Your browser is old and dusty. Try Google Chrome!

Details for slr2023

ORF slr2023
Accession NP_440589.1
Symbol fabD
Category malonyl coenzyme A-acyl carrier protein transacylase
Definition Fatty acid, phospholipid and sterol metabolism
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -258 -272 8.65272 0.0856
NP_440795.1_7 Forward -265 -258 14.6904 0.0123
NP_440795.1_7 Reverse -258 -265 14.6904 0.0123
NP_440795.1_7 Reverse -133 -140 10.2655 0.154
NP_441418.1_6 Reverse -257 -276 -18.1918 0.0827
NP_442291.1_5 Forward -267 -251 -3.48138 0.242
NP_442291.1_7 Reverse -187 -201 9.2427 0.291
NP_442272.1_2 Reverse -15 -34 12.4613 0.217
NP_441453.1_4 Reverse -257 -265 16.539 0.00633
NP_441453.1_4 Forward -266 -258 16.539 0.00633
NP_441453.1_4 Forward -141 -133 4.14932 0.264
NP_442151.1_1 Reverse -130 -149 3.53937 0.287
NP_442151.1_6 Reverse -257 -271 11.6026 0.0956
NP_441818.1_1 Forward -265 -254 16.7744 0.0118
NP_440226.1_1 Reverse -257 -276 4.81767 0.178
NP_441465.1_8 Reverse -114 -132 5.62401 0.286
NP_441630.1_3 Forward -311 -292 5.11266 0.149
NP_442623.1_3 Reverse -258 -277 -18.4868 0.263
NP_441098.1_3 Forward -34 -15 2.2072 0.25
NP_442173.1_1 Forward -265 -257 15.4574 0.00633
NP_442173.1_1 Reverse -258 -266 15.4574 0.00633
NP_442173.1_1 Reverse -133 -141 4.73931 0.258
NP_442752.1_4 Forward -266 -259 13.8055 0.0199
NP_442752.1_4 Reverse -257 -264 13.8055 0.0199
NP_442752.1_4 Forward -347 -340 5.64398 0.176
NP_442975.1_10 Reverse -253 -267 4.42388 0.245
NP_442975.1_10 Forward -270 -256 1.67063 0.293
NP_440784.1_7 Forward -265 -258 15.9687 0.0123
NP_440784.1_7 Reverse -258 -265 15.9687 0.0123
NP_440061.1_5 Forward -63 -44 15.2408 0.212
NP_440061.1_9 Forward -268 -254 13.4703 0.0811
NP_441054.1_2 Reverse -223 -242 10.4225 0.284
NP_440878.1_9 Forward -151 -132 3.04771 0.174
NP_441499.1_1 Reverse -79 -98 21.3373 0.0843
NP_442062.1_8 Forward -266 -256 17.6796 0.00193
NP_442062.1_8 Reverse -257 -267 17.3846 0.00193
NP_441900.1_2 Forward -378 -360 -2.14486 0.274
NP_441859.1_3 Forward -267 -248 4.62021 0.217
NP_442972.1_1 Reverse -137 -155 7.48186 0.291
NP_440304.1_4 Reverse -255 -265 9.91146 0.051
NP_440304.1_4 Forward -268 -258 1.84832 0.299
NP_442242.1_4 Forward -265 -258 14.3954 0.0124
NP_442242.1_4 Reverse -258 -265 14.3954 0.0124
NP_442207.1_4 Forward -365 -346 7.17762 0.285
NP_442602.1_3 Forward -102 -83 -0.688862 0.226
NP_442367.1_4 Reverse -146 -165 12.6841 0.102
NP_440330.1_2 Reverse -245 -264 9.24257 0.297
NP_440856.1_4 Reverse -250 -269 -1.47551 0.201
NP_441083.1_5 Reverse -257 -267 20.3345 0.00053
NP_441083.1_5 Forward -266 -256 19.3512 0.000718
NP_441434.1_7 Forward -264 -250 5.80112 0.225
NP_441738.1_2 Forward -264 -257 15.28 0.0102
NP_441738.1_2 Reverse -259 -266 15.28 0.0102
NP_441558.1_5 Reverse -255 -274 4.62101 0.276
NP_440209.1_1 Reverse -257 -265 18.1123 0.00295
NP_440209.1_1 Forward -266 -258 18.1123 0.00295
