP_441818.1_9 Reverse -232 -251 -4.13045 0.234
NP_441818.1_9 Reverse -301 -320 -8.26035 0.276
NP_440226.1_1 Reverse -319 -338 12.3892 0.0451
NP_442287.1_5 Reverse -231 -241 18.5646 0.19
NP_442655.1_10 Reverse -352 -371 -12.8819 0.266
NP_442173.1_1 Forward -327 -319 15.4574 0.00633
NP_442173.1_1 Reverse -320 -328 15.4574 0.00633
NP_442752.1_4 Forward -328 -321 13.8055 0.0199
NP_442752.1_4 Reverse -319 -326 13.8055 0.0199
NP_442752.1_4 Reverse -232 -239 7.6106 0.151
NP_442752.1_4 Forward -156 -149 5.54565 0.194
NP_443027.1_4 Reverse -317 -327 11.0914 0.107
NP_442975.1_10 Forward -332 -318 10.2254 0.056
NP_442975.1_10 Forward -365 -351 1.47397 0.297
NP_440784.1_7 Forward -327 -320 15.9687 0.0123
NP_440784.1_7 Reverse -320 -327 15.9687 0.0123
NP_440061.1_9 Forward -330 -316 19.6651 0.00478
NP_440061.1_9 Reverse -317 -331 10.422 0.124
NP_442062.1_8 Forward -328 -318 17.3846 0.00193
NP_442062.1_8 Reverse -319 -329 17.3846 0.00193
NP_442062.1_8 Reverse -76 -86 4.40493 0.217
NP_442062.1_8 Forward -107 -97 3.22496 0.279
NP_441859.1_3 Forward -98 -79 6.29183 0.18
NP_440304.1_4 Forward -330 -320 1.84832 0.299
NP_440304.1_4 Reverse -317 -327 1.84832 0.299
NP_442242.1_4 Forward -327 -320 14.3954 0.0124
NP_442242.1_4 Reverse -320 -327 14.3954 0.0124
NP_440044.1_8 Forward -327 -308 -0.0988766 0.21
NP_442602.1_3 Forward -265 -246 -3.24547 0.277
NP_441200.1_8 Forward -263 -244 18.2296 0.142
NP_441935.1_1 Reverse -238 -257 8.94757 0.225
NP_440893.1_5 Reverse -168 -187 9.7334 0.249
NP_440307.1_2 Forward -368 -349 9.63589 0.136
NP_441208.1_9 Reverse -175 -189 5.01447 0.282
NP_441594.1_6 Forward -208 -189 0.786102 0.281
NP_442110.1_7 Reverse -319 -333 1.76955 0.222
NP_442110.1_7 Forward -328 -314 0.491246 0.259
NP_442726.1_1 Forward -333 -314 13.4708 0.154
NP_441925.1_4 Forward -320 -301 -15.3409 0.263
NP_441925.1_4 Forward -254 -235 -16.8158 0.285
NP_441925.1_4 Forward -380 -361 -17.2092 0.29
NP_440856.1_7 Reverse -289 -308 -8.06369 0.264
NP_441083.1_5 Forward -328 -318 20.3345 0.00053
NP_441083.1_5 Reverse -319 -329 20.3345 0.00053
NP_441738.1_2 Forward -326 -319 15.28 0.0102
NP_441738.1_2 Reverse -321 -328 15.28 0.0102
NP_441558.1_5 Reverse -317 -336 21.8289 0.00248
NP_440209.1_1 Reverse -319 -327 18.1123 0.00295
NP_440209.1_1 Forward -328 -320 18.1123 0.00295
NP_442889.1_8 Reverse -316 -330 5.40719 0.227
NP_442445.1_1 Reverse -314 -333 11.6025 0.271
NP_440538.1_1 Forward -107 -89 15.5554 0.25
NP_440538.1_10 Forward -363 -344 10.5209 0.279
NP_441716.1_1 Forward -328 -314 8.75105 0.133
NP_442111.1_4 Reverse -318 -332 11.111 0.0515
NP_442111.1_4 Forward -329 -315 4.91614 0.185
NP_442111.1_4 Forward -157 -143 2.2612 0.283
NP_440906.1_5 Forward -327 -320 15.8704 0.0124
NP_440906.1_5 Reverse -320 -327 15.8704 0.0124
NP_440906.1_5 Reverse -29 -36 8.79057 0.149
NP_440747.1_10 Reverse -316 -328 26.5883 0.000317
NP_440747.1_10 Forward -331 -319 14.887 0.00223
NP_440747.1_10 Reverse -349 -361 -12.1541 0.227
NP_440747.1_10 Reverse -175 -187 -12.3507 0.27
NP_441486.1_1 Reverse -316 -330 6.3911 0.0344
NP_441486.1_1 Forward -331 -317 5.89945 0.0344
NP_442848.1_1 Forward -334 -320 -1.67204 0.263
NP_442848.1_5 Forward -247 -229 2.57575 0.276
NP_442848.1_9 Forward -366 -347 6.29264 0.189
NP_441012.1_4 Reverse -55 -68 7.39411 0.272
NP_443018.1_3 Forward -327 -320 14.8871 0.0123
NP_443018.1_3 Reverse -320 -327 14.8871 0.0123
NP_443018.1_3 Reverse -197 -204 5.34899 0.212
NP_443018.1_3 Reverse -93 -100 4.36568 0.254
NP_443018.1_3 Forward -100 -93 4.07068 0.299
NP_441634.1_8 Reverse -356 -370 4.42448 0.127
NP_441634.1_8 Reverse -317 -331 -3.147 0.295
NP_440376.1_1 Forward -328 -319 19.4693 0.000692
NP_440376.1_1 Reverse -319 -328 19.4693 0.000692
NP_440376.1_1 Reverse -352 -361 -1.18024 0.294
NP_441588.1_4 Reverse -321 -331 15.9097 0.0369
NP_442687.1_7 Forward -329 -319 8.92815 0.0994
NP_442687.1_7 Reverse -318 -328 8.92815 0.0994
NP_442191.1_4 Reverse -248 -262 11.284 0.263
NP_442485.1_3 Reverse -308 -327 2.85105 0.207
NP_442485.1_3 Reverse -242 -261 -2.95047 0.271
NP_441013.1_2 Forward -102 -84 -4.20908 0.298
NP_441013.1_3 Reverse -247 -266 8.84924 0.237
NP_441422.1_7 Reverse -90 -107 10.8552 0.0597
NP_441422.1_7 Forward -330 -313 -3.99273 0.238
NP_441950.1_7 Reverse -241 -260 -2.36049 0.201
NP_442658.1_1 Reverse -317 -327 7.94438 0.199
NP_442658.1_1 Forward -330 -320 6.76441 0.214
NP_442658.1_1 Reverse -90 -100 6.0761 0.238
NP_440141.1_3 Reverse -80 -99 5.211 0.274
NP_440141.1_4 Reverse -355 -374 -1.7705 0.296
NP_440141.1_8 Forward -172 -153 5.11266 0.278
NP_440141.1_8 Forward -295 -276 4.62101 0.286
NP_442782.1_2 Reverse -86 -100 4.12949 0.257
NP_442782.1_2 Forward -328 -314 2.94952 0.269
NP_442205.1_9 Reverse -313 -329 -1.61309 0.264
NP_441414.1_9 Reverse -319 -338 -3.3438 0.134