NP_442889.1_1 Reverse -113 -132 -5.9004 0.184
NP_442889.1_8 Reverse -254 -268 21.6317 0.0025
NP_442889.1_10 Reverse -21 -40 12.8296 0.195
NP_441713.1_4 Forward -259 -240 13.3725 0.143
NP_441770.1_4 Forward -60 -41 -12.3902 0.291
NP_440178.1_7 Reverse -256 -275 -20.3551 0.188
NP_440178.1_7 Forward -267 -248 -20.7484 0.199
NP_442570.1_3 Reverse -117 -136 4.916 0.159
NP_442570.1_3 Reverse -116 -135 0.982764 0.2
NP_441716.1_1 Reverse -257 -271 3.63784 0.259
NP_442111.1_4 Reverse -256 -270 8.65272 0.0709
NP_442111.1_4 Forward -267 -253 4.12949 0.219
NP_440906.1_5 Forward -265 -258 15.8704 0.0124
NP_440906.1_5 Reverse -258 -265 15.8704 0.0124
NP_441924.1_8 Reverse -333 -352 21.7306 0.142
NP_440747.1_10 Forward -269 -257 14.887 0.00223
NP_440747.1_10 Reverse -254 -266 7.4138 0.00422
NP_440747.1_10 Forward -326 -314 -12.2524 0.254
NP_441130.1_10 Forward -268 -254 8.84938 0.131
NP_441486.1_1 Reverse -254 -268 6.19444 0.0344
NP_441486.1_1 Forward -269 -255 6.19444 0.0344
NP_441486.1_1 Forward -144 -130 2.06454 0.0918
NP_441486.1_1 Reverse -182 -196 0.88457 0.124
NP_441486.1_1 Reverse -129 -143 -3.24533 0.177
NP_442634.1_4 Reverse -255 -269 -3.147 0.161
NP_442634.1_4 Forward -59 -45 -3.44199 0.161
NP_441014.1_8 Forward -318 -299 -5.11376 0.263
NP_441014.1_8 Forward -140 -121 -6.88371 0.276
NP_441014.1_10 Reverse -35 -54 -0.197979 0.248
NP_442848.1_1 Forward -272 -258 -0.983719 0.263
NP_442848.1_9 Forward -322 -303 4.32602 0.206
NP_442848.1_9 Reverse -186 -205 1.96607 0.255
NP_443018.1_3 Forward -265 -258 14.8871 0.0123
NP_443018.1_3 Reverse -258 -265 14.8871 0.0123
NP_443018.1_3 Reverse -133 -140 4.36568 0.254
NP_443018.1_3 Forward -140 -133 4.07068 0.299
NP_441634.1_8 Reverse -273 -287 -3.34366 0.295
NP_441634.1_8 Forward -268 -254 -4.62196 0.295
NP_441634.1_9 Forward -86 -67 12.9783 0.191
NP_440376.1_1 Forward -266 -257 19.4693 0.000692
NP_440376.1_1 Reverse -257 -266 19.4693 0.000692
NP_441857.1_6 Forward -355 -345 16.4996 0.199
NP_441857.1_6 Forward -202 -192 13.5497 0.269
NP_441588.1_4 Reverse -259 -269 15.9097 0.0369
NP_441588.1_4 Reverse -134 -144 6.17489 0.206
NP_442687.1_7 Reverse -256 -266 18.5646 0.0028
NP_442687.1_7 Forward -267 -257 8.92815 0.0994
NP_442687.1_7 Forward -195 -185 4.89658 0.23
NP_442687.1_7 Forward -188 -178 4.60159 0.243
NP_441077.1_6 Reverse -18 -34 12.3461 0.136
NP_442485.1_3 Forward -111 -92 3.53937 0.198
NP_442946.1_7 Reverse -34 -49 12.3223 0.284
NP_441013.1_2 Reverse -303 -321 5.91901 0.208
NP_440533.1_9 Forward -266 -247 4.71934 0.22
NP_442296.1_9 Reverse -258 -277 2.26107 0.176
NP_442296.1_9 Forward -140 -121 -4.6221 0.28
NP_440360.1_10 Reverse -187 -201 11.996 0.137
NP_442658.1_1 Reverse -255 -265 16.0075 0.00966
NP_442658.1_1 Forward -244 -234 7.15773 0.214
NP_442658.1_1 Forward -268 -258 6.76441 0.214
NP_442782.1_2 Reverse -219 -233 0.982901 0.282
NP_442544.1_2 Forward -53 -39 -1.5737 0.287
NP_441414.1_9 Reverse -257 -276 -0.197208 0.0875
NP_441256.1_1 Forward -263 -244 -7.86702 0.239
NP_442937.1_5 Forward -271 -252 14.2574 0.0802
NP_442937.1_5 Reverse -267 -286 6.98095 0.265
NP_442937.1_5 Reverse -252 -271 6.29264 0.282
NP_442937.1_5 Reverse -31 -50 6.09597 0.288
NP_441958.1_5 Reverse -256 -266 20.5312 0.000966
NP_441958.1_5 Forward -267 -257 12.2714 0.00183
NP_441958.1_5 Reverse -131 -141 0.0783647 0.168
NP_441958.1_6 Reverse -137 -151 20.0584 0.154
NP_442836.1_10 Forward -355 -345 9.61647 0.274
NP_442025.1_8 Reverse -185 -204 16.7157 0.154
NP_440984.1_7 Forward -110 -96 8.75105 0.137
NP_440984.1_7 Reverse -252 -266 5.30946 0.259
NP_439990.1_5 Forward -271 -258 11.0324 0.128
NP_442376.1_2 Forward -348 -329 -6.49039 0.286
NP_442690.1_1 Forward -162 -143 -7.86702 0.179
NP_442911.1_2 Forward -276 -257 -0.590531 0.0769
NP_442911.1_2 Reverse -247 -266 -2.45882 0.0982
NP_442911.1_2 Reverse -51 -70 -10.6203 0.284
NP_440153.1_5 Forward -325 -311 0.687908 0.291
NP_440369.1_6 Reverse -243 -262 15.1424 0.17
NP_442064.1_4 Reverse -115 -134 5.01354 0.281
NP_443055.1_6 Reverse -249 -267 6.70489 0.165
NP_443055.1_6 Reverse -83 -101 2.08335 0.22
NP_443055.1_6 Forward -274 -256 -1.6532 0.281
NP_442236.1_7 Reverse -118 -137 11.0125 0.216
NP_440993.1_4 Forward -134 -117 9.77361 0.213
NP_441099.1_5 Forward -276 -257 7.17762 0.0429
NP_441099.1_5 Reverse -247 -266 -2.36049 0.12
NP_442002.1_9 Reverse -256 -263 14.1004 0.074
NP_441294.1_7 Reverse -253 -267 18.3695 0.0057
NP_441646.1_1 Forward -273 -254 9.63589 0.125
NP_441752.1_6 Forward -294 -275 1.37609 0.257
NP_441000.1_6 Forward -267 -253 5.01447 0.0933
NP_442771.1_1 Reverse -255 -273 -5.58572 0.166
NP_442771.1_1 Forward -118 -100 -10.8956 0.29
NP_440147.1_4 Forward -268 -255 19.2922 0.00305
NP_440147.1_4 Reverse -255 -268 10.639 0.0355
NP_441125.1_6 Forward -165 -152 15.4572 0.214
NP_441295.1_4 Forward -271 -252 -4.52377 0.29
NP_441550.1_8 Reverse -255 -265 18.1707 0.00754
NP_441550.1_8 Forward -268 -258 14.6309 0.0132
NP_441916.1_7 Forward -266 -256 16.893 0.00407
NP_441916.1_7 Reverse -257 -267 10.3048 0.0261
NP_441916.1_7 Forward -141 -131 6.27322 0.102
NP_441041.1_4 Reverse -257 -276 -2.26216 0.109
NP_441041.1_7 Reverse -254 -266 20.245 0.00277
NP_441041.1_7 Reverse -129 -141 6.44582 0.21
NP_442396.1_5 Forward -270 -257 12.114 0.0913
NP_442004.1_6 Forward -347 -333 3.8345 0.231
NP_441725.1_4 Forward -271 -257 2.26061 0.287
NP_441725.1_5 Forward -265 -255 11.7798 0.0247
NP_441725.1_5 Reverse -258 -268 2.04498 0.115
NP_441725.1_5 Forward -140 -130 -0.314959 0.246
NP_439966.1_7 Forward -381 -371 11.091 0.0741
NP_439966.1_7 Reverse -255 -265 8.63269 0.132
NP_439966.1_7 Forward -268 -258 7.25606 0.15
NP_442941.1_3 Reverse -258 -268 11.0914 0.0116
NP_442941.1_3 Forward -265 -255 10.6981 0.0116
NP_440289.1_2 Reverse -254 -267 21.9471 0.00262