NP_440184.1_5 Reverse -309 -328 5.01433 0.242
NP_441256.1_1 Forward -244 -225 -7.67036 0.239
NP_442937.1_5 Forward -333 -314 18.3873 0.0262
NP_442937.1_5 Reverse -314 -333 16.6174 0.042
NP_441958.1_5 Forward -329 -319 12.2714 0.00183
NP_441958.1_5 Reverse -318 -328 12.2714 0.00183
NP_441127.1_1 Forward -286 -272 13.6676 0.175
NP_442486.1_4 Forward -371 -352 12.3892 0.167
NP_442605.1_4 Reverse -35 -54 9.83255 0.275
NP_440984.1_7 Reverse -314 -328 5.89945 0.235
NP_439990.1_5 Forward -333 -320 11.0324 0.128
NP_442690.1_1 Reverse -31 -50 -16.4218 0.289
NP_442911.1_2 Forward -338 -319 11.8975 0.0131
NP_440153.1_5 Forward -327 -313 1.37622 0.257
NP_440369.1_5 Forward -187 -168 13.1758 0.205
NP_442064.1_10 Reverse -329 -348 14.3558 0.164
NP_443055.1_6 Forward -336 -318 1.5917 0.227
NP_440993.1_6 Forward -155 -138 11.8386 0.256
NP_440138.1_6 Forward -333 -314 1.17865 0.289
NP_441099.1_5 Forward -338 -319 -0.590531 0.0954
NP_441099.1_5 Reverse -309 -328 -11.8003 0.29
NP_440475.1_3 Reverse -317 -336 16.2241 0.216
NP_441294.1_7 Forward -377 -363 11.1704 0.153
NP_441294.1_7 Forward -332 -318 9.15464 0.256
NP_440411.1_10 Reverse -245 -264 10.6521 0.27
NP_440411.1_10 Reverse -364 -383 8.79781 0.293
NP_441646.1_1 Forward -335 -316 3.6377 0.206
NP_442438.1_10 Reverse -314 -328 3.44117 0.162
NP_442438.1_10 Forward -333 -319 1.08123 0.206
NP_441752.1_6 Forward -368 -349 6.58763 0.211
NP_440377.1_1 Forward -141 -124 12.24 0.26
NP_441000.1_6 Forward -329 -315 -3.73699 0.225
NP_440484.1_3 Reverse -317 -331 11.2093 0.242
NP_440147.1_4 Forward -330 -317 18.9972 0.00328
NP_440147.1_4 Reverse -317 -330 8.77074 0.0465
NP_441175.1_7 Reverse -319 -338 17.5024 0.0564
NP_441295.1_4 Forward -333 -314 -3.44213 0.29
NP_441550.1_8 Reverse -317 -327 15.1225 0.0132
NP_441550.1_8 Forward -330 -320 14.6309 0.0132
NP_441916.1_7 Forward -328 -318 10.3048 0.0261
NP_441916.1_7 Reverse -319 -329 10.3048 0.0261
NP_441041.1_4 Reverse -319 -338 -0.295539 0.0941
NP_441041.1_4 Reverse -241 -260 -12.7836 0.274
NP_441041.1_7 Reverse -316 -328 7.51478 0.162
NP_442396.1_5 Forward -332 -319 12.114 0.0913
NP_440569.1_7 Forward -274 -255 17.6007 0.116
NP_442004.1_6 Reverse -319 -333 8.94771 0.14
NP_441725.1_4 Reverse -314 -328 2.94893 0.279
NP_441725.1_5 Forward -327 -317 2.04498 0.115
NP_441725.1_5 Reverse -320 -330 2.04498 0.115
NP_439966.1_7 Reverse -317 -327 15.3192 0.0152
NP_439966.1_7 Forward -330 -320 7.25606 0.15
NP_439966.1_9 Reverse -26 -35 7.57121 0.253
NP_442941.1_3 Forward -327 -317 19.2529 0.00262
NP_442941.1_3 Reverse -320 -330 11.0914 0.0116
NP_440289.1_2 Reverse -316 -329 3.06754 0.0811
NP_440289.1_2 Forward -331 -318 -4.9956 0.294
NP_440260.1_8 Reverse -310 -328 -2.63579 0.245
NP_440260.1_8 Reverse -244 -262 -3.42244 0.252
NP_440260.1_8 Forward -337 -319 -7.06068 0.295
NP_442281.1_1 Reverse -314 -328 15.6336 0.0113
NP_442281.1_1 Forward -333 -319 7.57046 0.0969
NP_440177.1_9 Forward -336 -317 14.2574 0.213
NP_442256.1_2 Reverse -317 -335 -7.84733 0.215
NP_442012.1_1 Forward -162 -143 1.17943 0.222
NP_440723.1_4 Reverse -25 -44 -9.44032 0.272
NP_441556.1_10 Reverse -142 -156 10.8058 0.257
NP_441644.1_6 Forward -328 -318 17.3841 0.00127
NP_441644.1_6 Reverse -319 -329 17.3841 0.00127
NP_441644.1_6 Reverse -92 -102 8.23937 0.104
NP_442215.1_2 Reverse -317 -333 -1.71142 0.187
NP_442215.1_2 Forward -330 -314 -2.98973 0.207
NP_442215.1_2 Forward -70 -54 -5.64466 0.254
NP_442029.1_6 Forward -333 -314 5.89931 0.248
NP_440253.1_2 Reverse -319 -337 -1.45582 0.242
NP_440253.1_2 Forward -276 -258 -3.22577 0.287
NP_440929.1_8 Forward -328 -319 19.2726 0.000701
NP_440929.1_8 Reverse -319 -328 19.2726 0.000701
NP_440780.1_1 Forward -352 -333 11.4109 0.243
NP_442933.1_10 Forward -328 -319 17.601 0.00325
NP_442933.1_10 Reverse -319 -328 17.601 0.00325
NP_441751.2_8 Forward -327 -313 14.8476 0.0119
NP_442554.1_8 Forward -327 -317 16.2046 0.0065
NP_442554.1_8 Reverse -320 -330 15.3197 0.00882
NP_442075.1_5 Forward -194 -175 16.4673 0.246
NP_441762.1_7 Forward -38 -26 5.15219 0.0443
NP_441762.1_7 Reverse -318 -330 0.432302 0.0747
NP_441762.1_7 Forward -329 -317 -6.74586 0.284
NP_442142.1_4 Reverse -316 -329 13.49 0.0348
NP_442142.1_4 Forward -313 -300 12.605 0.0434
NP_442142.1_4 Forward -244 -231 3.85363 0.243
NP_442142.1_4 Forward -331 -318 2.96866 0.269
NP_442292.1_1 Forward -327 -318 18.486 0.00229
NP_442292.1_1 Reverse -320 -329 18.486 0.00229
NP_442476.1_6 Reverse -320 -334 2.94952 0.169
NP_442476.1_6 Forward -327 -313 0.589577 0.252
NP_440895.1_6 Reverse -313 -326 18.8988 0.039
NP_440895.1_6 Forward -334 -321 8.77074 0.246
NP_440421.1_1 Forward -208 -194 16.4209 0.176
NP_442381.1_8 Forward -40 -21 -7.96535 0.207
NP_441711.1_4 Forward -196 -177 8.94757 0.144