NP_440289.1_2 Forward -269 -256 -2.144 0.251
NP_440260.1_8 Forward -275 -257 1.88744 0.182
NP_441514.1_4 Reverse -17 -36 13.1825 0.269
NP_442281.1_1 Reverse -252 -266 18.9768 0.00347
NP_442281.1_1 Forward -271 -257 9.53707 0.0685
NP_442281.1_1 Reverse -127 -141 5.21053 0.166
NP_442281.1_1 Forward -132 -118 1.76896 0.29
NP_441079.1_1 Forward -348 -329 15.6341 0.239
NP_441079.1_7 Forward -38 -19 -3.04956 0.228
NP_440177.1_9 Forward -274 -255 16.5191 0.165
NP_442256.1_2 Reverse -255 -273 2.18243 0.107
NP_441081.1_1 Forward -74 -55 16.4207 0.169
NP_440498.1_1 Forward -275 -257 -2.93078 0.252
NP_442068.1_8 Forward -322 -303 13.1758 0.107
NP_441644.1_6 Reverse -257 -267 17.3841 0.00127
NP_441644.1_6 Forward -266 -256 15.7125 0.0048
NP_441644.1_6 Reverse -314 -324 8.73102 0.0944
NP_441644.1_6 Reverse -132 -142 3.61784 0.272
NP_440867.1_10 Forward -281 -262 19.2723 0.0844
NP_440867.1_10 Forward -142 -123 3.93269 0.283
NP_440867.1_10 Forward -320 -301 2.16274 0.291
NP_442215.1_2 Reverse -116 -132 7.92501 0.0666
NP_442215.1_2 Forward -143 -127 7.13836 0.0694
NP_442215.1_2 Reverse -34 -50 2.61514 0.112
NP_442215.1_2 Forward -268 -252 0.255197 0.154
NP_442215.1_2 Reverse -176 -192 -5.25134 0.248
NP_442029.1_6 Forward -353 -334 5.11266 0.255
NP_442247.1_8 Forward -381 -367 10.3243 0.247
NP_440253.1_2 Reverse -257 -275 6.01734 0.0864
NP_440253.1_2 Forward -266 -248 -2.3408 0.265
NP_440929.1_8 Forward -266 -257 19.2726 0.000701
NP_440929.1_8 Reverse -257 -266 19.2726 0.000701
NP_442933.1_2 Reverse -12 -30 12.7979 0.227
NP_442933.1_10 Forward -266 -257 17.601 0.00325
NP_442933.1_10 Reverse -257 -266 17.601 0.00325
NP_442933.1_10 Reverse -132 -141 5.11294 0.204
NP_442933.1_10 Forward -206 -197 4.52295 0.24
NP_441751.2_8 Forward -265 -251 2.06454 0.0884
NP_442554.1_8 Reverse -258 -268 15.3197 0.00882
NP_442554.1_8 Forward -265 -255 15.123 0.00944
NP_442554.1_8 Forward -140 -130 3.61828 0.218
NP_442554.1_8 Reverse -186 -196 2.33998 0.274
NP_442554.1_8 Reverse -62 -72 1.84832 0.292
NP_442167.1_6 Forward -313 -297 12.0542 0.229
NP_441762.1_7 Reverse -256 -268 8.9871 0.0142
NP_441762.1_7 Forward -267 -255 -6.84419 0.284
NP_442142.1_4 Reverse -254 -267 11.9167 0.0504
NP_442142.1_4 Forward -326 -313 3.7553 0.246
NP_442292.1_1 Reverse -258 -267 18.486 0.00229
NP_442292.1_1 Forward -265 -256 9.53783 0.0183
NP_440122.1_2 Forward -274 -255 5.40766 0.234
NP_441525.1_1 Reverse -334 -347 13.3923 0.241
NP_442476.1_6 Forward -265 -251 2.35953 0.186
NP_442381.1_8 Reverse -254 -273 1.86774 0.103
NP_442381.1_8 Reverse -246 -265 -3.63879 0.126
NP_443009.1_5 Forward -267 -256 15.7911 0.0107
NP_443009.1_5 Reverse -256 -267 11.1696 0.066
NP_442408.2_1 Reverse -257 -276 -7.67036 0.3
NP_441715.1_4 Forward -265 -255 9.81313 0.097
NP_441715.1_4 Reverse -258 -268 7.94484 0.107
NP_440183.1_9 Reverse -187 -206 -15.6352 0.273
NP_441198.1_5 Reverse -259 -272 15.6533 0.206