NP_443009.1_5 Reverse -318 -329 8.90795 0.0965
NP_443009.1_5 Forward -329 -318 8.90795 0.0965
NP_442301.1_2 Forward -251 -232 4.03023 0.284
NP_441715.1_4 Forward -327 -317 17.3846 0.0106
NP_441715.1_4 Reverse -320 -330 7.94484 0.107
NP_441448.1_1 Forward -306 -287 7.47261 0.221
NP_440158.1_8 Reverse -26 -45 9.3409 0.285
NP_441198.1_8 Forward -39 -29 10.5368 0.265
NP_440379.1_5 Reverse -244 -263 -8.26035 0.25
NP_440464.1_10 Reverse -320 -330 13.0082 0.169
NP_441468.1_1 Forward -327 -320 15.8704 0.0124
NP_441468.1_1 Reverse -320 -327 15.8704 0.0124
NP_441468.1_1 Reverse -93 -100 4.46401 0.224
NP_441618.1_5 Forward -381 -362 14.5524 0.063
NP_441020.2_6 Reverse -362 -379 7.217 0.237
NP_441015.1_10 Reverse -314 -333 0.982764 0.164
NP_441015.1_10 Reverse -353 -372 -1.08219 0.169
NP_441673.1_1 Forward -328 -319 20.8459 0.000698
NP_441673.1_1 Reverse -319 -328 20.8459 0.000698
NP_440265.1_4 Reverse -71 -90 16.8577 0.287
NP_441826.1_2 Reverse -313 -327 -2.45868 0.271
NP_441826.1_5 Reverse -83 -102 4.71934 0.253
NP_441330.1_1 Reverse -314 -333 6.39097 0.0252
NP_442868.1_6 Reverse -317 -327 19.2529 0.00563
NP_442868.1_6 Forward -330 -320 9.81313 0.038
NP_441056.1_1 Forward -328 -309 -0.295539 0.16
NP_441612.1_2 Reverse -319 -329 8.54929 0.21
NP_441612.1_2 Forward -328 -318 8.54929 0.21
NP_442427.1_8 Forward -337 -318 10.7175 0.159
NP_442808.1_1 Reverse -318 -328 8.63269 0.0481
NP_442808.1_1 Forward -329 -319 8.63269 0.0481
NP_442808.1_1 Reverse -27 -37 4.89613 0.185
NP_441101.1_7 Reverse -299 -318 13.1758 0.29
NP_440145.1_3 Reverse -309 -328 2.3594 0.12
NP_440145.1_3 Forward -338 -319 0.982764 0.132
NP_440145.1_3 Reverse -354 -373 -4.22878 0.226
NP_442542.1_2 Reverse -26 -39 4.64084 0.299
NP_442050.1_1 Forward -187 -168 12.3892 0.215
NP_442050.1_5 Reverse -317 -327 14.3359 0.0206
NP_442050.1_5 Forward -39 -29 7.94438 0.243
NP_442050.1_5 Forward -330 -320 7.64939 0.243
NP_442903.1_2 Forward -147 -128 5.96782 0.185
NP_442342.1_9 Reverse -188 -204 1.92682 0.296
NP_441114.1_3 Forward -66 -57 7.57121 0.231
NP_440558.1_2 Reverse -244 -263 3.83436 0.153
NP_440558.1_2 Reverse -310 -329 0.884433 0.185
NP_440558.1_2 Forward -110 -91 -5.01543 0.251
NP_440558.1_2 Reverse -363 -382 -5.9004 0.267
NP_440558.1_2 Reverse -49 -68 -7.67036 0.298
NP_441878.1_6 Forward -329 -319 10.4031 0.0176
NP_441878.1_6 Reverse -318 -328 10.4031 0.0176
NP_441878.1_6 Reverse -246 -256 -7.39479 0.222
NP_441036.1_8 Forward -329 -319 8.33817 0.174
NP_441036.1_8 Reverse -318 -328 8.33817 0.174
NP_442650.1_2 Reverse -319 -333 8.55439 0.13
NP_441534.1_5 Forward -171 -152 0.687771 0.293
NP_441557.1_5 Forward -328 -319 19.9609 0.000699
NP_441557.1_5 Reverse -319 -328 19.9609 0.000699
NP_441557.1_8 Forward -360 -350 11.6809 0.24
NP_441445.1_1 Reverse -310 -329 12.3892 0.0698
NP_441590.1_4 Forward -261 -242 10.52 0.249
NP_442419.1_2 Forward -333 -314 -0.0988766 0.243
NP_442419.1_2 Reverse -314 -333 -2.45882 0.247
NP_441458.1_10 Forward -370 -351 9.83255 0.151
NP_441458.1_10 Reverse -83 -102 9.73422 0.151
NP_441458.1_10 Reverse -310 -329 7.86593 0.192
NP_441458.1_10 Forward -110 -91 4.12936 0.236
NP_442830.1_5 Reverse -165 -179 -0.000988673 0.297
NP_442830.1_5 Reverse -366 -380 -1.67261 0.299
NP_442183.1_1 Forward -37 -23 8.94771 0.105
NP_442183.1_1 Reverse -319 -333 7.76774 0.131
NP_441574.1_1 Reverse -301 -320 -1.18052 0.215
NP_441574.1_1 Reverse -307 -326 -3.44213 0.238
NP_441549.1_9 Reverse -348 -366 -5.19239 0.198
NP_441549.1_9 Reverse -243 -261 -8.92897 0.238
NP_442347.1_2 Forward -327 -318 12.4878 0.056
NP_442347.1_2 Reverse -320 -329 12.4878 0.056
NP_442347.1_2 Reverse -191 -200 7.96454 0.122
NP_442645.1_2 Reverse -311 -330 -5.80207 0.0745
NP_442645.1_2 Forward -336 -317 -12.3902 0.144
NP_442645.1_2 Forward -109 -90 -15.5368 0.203
NP_442965.1_2 Forward -191 -172 -8.35868 0.283
NP_441037.1_4 Forward -330 -320 7.9999 0.237
NP_441037.1_4 Reverse -246 -256 7.12278 0.237
NP_441633.1_3 Reverse -317 -330 3.46087 0.0699
NP_441633.1_3 Forward -330 -317 1.19926 0.109
NP_441633.1_3 Forward -87 -74 -6.96221 0.283
NP_440136.1_2 Forward -327 -320 15.9687 0.0123
NP_440136.1_2 Reverse -320 -327 15.9687 0.0123
NP_440136.1_2 Reverse -29 -36 4.26735 0.218
NP_442590.1_10 Reverse -241 -260 7.7676 0.219
NP_442590.1_10 Forward -182 -163 5.89931 0.257
NP_442998.1_5 Forward -155 -145 8.53483 0.261
NP_442998.1_10 Forward -326 -319 15.5754 0.0102
NP_442998.1_10 Reverse -321 -328 15.5754 0.0102
NP_440299.1_1 Forward -332 -319 22.7331 0.000547
NP_440299.1_1 Forward -105 -92 12.5067 0.0369
NP_440299.1_1 Reverse -315 -328 10.6384 0.0557
NP_441799.1_1 Reverse -315 -329 13.1753 0.0348
NP_441799.1_1 Forward -332 -318 6.98048 0.155
NP_441007.1_10 Reverse -314 -327 1.39592 0.203
NP_441007.1_10 Forward -333 -320 1.00259 0.209
NP_441449.1_8 Forward -249 -230 16.6961 0.21
NP_440256.1_1 Reverse -316 -335 -0.0988766 0.0893
NP_440256.1_1 Forward -104 -85 -7.08038 0.228
NP_440256.1_1 Forward -331 -312 -10.0303 0.293
NP_441229.1_10 Forward -47 -28 2.45773 0.288
NP_442007.1_8 Forward -99 -81 11.2281 0.258
NP_441559.1_8 Reverse -71 -85 -1.8687 0.186
NP_441559.1_8 Reverse -172 -186 -4.22864 0.219
NP_441559.1_8 Reverse -24 -38 -5.21195 0.254
NP_441559.1_8 Reverse -314 -328 -6.39192 0.277
NP_440915.1_6 Forward -332 -318 3.44117 0.101
NP_440915.1_6 Reverse -315 -329 1.08123 0.147
NP_440717.1_2 Reverse -304 -323 -3.93378 0.238
NP_440164.1_6 Forward -314 -295 5.11266 0.286
NP_441704.1_8 Forward -339 -320 7.27514 0.245
NP_442866.1_1 Reverse -23 -42 -7.76869 0.268
NP_441464.1_10 Reverse -257 -271 9.83269 0.262
NP_440702.1_2 Reverse -230 -249 2.3594 0.254
NP_441939.1_3 Forward -327 -308 8.35759 0.175
NP_442993.1_1 Forward -328 -312 -8.88958 0.176
NP_442386.1_9 Reverse -318 -327 13.8639 0.0289
NP_442386.1_9 Forward -329 -320 13.8639 0.0289
NP_442386.1_9 Forward -263 -254 9.24241 0.168
NP_442386.1_9 Reverse -217 -226 7.2758 0.219
NP_442386.1_9 Reverse -27 -36 6.68581 0.219
NP_442386.1_9 Reverse -91 -100 5.21086 0.262
NP_442386.1_9 Forward -368 -359 4.91586 0.276
NP_441340.1_5 Forward -327 -320 15.6737 0.0124
NP_441340.1_5 Reverse -320 -327 15.6737 0.0124
NP_441340.1_5 Forward -100 -93 3.97235 0.274
NP_442484.1_2 Forward -339 -320 4.52268 0.186
NP_440146.1_2 Reverse -86 -100 11.6026 0.3
NP_442240.1_1 Reverse -170 -189 5.11187 0.264
NP_440586.1_1 Reverse -240 -259 -5.50708 0.285
NP_440586.1_1 Reverse -348 -367 -6.39206 0.299
NP_440586.1_8 Forward -327 -320 13.2151 0.026
NP_440586.1_8 Reverse -320 -327 13.2151 0.026
NP_442251.1_6 Forward -327 -320 15.2804 0.0124
NP_442251.1_6 Reverse -320 -327 15.2804 0.0124
NP_440684.1_9 Forward -334 -320 8.16106 0.235
NP_440684.1_9 Reverse -313 -327 6.6861 0.294
NP_441262.1_3 Reverse -319 -326 14.7888 0.0223
NP_441262.1_3 Forward -328 -321 14.7888 0.0223
NP_443051.1_1 Reverse -318 -327 10.4228 0.00754
NP_443051.1_1 Forward -329 -320 10.4228 0.00754
NP_440451.1_1 Reverse -77 -96 20.059 0.114
NP_440451.1_10 Forward -267 -248 13.3716 0.188
NP_439937.1_8 Forward -201 -182 2.0644 0.217
NP_439937.1_9 Forward -157 -140 1.02145 0.0948
NP_440408.1_3 Reverse -355 -374 -2.0655 0.246
NP_440408.1_7 Reverse -313 -332 9.83255 0.255
NP_440439.1_1 Reverse -316 -329 1.9859 0.138
NP_440439.1_1 Reverse -25 -38 0.904263 0.168
NP_439943.1_7 Reverse -314 -333 10.8159 0.161
NP_439943.1_7 Forward -333 -314 8.45592 0.181
NP_440372.1_2 Forward -327 -320 16.3621 0.0124
NP_440372.1_2 Reverse -320 -327 16.3621 0.0124
NP_441138.1_5 Reverse -129 -142 9.51548 0.238
NP_440316.1_10 Forward -287 -277 8.63316 0.239
NP_440316.1_10 Reverse -312 -322 5.68323 0.29
NP_441803.1_2 Reverse -23 -42 6.29264 0.155
NP_441803.1_2 Reverse -314 -333 4.32602 0.18
NP_442384.1_10 Reverse -319 -332 17.7189 0.00567
NP_442384.1_10 Forward -328 -315 11.9173 0.0319
NP_442384.1_10 Reverse -166 -179 0.510939 0.289
NP_440948.1_4 Reverse -90 -109 8.55425 0.296
NP_441877.1_7 Reverse -87 -106 2.9486 0.218
NP_441877.1_7 Reverse -314 -333 2.85027 0.218
NP_441018.1_7 Forward -332 -313 6.68596 0.283
NP_442790.1_4 Reverse -310 -329 -7.17871 0.151
NP_442262.1_10 Forward -327 -320 14.1988 0.0123
NP_442262.1_10 Reverse -320 -327 14.1988 0.0123
NP_442262.1_10 Reverse -197 -204 7.6106 0.274
NP_441689.1_5 Forward -330 -320 5.78111 0.197
NP_441689.1_5 Reverse -317 -327 5.78111 0.197
NP_440344.1_10 Forward -335 -318 1.71047 0.0299
NP_440344.1_10 Forward -368 -351 -10.3842 0.178
NP_440344.1_10 Reverse -183 -200 -11.8592 0.231
NP_440531.1_6 Reverse -311 -330 -2.65548 0.257
NP_441965.1_10 Forward -331 -315 4.0901 0.249
NP_442693.1_7 Forward -188 -169 12.3892 0.204
NP_440297.1_9 Forward -327 -317 -0.118297 0.282
NP_440297.1_9 Reverse -320 -330 -0.118297 0.282
NP_440297.1_9 Reverse -167 -177 -0.511621 0.289
NP_442280.1_10 Reverse -249 -267 15.0971 0.114
NP_441592.1_4 Forward -261 -242 11.6025 0.115
NP_441592.1_4 Forward -328 -309 3.83436 0.164
NP_441103.1_9 Reverse -169 -179 12.6848 0.29
NP_442078.1_9 Forward -361 -344 14.6902 0.21
NP_440999.1_9 Reverse -315 -329 0.589577 0.18
NP_440888.1_2 Forward -328 -314 13.372 0.0297
NP_440888.1_2 Reverse -319 -333 11.602 0.0635
NP_440888.1_2 Forward -107 -93 11.307 0.0705
NP_439969.1_3 Reverse -142 -161 0.687771 0.265
NP_442033.1_10 Forward -363 -344 -10.6203 0.243
NP_441543.1_2 Forward -327 -318 16.9127 0.00359
NP_441543.1_2 Reverse -320 -329 16.9127 0.00359
NP_442845.1_2 Forward -334 -320 15.2409 0.0752
NP_442845.1_2 Reverse -313 -327 8.16106 0.195
NP_441918.1_7 Reverse -318 -337 -3.14714 0.297
NP_441469.1_4 Forward -190 -171 6.88262 0.282
NP_441469.1_8 Reverse -366 -375 9.83282 0.227