NP_440464.1_10 Reverse -258 -268 13.0082 0.169
NP_441468.1_1 Forward -265 -258 15.8704 0.0124
NP_441468.1_1 Reverse -258 -265 15.8704 0.0124
NP_441468.1_1 Reverse -133 -140 4.46401 0.224
NP_441015.1_10 Reverse -303 -322 -10.3253 0.284
NP_441673.1_1 Forward -266 -257 20.8459 0.000698
NP_441673.1_1 Reverse -257 -266 20.8459 0.000698
NP_441731.1_3 Forward -274 -255 1.57275 0.215
NP_441826.1_2 Forward -272 -258 -4.52363 0.296
NP_441330.1_1 Reverse -252 -271 -11.4069 0.183
NP_441764.1_8 Forward -165 -155 13.8947 0.284
NP_441764.1_8 Forward -307 -297 11.6935 0.284
NP_442868.1_6 Reverse -255 -265 18.5646 0.0104
NP_442868.1_6 Forward -268 -258 9.81313 0.038
NP_442868.1_6 Forward -325 -315 0.471689 0.226
NP_441251.1_8 Reverse -19 -32 15.5315 0.254
NP_441612.1_2 Reverse -257 -267 8.54929 0.21
NP_442559.1_3 Forward -144 -125 11.2092 0.214
NP_442227.1_2 Forward -321 -302 3.44104 0.216
NP_443058.1_9 Forward -111 -93 21.947 0.0319
NP_442361.1_3 Forward -272 -259 7.49244 0.3
NP_442427.1_8 Reverse -248 -267 19.469 0.029
NP_442808.1_1 Reverse -256 -266 8.73102 0.0481
NP_442808.1_1 Forward -267 -257 8.63269 0.0481
NP_442808.1_1 Reverse -344 -354 4.40448 0.199
NP_441101.1_4 Forward -33 -14 5.99764 0.295
NP_441290.1_1 Reverse -232 -251 14.7491 0.0933
NP_441290.1_8 Reverse -298 -317 19.8623 0.218
NP_442692.1_10 Reverse -297 -310 14.5901 0.277
NP_442542.1_2 Reverse -255 -268 10.049 0.131
NP_442050.1_5 Reverse -255 -265 13.6475 0.0295
NP_442050.1_5 Forward -268 -258 7.64939 0.243
NP_441114.1_3 Reverse -187 -196 7.66954 0.231
NP_441518.1_3 Reverse -90 -109 -15.6352 0.296
NP_441878.1_6 Reverse -256 -266 20.2362 0.0046
NP_441878.1_6 Forward -267 -257 10.4031 0.0176
NP_441878.1_6 Reverse -131 -141 2.53664 0.0363
NP_441878.1_6 Forward -195 -185 0.57002 0.14
NP_441878.1_6 Reverse -313 -323 -7.19813 0.21
NP_441036.1_8 Reverse -256 -266 8.4365 0.174
NP_441036.1_8 Forward -267 -257 8.33817 0.174
NP_441557.1_5 Forward -266 -257 19.9609 0.000699
NP_441557.1_5 Reverse -257 -266 19.9609 0.000699
NP_441557.1_5 Reverse -132 -141 -0.491928 0.193
NP_441557.1_8 Forward -316 -306 12.1726 0.236
NP_441445.1_1 Reverse -248 -267 3.83436 0.205
NP_441445.1_1 Forward -353 -334 3.44104 0.213
NP_441445.1_8 Reverse -304 -323 -12.1936 0.277
NP_441590.1_6 Forward -144 -125 12.9783 0.209
NP_440084.1_8 Reverse -22 -36 16.7227 0.161
NP_440084.1_8 Forward -34 -20 10.8022 0.26
NP_440084.1_8 Forward -35 -21 10.2293 0.271
NP_440101.1_5 Forward -312 -293 7.66927 0.183
NP_442183.1_1 Reverse -257 -271 10.0294 0.0903
NP_442183.1_1 Forward -266 -252 7.27608 0.145
NP_442183.1_9 Reverse -311 -321 9.12481 0.296
NP_441116.1_8 Forward -40 -21 14.0608 0.295
NP_440233.1_2 Forward -89 -70 -2.0655 0.25
NP_441574.1_1 Forward -206 -187 6.88262 0.11
NP_442347.1_2 Reverse -258 -267 12.4878 0.056
NP_442347.1_2 Forward -265 -256 3.34298 0.284
NP_442645.1_2 Reverse -249 -268 -21.535 0.29