NP_441469.1_8 Forward -329 -320 6.48957 0.227
NP_441469.1_8 Reverse -318 -327 6.48957 0.227
NP_441469.1_8 Reverse -91 -100 5.11294 0.289
NP_442315.1_1 Reverse -302 -320 12.8022 0.131
NP_443064.1_6 Forward -328 -318 12.5669 0.0796
NP_443064.1_6 Reverse -319 -329 12.5669 0.0796
NP_442578.1_7 Forward -327 -320 14.5921 0.026
NP_442578.1_7 Reverse -320 -327 14.5921 0.026
NP_441462.1_2 Forward -328 -318 11.5831 0.00406
NP_441462.1_2 Reverse -319 -329 11.5831 0.00406
NP_441621.1_7 Forward -375 -361 -5.80194 0.263
NP_443062.1_6 Reverse -68 -87 10.6192 0.112
NP_442204.1_1 Reverse -315 -326 1.82863 0.266
NP_442872.1_1 Forward -249 -230 -12.3902 0.255
NP_440516.1_8 Forward -328 -319 16.9127 0.00442
NP_440516.1_8 Reverse -319 -328 16.9127 0.00442
NP_440128.1_10 Forward -177 -158 14.5524 0.232
NP_442428.1_5 Forward -327 -320 15.8704 0.0124
NP_442428.1_5 Reverse -320 -327 15.8704 0.0124
NP_442428.1_5 Reverse -93 -100 4.759 0.223
NP_442120.1_10 Reverse -241 -260 -15.8318 0.296
NP_442823.1_9 Forward -345 -326 13.903 0.277
NP_440673.1_3 Forward -326 -319 12.4288 0.0426
NP_440673.1_3 Reverse -321 -328 12.4288 0.0426
NP_440718.1_2 Reverse -87 -106 13.4708 0.216
NP_441052.1_2 Forward -328 -318 19.9412 0.00106
NP_441052.1_2 Reverse -319 -329 19.9412 0.00106
NP_442219.1_9 Forward -327 -318 17.7976 0.00718
NP_442219.1_9 Reverse -320 -329 17.7976 0.00718
NP_440436.1_4 Forward -327 -318 17.2072 0.00233
NP_440436.1_4 Reverse -320 -329 17.2072 0.00233
NP_440436.1_4 Forward -100 -91 4.42421 0.265
NP_440314.1_9 Forward -327 -308 -8.16202 0.245
NP_442414.1_2 Reverse -226 -245 16.7157 0.134
NP_441719.1_4 Forward -327 -320 16.3621 0.0124
NP_441719.1_4 Reverse -320 -327 16.3621 0.0124
NP_441733.1_10 Reverse -25 -38 4.73917 0.244
NP_441004.1_1 Reverse -355 -374 -13.1769 0.255
NP_441004.1_1 Forward -106 -87 -13.4719 0.257
NP_441004.1_1 Forward -334 -315 -16.7168 0.287
NP_441004.1_1 Reverse -349 -368 -16.9135 0.287
NP_442366.1_3 Forward -329 -311 -5.29072 0.286
NP_442366.1_5 Forward -331 -321 15.4175 0.0374
NP_442139.1_7 Reverse -81 -100 12.2908 0.174
NP_442694.1_3 Forward -377 -359 -4.8974 0.276
NP_440328.1_8 Forward -104 -85 14.9579 0.294
NP_443054.1_2 Reverse -317 -331 -0.393733 0.294
NP_443054.1_2 Forward -258 -244 -0.590395 0.299
NP_442586.1_5 Reverse -83 -102 14.5524 0.292
NP_441851.1_10 Forward -329 -319 15.8113 0.00552
NP_441851.1_10 Reverse -318 -328 15.8113 0.00552
NP_442622.1_8 Forward -328 -310 -18.7621 0.268
NP_442856.1_7 Reverse -310 -329 14.3558 0.0483
NP_442856.1_7 Forward -289 -270 5.01433 0.131
NP_442856.1_7 Reverse -244 -263 -3.3438 0.243
NP_442856.1_7 Forward -370 -351 -6.49039 0.298
NP_441668.1_4 Forward -338 -319 -1.08219 0.267
NP_442515.1_1 Forward -329 -315 9.83269 0.0596
NP_442515.1_1 Reverse -318 -332 4.42448 0.107
NP_442515.1_1 Forward -277 -263 -2.45868 0.275
NP_440593.1_3 Forward -333 -314 3.44104 0.155
NP_440593.1_3 Reverse -314 -333 -3.3438 0.235
NP_440593.1_3 Forward -112 -93 -7.08038 0.285
NP_441349.1_10 Reverse -309 -328 7.07928 0.0326
NP_441349.1_10 Reverse -76 -95 -8.94866 0.28
NP_441409.1_6 Forward -334 -315 0.0977854 0.0655
NP_439960.1_10 Reverse -312 -330 2.77242 0.169
NP_440431.1_3 Reverse -318 -337 -2.16383 0.165
NP_442450.1_5 Forward -330 -320 7.55152 0.13
NP_440943.1_1 Reverse -239 -258 11.7008 0.242
NP_442006.1_2 Forward -295 -278 -16.3824 0.25
NP_441570.1_1 Forward -328 -310 -0.964162 0.0525
NP_441570.1_1 Reverse -232 -250 -13.7472 0.224
NP_440078.1_10 Forward -328 -309 7.57094 0.217
NP_441078.1_4 Forward -328 -319 19.6659 0.0007
NP_441078.1_4 Reverse -319 -328 19.6659 0.0007
NP_441078.1_4 Forward -361 -352 -0.983583 0.213
NP_442729.1_8 Forward -332 -319 9.36073 0.125
NP_441091.1_5 Reverse -186 -205 4.71934 0.26
NP_440526.1_3 Forward -327 -316 8.02298 0.126
NP_440526.1_3 Reverse -320 -331 1.04151 0.267
NP_441432.1_8 Reverse -318 -327 16.8143 0.00595
NP_441432.1_8 Forward -329 -320 16.8143 0.00595
NP_441432.1_8 Reverse -1 -10 2.94966 0.28
NP_441432.1_8 Forward -257 -248 2.85133 0.281
NP_442320.1_8 Forward -334 -320 15.7325 0.0102
NP_442320.1_8 Reverse -313 -327 -2.55701 0.0913
NP_441732.1_2 Forward -332 -316 -6.82463 0.0533
NP_441732.1_2 Forward -260 -244 -15.9694 0.164
NP_441732.1_2 Reverse -315 -331 -16.2644 0.165
NP_441732.1_2 Forward -365 -349 -17.346 0.253
NP_440760.1_1 Reverse -319 -338 5.99764 0.0115
NP_440760.1_1 Forward -328 -309 -7.17871 0.0685
NP_442797.1_2 Reverse -314 -332 19.4692 0.088
NP_441057.1_4 Reverse -348 -366 -1.16082 0.272
NP_441057.1_4 Reverse -82 -100 -1.84914 0.272
NP_442353.1_4 Reverse -86 -105 4.52188 0.205
NP_443011.1_4 Reverse -228 -247 20.2556 0.0325
NP_441072.1_2 Reverse -308 -327 18.1907 0.0585
NP_441072.1_2 Reverse -348 -367 11.7008 0.187
NP_440713.1_4 Reverse -309 -328 13.3725 0.0973
NP_442489.1_7 Forward -328 -319 20.1576 0.000695
NP_442489.1_7 Reverse -319 -328 20.1576 0.000695
NP_440559.1_1 Forward -327 -318 17.4043 0.00658
NP_440559.1_1 Reverse -320 -329 17.4043 0.00658
NP_441659.2_8 Forward -328 -318 18.1713 0.00133
NP_441659.2_8 Reverse -319 -329 18.1713 0.00133
NP_442913.1_9 Forward -334 -315 7.27595 0.289
NP_439956.1_7 Reverse -23 -42 8.35759 0.257
NP_440708.1_6 Reverse -168 -187 -9.63698 0.272
NP_441807.1_5 Reverse -341 -360 12.1925 0.142
NP_442346.1_5 Forward -329 -319 16.6963 0.00248
NP_442346.1_5 Reverse -318 -328 16.6963 0.00248
NP_442346.1_5 Forward -176 -166 4.50326 0.286
NP_440545.1_3 Forward -160 -143 1.71047 0.114
NP_440545.1_3 Forward -105 -88 -4.68105 0.23
NP_440545.1_3 Forward -332 -315 -5.07437 0.24
NP_440831.1_3 Reverse -310 -329 9.39653 0.202
NP_441923.1_6 Forward -294 -280 11.2093 0.25
NP_441923.1_6 Reverse -359 -373 8.84938 0.278
NP_441923.1_8 Forward -69 -55 11.8976 0.286
NP_441653.1_2 Reverse -308 -327 5.07576 0.248
NP_441653.1_5 Reverse -232 -249 22.2616 0.113
NP_440010.1_4 Reverse -315 -334 2.75194 0.222
NP_440010.1_4 Reverse -354 -373 -2.06626 0.273
NP_440847.1_3 Forward -22 -8 11.012 0.275
NP_441948.1_4 Forward -44 -26 -4.01242 0.214
NP_441047.1_2 Forward -100 -81 3.24438 0.231
NP_441047.1_2 Forward -366 -347 1.76941 0.239
NP_440170.1_5 Reverse -82 -101 11.9958 0.13
NP_441833.1_4 Forward -327 -320 15.9687 0.0124
NP_441833.1_4 Reverse -320 -327 15.9687 0.0124
NP_442060.1_5 Reverse -306 -325 15.8307 0.235
NP_442162.1_9 Forward -327 -320 16.2637 0.0124
NP_442162.1_9 Reverse -320 -327 16.2637 0.0124
NP_440671.1_4 Reverse -313 -327 9.93102 0.168
NP_440224.1_1 Reverse -308 -327 3.04771 0.132
NP_442073.1_6 Reverse -310 -329 -0.787193 0.269
NP_442140.1_3 Reverse -320 -330 12.2714 0.0632
NP_442140.1_3 Forward -327 -317 10.3048 0.0902
NP_442140.1_3 Reverse -359 -369 3.71661 0.283
NP_442723.1_1 Reverse -157 -176 3.04693 0.28
NP_440875.1_9 Forward -326 -316 8.37203 0.233
NP_441813.1_5 Reverse -317 -327 18.1713 0.00743
NP_441813.1_5 Forward -330 -320 8.63316 0.0367
NP_441813.1_5 Reverse -90 -100 -0.511621 0.247
NP_440594.1_3 Reverse -28 -46 18.6037 0.164
NP_440590.1_4 Reverse -320 -333 17.6205 0.00882
NP_440590.1_4 Forward -327 -314 2.96921 0.0783
NP_440567.1_1 Reverse -320 -334 14.4542 0.0187
NP_440567.1_1 Forward -327 -313 0.392915 0.246
NP_442497.1_10 Forward -327 -318 10.4228 0.0087
NP_442497.1_10 Reverse -320 -329 10.4228 0.0087
NP_440821.1_4 Reverse -317 -327 9.41981 0.0286
NP_440821.1_4 Forward -330 -320 9.41981 0.0286
NP_440821.1_4 Reverse -26 -36 3.51995 0.131
NP_441239.1_9 Reverse -317 -329 5.25052 0.223
NP_441239.1_9 Forward -330 -318 3.38223 0.285
NP_441727.1_3 Forward -335 -316 6.78429 0.24
NP_441892.1_1 Reverse -310 -327 -2.22277 0.219
NP_442325.1_3 Forward -247 -237 17.8758 0.273
NP_442193.1_3 Forward -106 -87 14.3434 0.299
NP_442643.1_1 Forward -334 -315 -11.3086 0.231
NP_443035.1_10 Reverse -360 -377 5.05372 0.282
NP_442138.1_10 Forward -328 -309 0.392778 0.14
NP_441782.1_5 Reverse -311 -330 7.07928 0.287
NP_440546.1_4 Forward -328 -318 10.046 0.109
NP_440546.1_4 Reverse -319 -329 10.046 0.109
NP_440546.1_4 Reverse -259 -269 8.30077 0.196
NP_440546.1_4 Forward -257 -247 6.8464 0.276
NP_440462.1_6 Reverse -317 -327 9.61647 0.0429
NP_440462.1_6 Reverse -26 -36 5.48657 0.15
NP_440462.1_6 Forward -330 -320 1.35667 0.294
NP_442340.1_3 Forward -105 -86 4.22769 0.113
NP_440868.1_4 Reverse -315 -327 14.7886 0.0169
NP_440868.1_4 Forward -332 -320 -0.944332 0.284
NP_440401.1_5 Reverse -141 -155 17.8958 0.16
NP_441249.1_8 Reverse -2 -21 4.916 0.253
NP_442402.1_2 Reverse -207 -221 11.4053 0.272
NP_442402.1_4 Reverse -202 -221 -5.31116 0.24
NP_442402.1_4 Reverse -139 -158 -8.06442 0.278
NP_442402.1_10 Reverse -271 -281 10.5993 0.287
NP_440653.1_10 Reverse -320 -339 5.40766 0.23
NP_442460.1_7 Reverse -307 -326 3.34271 0.222
NP_440696.1_3 Reverse -76 -94 -0.964162 0.249
NP_440696.1_6 Reverse -236 -255 4.81767 0.285
NP_442039.1_4 Forward -327 -320 15.1821 0.0124
NP_442039.1_4 Reverse -320 -327 15.1821 0.0124
NP_442039.1_4 Reverse -353 -360 6.13563 0.297
NP_442039.1_7 Forward -293 -283 11.4848 0.257
NP_440825.1_7 Reverse -320 -330 12.9096 0.152
NP_442696.1_6 Forward -89 -70 -12.9802 0.256
NP_442837.1_3 Forward -327 -320 15.7721 0.0124
NP_442837.1_3 Reverse -320 -327 15.7721 0.0124
NP_442053.1_1 Forward -328 -319 18.3876 0.0007
NP_442053.1_1 Reverse -319 -328 18.3876 0.0007
NP_442053.1_1 Forward -361 -352 3.83464 0.285
NP_440505.1_3 Reverse -317 -327 18.3679 0.00213
NP_440505.1_3 Forward -330 -320 9.22315 0.122
NP_440505.1_7 Reverse -174 -193 -0.983855 0.271
NP_440505.1_7 Forward -260 -241 -2.65548 0.289
NP_440207.2_8 Forward -106 -87 17.0107 0.258
NP_441408.2_7 Forward -264 -245 -4.13045 0.279
NP_440914.1_1 Forward -328 -318 17.5935 0.000537