NP_442645.1_2 Forward -274 -255 -21.9284 0.29
NP_441037.1_4 Reverse -255 -265 9.55921 0.21
NP_441037.1_4 Forward -268 -258 7.9999 0.237
NP_441037.1_4 Reverse -130 -140 6.63549 0.25
NP_442317.1_6 Forward -271 -252 11.3075 0.193
NP_440563.1_6 Reverse -116 -129 20.4721 0.089
NP_441633.1_3 Forward -268 -255 10.639 0.0286
NP_441633.1_3 Reverse -255 -268 -3.71729 0.177
NP_440136.1_2 Forward -265 -258 15.9687 0.0123
NP_440136.1_2 Reverse -258 -265 15.9687 0.0123
NP_442590.1_10 Forward -206 -187 3.14605 0.295
NP_442998.1_5 Forward -306 -296 11.6814 0.179
NP_442998.1_5 Forward -307 -297 11.0914 0.196
NP_442998.1_10 Forward -264 -257 15.5754 0.0102
NP_442998.1_10 Reverse -259 -266 15.5754 0.0102
NP_440299.1_1 Forward -270 -257 22.7331 0.000547
NP_440299.1_1 Forward -145 -132 4.83694 0.197
NP_440299.1_1 Reverse -57 -70 3.7553 0.232
NP_440299.1_6 Forward -56 -37 13.2741 0.201
NP_441799.1_1 Reverse -253 -267 12.2903 0.0441
NP_441007.1_5 Reverse -258 -277 15.7324 0.168
NP_441007.1_10 Reverse -252 -265 2.96921 0.183
NP_441007.1_10 Reverse -357 -370 0.117615 0.25
NP_441007.1_10 Reverse -127 -140 -0.669033 0.287
NP_441007.1_10 Reverse -309 -322 -0.865694 0.295
NP_441449.1_10 Forward -272 -254 11.0322 0.295
NP_440256.1_1 Forward -269 -250 2.16274 0.0669
NP_440256.1_1 Forward -326 -307 -7.86702 0.247
NP_440256.1_1 Reverse -254 -273 -9.24366 0.275
NP_440087.1_1 Reverse -357 -376 -5.70374 0.249
NP_440915.1_6 Forward -270 -256 11.2093 0.0267
NP_440915.1_6 Reverse -366 -380 8.35772 0.0559
NP_440915.1_6 Reverse -253 -267 3.63784 0.101
NP_440915.1_6 Reverse -214 -228 -2.45868 0.272
NP_442855.1_3 Reverse -305 -324 27.0405 0.000347
NP_440717.1_1 Reverse -119 -138 13.4708 0.159
NP_441866.1_4 Forward -26 -13 13.2449 0.273
NP_441464.1_8 Forward -266 -252 10.7177 0.178
NP_441939.1_3 Forward -265 -246 15.0441 0.0642
NP_442993.1_1 Forward -266 -250 -9.28291 0.181
NP_440677.1_1 Forward -275 -256 13.3725 0.133
NP_442386.1_9 Forward -267 -258 13.8639 0.0289
NP_442386.1_9 Reverse -256 -265 6.39082 0.219
NP_442386.1_10 Reverse -269 -282 4.64084 0.262
NP_440570.1_5 Forward -276 -257 15.1424 0.111
NP_441340.1_5 Forward -265 -258 15.6737 0.0124
NP_441340.1_5 Reverse -258 -265 15.6737 0.0124
NP_441340.1_5 Reverse -371 -378 4.07068 0.239
NP_441340.1_5 Forward -140 -133 3.97235 0.274
NP_441340.1_9 Forward -164 -154 7.38756 0.27
NP_442186.1_9 Reverse -255 -274 7.86593 0.228
NP_442327.1_3 Forward -40 -21 5.96782 0.276
NP_442327.1_3 Reverse -8 -27 5.77684 0.276
NP_442484.1_2 Forward -277 -258 10.5209 0.115
NP_442791.1_1 Forward -334 -315 11.9958 0.214
NP_442791.1_5 Reverse -316 -335 -7.17871 0.279
NP_440168.1_9 Reverse -255 -274 -3.04881 0.286
NP_440168.1_9 Forward -228 -209 -5.80207 0.296
NP_440327.1_6 Reverse -277 -296 3.14605 0.285
NP_440586.1_1 Forward -351 -332 2.45773 0.226
NP_440586.1_8 Forward -265 -258 13.2151 0.026
NP_440586.1_8 Reverse -258 -265 13.2151 0.026
NP_440586.1_8 Forward -193 -186 5.8403 0.283
NP_442251.1_6 Forward -265 -258 15.2804 0.0124
NP_442251.1_6 Reverse -258 -265 15.2804 0.0124
NP_440684.1_9 Forward -272 -258 11.111 0.18
NP_440684.1_9 Forward -353 -339 9.2427 0.221
NP_441262.1_3 Reverse -257 -264 14.7888 0.0223
NP_441262.1_3 Forward -266 -259 14.7888 0.0223
NP_440027.1_8 Forward -326 -307 8.75009 0.246
NP_440027.1_8 Forward -137 -118 4.81688 0.285
NP_443051.1_1 Reverse -256 -265 18.0926 0.00402
NP_443051.1_1 Forward -267 -258 10.4228 0.00754
NP_443051.1_1 Reverse -131 -140 -1.08191 0.281
NP_441232.1_10 Forward -277 -258 6.98095 0.16
NP_439937.1_9 Reverse -333 -350 -6.64833 0.157
NP_439937.1_9 Reverse -334 -351 -13.9248 0.287
NP_439937.1_9 Forward -267 -250 -15.0064 0.287
NP_441595.1_2 Forward -43 -30 9.61097 0.277
NP_441595.1_5 Forward -273 -255 5.42735 0.257
NP_442239.1_8 Reverse -304 -323 18.3873 0.169
NP_440372.1_2 Forward -265 -258 16.3621 0.0124
NP_440372.1_2 Reverse -258 -265 16.3621 0.0124
NP_440372.1_2 Reverse -371 -378 4.36568 0.205
NP_440171.1_3 Forward -258 -239 1.27776 0.294
NP_440316.1_10 Reverse -131 -141 6.46988 0.257
NP_439977.1_5 Reverse -251 -270 -1.57384 0.256
NP_442368.1_2 Reverse -259 -278 5.211 0.285
NP_440139.1_1 Reverse -251 -270 15.4366 0.0474
NP_440267.1_2 Reverse -252 -266 10.422 0.14
NP_442384.1_10 Reverse -257 -270 17.7189 0.00567
NP_442384.1_10 Forward -266 -253 5.13249 0.137
NP_442384.1_10 Reverse -185 -198 1.88757 0.243
NP_442384.1_10 Reverse -338 -351 1.10092 0.268
NP_442384.1_10 Forward -285 -272 0.904263 0.275
NP_442790.1_4 Reverse -361 -380 -14.9469 0.283
NP_442262.1_10 Forward -265 -258 14.1988 0.0123
NP_442262.1_10 Reverse -258 -265 14.1988 0.0123
NP_441689.1_5 Forward -268 -258 5.78111 0.197
NP_440344.1_10 Reverse -250 -267 10.8552 0.00666
NP_440344.1_10 Forward -273 -256 -10.5809 0.185
NP_440282.1_10 Forward -252 -233 -9.93197 0.29
NP_442910.1_1 Forward -273 -254 -4.72043 0.254
NP_442910.1_1 Reverse -250 -269 -8.45701 0.296
NP_442832.1_3 Forward -354 -335 15.2408 0.248
NP_441965.1_3 Reverse -247 -266 1.76941 0.219
NP_440297.1_9 Forward -265 -255 9.61647 0.0917
NP_440297.1_9 Forward -140 -130 0.471689 0.282
NP_440297.1_9 Reverse -258 -268 -0.118297 0.282
NP_440297.1_9 Reverse -186 -196 -0.118297 0.282
NP_441592.1_4 Reverse -257 -276 2.0644 0.204
NP_441896.1_5 Forward -201 -194 15.3787 0.268
NP_441679.1_6 Forward -271 -252 4.12936 0.151
NP_440937.1_6 Reverse -8 -27 16.6165 0.199
NP_440999.1_9 Reverse -253 -267 1.67122 0.16
NP_440888.1_2 Reverse -257 -271 10.717 0.0861
NP_440888.1_2 Forward -227 -213 7.27547 0.202
NP_440888.1_2 Forward -266 -252 6.88214 0.217
NP_440888.1_2 Forward -317 -303 5.70218 0.267
NP_442454.1_2 Forward -34 -15 12.8432 0.251
NP_442454.1_2 Reverse -24 -43 11.0289 0.259
NP_440792.1_5 Reverse -258 -277 7.27595 0.237
NP_440179.1_6 Reverse -186 -205 4.12936 0.246