NP_440914.1_1 Reverse -319 -329 17.5935 0.000537
NP_442470.1_5 Reverse -130 -144 20.7474 0.125
NP_441011.1_8 Forward -36 -27 9.04618 0.141
NP_441011.1_8 Forward -327 -318 8.25953 0.144
NP_441011.1_8 Reverse -320 -329 8.25953 0.144
NP_442533.1_1 Forward -172 -153 1.57275 0.118
NP_442533.1_1 Reverse -229 -248 -3.63879 0.14
NP_442533.1_1 Reverse -304 -323 -6.09707 0.161
NP_442533.1_6 Forward -328 -319 17.2076 0.00137
NP_442533.1_6 Reverse -319 -328 17.2076 0.00137
NP_442533.1_6 Reverse -248 -257 1.86802 0.284
NP_442533.1_6 Reverse -367 -376 1.37636 0.3
NP_442541.1_10 Reverse -196 -210 8.3571 0.219
NP_442232.1_1 Forward -335 -316 -0.295539 0.298
NP_442232.1_3 Forward -109 -90 -5.50708 0.165
NP_441482.1_7 Reverse -313 -327 -0.885388 0.0612
NP_441482.1_7 Forward -334 -320 -0.983719 0.0612
NP_441482.1_7 Forward -262 -248 -11.3085 0.254
NP_441108.1_1 Forward -226 -207 15.6341 0.158
NP_439944.1_9 Forward -327 -317 10.5014 0.0887
NP_439944.1_9 Reverse -320 -330 10.5014 0.0887
NP_441028.1_6 Reverse -149 -159 6.0761 0.232
NP_441028.1_6 Reverse -272 -282 3.51951 0.292
NP_439945.1_2 Reverse -338 -355 17.7673 0.237
NP_440116.1_5 Reverse -256 -273 4.85706 0.178
NP_440115.1_6 Reverse -316 -326 16.008 0.0325
NP_439965.1_1 Reverse -310 -329 -2.75381 0.177
NP_441347.1_5 Reverse -313 -327 9.14375 0.278
NP_441059.1_2 Reverse -354 -373 -3.14714 0.242
NP_441961.1_1 Reverse -69 -88 12.9791 0.226
NP_441972.1_5 Reverse -81 -100 2.85105 0.121
NP_441972.1_5 Reverse -320 -339 -3.54046 0.2
NP_441972.1_5 Forward -372 -353 -7.4737 0.249
NP_441106.1_1 Forward -329 -320 9.63616 0.0311
NP_441106.1_1 Reverse -318 -327 9.63616 0.0311
NP_441106.1_1 Reverse -91 -100 4.71961 0.21
NP_439903.1_6 Reverse -316 -335 1.17865 0.253
NP_441286.1_1 Forward -329 -317 12.9203 0.00815
NP_441286.1_1 Reverse -318 -330 12.9203 0.00815
NP_441286.1_1 Reverse -363 -375 1.80894 0.0791
NP_442674.1_3 Forward -45 -26 5.30853 0.269
NP_440670.1_8 Forward -328 -319 18.3876 0.000699
NP_440670.1_8 Reverse -319 -328 18.3876 0.000699
NP_441705.1_3 Forward -170 -151 -6.78538 0.296
NP_440886.1_4 Forward -176 -157 13.5691 0.274
NP_440886.1_7 Forward -329 -319 7.94438 0.0805
NP_440886.1_7 Reverse -318 -328 7.94438 0.0805
NP_440886.1_7 Forward -362 -352 6.37109 0.13
NP_442614.1_2 Forward -328 -314 7.9644 0.257
NP_442614.1_2 Forward -175 -161 7.47274 0.273
NP_442382.1_9 Forward -111 -92 7.76679 0.29
NP_442072.1_9 Reverse -318 -336 -21.8103 0.212
NP_441808.1_8 Reverse -295 -314 6.68596 0.284
NP_440907.2_8 Reverse -320 -330 7.64939 0.117
NP_440907.2_8 Forward -36 -26 4.10949 0.278
NP_442264.1_4 Forward -190 -176 16.9125 0.228
NP_441021.1_1 Forward -327 -308 -5.80207 0.177
NP_441021.1_1 Reverse -320 -339 -6.88371 0.181
NP_440841.1_4 Forward -330 -311 -5.31042 0.208
NP_440841.1_4 Reverse -317 -336 -8.65367 0.25
NP_442459.1_10 Forward -214 -195 17.3057 0.165
NP_441463.1_3 Reverse -309 -328 -10.4236 0.294
NP_441626.1_2 Forward -327 -320 15.7721 0.0124
NP_441626.1_2 Reverse -320 -327 15.7721 0.0124
NP_441589.1_5 Reverse -91 -110 15.3999 0.267
NP_442794.1_1 Forward -332 -320 19.1152 0.00716
NP_442794.1_1 Reverse -315 -327 10.2654 0.0721
NP_442794.1_1 Reverse -174 -186 4.66053 0.251
NP_442615.1_1 Reverse -310 -328 7.88563 0.0304
NP_442615.1_1 Forward -337 -319 -0.374176 0.115
NP_441962.1_4 Forward -333 -314 -11.8003 0.245
NP_441962.1_4 Reverse -314 -333 -12.1936 0.253
NP_441796.1_8 Reverse -276 -294 10.8356 0.222
NP_440387.1_1 Reverse -319 -335 14.3165 0.00649
NP_440387.1_1 Forward -328 -312 -2.98973 0.153
NP_440855.1_5 Reverse -84 -103 7.07848 0.285
NP_440855.1_5 Forward -99 -80 1.96529 0.295
NP_441431.1_2 Reverse -316 -330 10.422 0.159
NP_441488.1_8 Forward -333 -319 10.2254 0.146
NP_441836.1_2 Forward -334 -315 -4.22878 0.255
NP_441836.1_2 Reverse -313 -332 -5.21209 0.275
NP_440634.1_10 Forward -250 -231 5.50519 0.269
NP_441993.1_1 Forward -334 -315 20.3661 0.0256
NP_441174.1_4 Forward -191 -181 11.6814 0.288
NP_440358.1_2 Reverse -154 -171 13.3128 0.219
NP_442323.1_7 Forward -73 -54 1.17865 0.289
NP_440293.1_3 Forward -264 -245 -5.80207 0.282
NP_441237.1_9 Reverse -320 -330 14.828 0.0242
NP_442743.1_5 Forward -327 -308 8.45592 0.148
NP_439910.1_2 Forward -336 -319 -22.2823 0.22
NP_440457.1_1 Reverse -315 -327 0.628964 0.25
NP_442940.1_2 Forward -328 -309 -0.39387 0.296
NP_442940.1_2 Forward -322 -303 -0.590531 0.296
NP_442940.1_2 Forward -91 -72 -0.688862 0.296
NP_442680.1_5 Forward -158 -139 3.68677 0.227
NP_440801.1_8 Forward -329 -310 5.01433 0.192
NP_440142.1_7 Forward -261 -242 11.1109 0.202
NP_441332.1_6 Forward -248 -238 11.7436 0.252
NP_440473.1_1 Forward -244 -225 11.643 0.267
NP_442509.1_9 Forward -328 -318 8.14104 0.192
NP_442509.1_9 Reverse -319 -329 8.14104 0.192
NP_442784.1_3 Forward -106 -87 16.9124 0.264
NP_442514.1_10 Reverse -46 -65 10.0292 0.253
NP_440554.1_4 Forward -327 -317 8.92815 0.0646
NP_440554.1_4 Forward -100 -90 6.07655 0.128
NP_442862.1_3 Reverse -227 -244 5.05372 0.28
NP_441845.1_6 Forward -322 -304 -1.84914 0.299
NP_441885.1_5 Forward -328 -318 20.9245 0.000538
NP_441885.1_5 Reverse -319 -329 20.9245 0.000538
NP_441885.1_5 Forward -361 -351 0.668351 0.133
NP_440478.1_4 Forward -332 -313 10.9142 0.266
NP_440478.1_10 Forward -369 -355 14.3559 0.111
NP_440478.1_10 Forward -330 -316 7.9644 0.257
NP_442341.1_7 Reverse -318 -332 17.4042 0.012
NP_441173.1_9 Forward -47 -39 12.9004 0.206
NP_441173.1_9 Reverse -214 -222 9.85212 0.275
NP_440423.1_6 Reverse -311 -330 -14.9469 0.229
NP_443000.1_7 Reverse -317 -327 19.9412 0.00223
NP_443000.1_7 Forward -330 -320 10.3048 0.0345
NP_440507.2_3 Reverse -19 -38 7.66846 0.273
NP_440507.2_3 Forward -319 -300 6.78348 0.299
NP_440275.1_3 Reverse -317 -327 15.123 0.0182
NP_440275.1_3 Forward -330 -320 8.04317 0.0602
NP_440560.1_1 Forward -142 -123 22.4416 0.0126
NP_440091.1_1 Reverse -315 -327 -0.452677 0.273
NP_443060.1_5 Reverse -311 -330 4.91521 0.276
NP_440679.1_10 Reverse -360 -379 -21.1417 0.292
NP_440679.1_10 Reverse -294 -313 -21.83 0.3
NP_442451.1_2 Reverse -311 -330 -10.6203 0.277
NP_439962.1_4 Forward -106 -87 -8.35868 0.293
NP_440149.1_8 Reverse -352 -371 -3.93378 0.201
NP_441105.1_3 Forward -339 -320 5.50599 0.0678
NP_441105.1_3 Reverse -81 -100 1.27776 0.115
NP_441105.1_3 Reverse -308 -327 -1.57384 0.15
NP_441105.1_3 Reverse -347 -366 -6.88371 0.243
NP_442373.1_2 Reverse -80 -99 -11.9969 0.298
NP_440216.1_1 Forward -328 -314 7.27608 0.00942
NP_440216.1_1 Reverse -319 -333 -10.6202 0.145
NP_440216.1_9 Forward -260 -251 6.98123 0.289
NP_440172.1_1 Forward -328 -318 15.0247 0.00945
NP_440172.1_1 Reverse -319 -329 15.0247 0.00945
NP_440167.1_3 Forward -101 -82 7.66927 0.296
NP_442015.1_10 Reverse -315 -328 11.4257 0.0372
NP_442015.1_10 Forward -332 -319 11.229 0.0372
NP_442015.1_10 Forward -15 -2 -1.06236 0.293
NP_441045.1_2 Forward -289 -270 17.2074 0.112
NP_441226.1_7 Forward -327 -320 14.4934 0.0123
NP_441226.1_7 Reverse -320 -327 14.4934 0.0123
NP_441111.1_7 Forward -327 -319 18.7023 0.00294
NP_441111.1_7 Reverse -320 -328 18.7023 0.00294
NP_441766.1_2 Forward -328 -319 17.5026 0.00297
NP_441766.1_2 Reverse -319 -328 17.5026 0.00297
NP_440416.1_9 Forward -108 -89 -1.57384 0.0652
NP_440416.1_9 Forward -335 -316 -7.67036 0.105
NP_440416.1_9 Forward -368 -349 -11.9969 0.155
NP_440416.1_9 Reverse -170 -189 -15.3402 0.189
NP_443052.1_9 Forward -368 -349 5.89931 0.138
NP_443052.1_9 Forward -99 -80 4.12936 0.156
NP_443052.1_9 Forward -365 -346 0.884433 0.191
NP_443052.1_9 Forward -248 -229 -0.983855 0.219
NP_443052.1_9 Forward -374 -355 -5.40875 0.27
NP_440591.1_9 Reverse -12 -30 11.6222 0.0943
NP_440591.1_9 Reverse -351 -369 5.62401 0.241
NP_442154.1_1 Forward -294 -276 -15.4188 0.218
NP_442154.1_1 Reverse -302 -320 -16.4021 0.239
NP_440261.1_5 Forward -327 -314 -2.73398 0.0924
NP_440261.1_5 Forward -255 -242 -6.17557 0.196
NP_440988.1_10 Forward -330 -316 6.44783 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTCATAGTTGTAGTAATAATGCAGAGGCACGTCCGCCACGGCTAGCTCCAGCAAACCTTCATAAAATGCTTTGGCGATCGCCAGGTCCGACACCATCACTGTGTACACCTTGGGGGCACTGGTGAGAAATAACCACATAGCCAAGGCATAGGCCCCCAACAGCATCACCATAATGCCTTGGGTGGAAAACAAGCTGTCAATGGGAATCAAGGCGGCGAAATGCAGGGGCATGGTTAGGAAACTGGGGGATAGAACCCGAAATAATCAGCGAAAATTGTATTGTTAGGATCATTAGGCTTTGCCACCGCTGGAGCCAGCAAACACCGTCCAACTAGCATTGCCCTTGGGATACATTCTACCAAGAGCTATCCCGGCGTTCCAAACTTCCCTCCGATAACCT

CDS

ATGGACCAGTTGGATCAATTGAGTGATTATTTTCCCCCTCCCCTCCCGGTGGGCCAAACCCTTTTTGATTGGGGCAAACGCACCTATGTGATGGGAATTTTGAATACTACGCCGGACAGTTTTAGTGATGGGGGCGAATTTAACTCTCTACCAACGGCCATCCACCAGGCTAAAACCATGGTGCAGGGGGGAGCACACATTATTGACATTGGCGGCCAGTCCACCCGACCGGGGGCAGAAACTGTTAGCTTGAAGGAAGAATTAGAGCGCACTATTCCGATTATCCAAGCTCTCCGGCAAGAATTAGACATTCCCATTTCCATCGATACCACCAGGGCGGAAGTGGCACGACAAGCTCTCCAAGCCGGAGCGGATATGGTCAACGATATTTCCGGAGCTACCTTTGAACCAGAAATTTTGGCGGTCGCCGCCCAGCACAAGGCTCCGATTATTTTGATGCACATACGGGGTAACCCCCAAACTATGCAAAATTTGACGGATTATGGGGATTTAATCGGGGAAATGAGGCAGTTTTTCAGCGCCCAAGTAGATCTAGCCCGCCATTACGGCGTATTGCCCGAACAGATTATCCTTGACCCAGGCATTGGCTTTGCTAAAACCGCTGAGCAAAATATTACCCTACTGCGCCAGTTACCGGAGCTAAAAAGACTTGGTTTTCCCCTATTGGTGGGGCCATCCCGGAAAAGTTTCATTGGCAAAATTCTTGACCAACCTGATCCGAAGGAAAGAGTTTGGGGTACTGGGGCGACCTGCTGTCGGGCGATCGCCGGGGGAGCAGATATAGTCAGAGTCCATGATGTGGAAGCCATGGCCCAGATATGTAAGGTTGCAGATGCCCTATGGCGATGA

Protein

MDQLDQLSDYFPPPLPVGQTLFDWGKRTYVMGILNTTPDSFSDGGEFNSLPTAIHQAKTMVQGGAHIIDIGGQSTRPGAETVSLKEELERTIPIIQALRQELDIPISIDTTRAEVARQALQAGADMVNDISGATFEPEILAVAAQHKAPIILMHIRGNPQTMQNLTDYGDLIGEMRQFFSAQVDLARHYGVLPEQIILDPGIGFAKTAEQNITLLRQLPELKRLGFPLLVGPSRKSFIGKILDQPDPKERVWGTGATCCRAIAGGADIVRVHDVEAMAQICKVADALWR