NP_442147.1_6 Forward -325 -311 16.1252 0.205
NP_442277.1_7 Reverse -14 -30 0.197786 0.215
NP_442033.1_10 Reverse -255 -274 -9.34199 0.213
NP_440575.1_1 Reverse -154 -173 -2.26292 0.294
NP_441543.1_2 Reverse -258 -267 16.9127 0.00359
NP_441543.1_2 Forward -265 -256 9.34117 0.0818
NP_441543.1_3 Reverse -343 -357 14.5519 0.163
NP_442845.1_2 Forward -272 -258 4.42448 0.259
NP_441178.1_6 Forward -321 -302 1.96529 0.276
NP_441469.1_8 Reverse -256 -265 13.3727 0.073
NP_441469.1_8 Reverse -131 -140 10.4228 0.216
NP_441469.1_8 Forward -267 -258 6.48957 0.227
NP_442315.1_1 Reverse -361 -379 6.214 0.256
NP_443064.1_6 Forward -266 -256 13.8273 0.0796
NP_443064.1_6 Reverse -257 -267 12.5669 0.0796
NP_442578.1_7 Forward -265 -258 14.5921 0.026
NP_442578.1_7 Reverse -258 -265 14.5921 0.026
NP_440710.1_1 Forward -274 -256 -9.32229 0.297
NP_441462.1_2 Forward -266 -256 20.1379 0.000967
NP_441462.1_2 Reverse -257 -267 11.5831 0.00406
NP_441462.1_2 Forward -323 -313 -0.806614 0.254
NP_441462.1_2 Forward -141 -131 -0.904945 0.265
NP_443062.1_1 Forward -266 -248 7.27833 0.18
NP_443062.1_1 Forward -371 -353 5.5232 0.227
NP_443062.1_1 Reverse -257 -275 4.06059 0.276
NP_443062.1_1 Forward -206 -188 3.96308 0.279
NP_442204.1_1 Reverse -310 -321 1.14031 0.28
NP_440255.1_9 Reverse -135 -154 14.7531 0.294
NP_440516.1_8 Forward -266 -257 16.9127 0.00442
NP_440516.1_8 Reverse -257 -266 16.9127 0.00442
NP_440516.1_8 Reverse -370 -379 -0.196935 0.185
NP_442428.1_5 Forward -265 -258 15.8704 0.0124
NP_442428.1_5 Reverse -258 -265 15.8704 0.0124
NP_442428.1_5 Reverse -133 -140 4.759 0.223
NP_440783.1_5 Reverse -89 -108 -6.49039 0.295
NP_440673.1_2 Reverse -51 -70 15.3647 0.0888
NP_440673.1_2 Forward -151 -132 11.3651 0.178
NP_440673.1_3 Forward -264 -257 12.4288 0.0426
NP_440673.1_3 Reverse -259 -266 12.4288 0.0426
NP_440673.1_7 Forward -277 -258 4.916 0.185
NP_440865.1_9 Reverse -251 -270 -6.39206 0.226
NP_441052.1_2 Reverse -257 -267 19.9412 0.00106
NP_441052.1_2 Forward -266 -256 10.4031 0.0285
NP_442219.1_8 Forward -276 -257 9.13344 0.234
NP_442219.1_9 Reverse -258 -267 17.7976 0.00718
NP_442219.1_9 Forward -265 -256 8.25953 0.0681
NP_440436.1_4 Reverse -258 -267 17.2072 0.00233
NP_440436.1_4 Forward -265 -256 15.9289 0.00508
NP_441884.1_9 Reverse -254 -273 -6.1954 0.0594
NP_441884.1_9 Forward -73 -54 -23.01 0.284
NP_442864.1_3 Forward -272 -253 8.35759 0.233
NP_440314.1_9 Reverse -258 -277 9.24257 0.0338
NP_440314.1_9 Reverse -339 -358 -0.590531 0.112
NP_440041.1_2 Forward -202 -183 -6.39206 0.296
NP_441719.1_4 Forward -265 -258 16.3621 0.0124
NP_441719.1_4 Reverse -258 -265 16.3621 0.0124
NP_441733.1_10 Forward -269 -256 5.32916 0.218
NP_441004.1_1 Reverse -120 -139 -13.3736 0.257
NP_441004.1_2 Forward -205 -186 0.196116 0.24
NP_442366.1_3 Reverse -256 -274 2.37909 0.131
NP_442366.1_3 Forward -195 -177 -3.81576 0.258
NP_442366.1_5 Forward -269 -259 15.4175 0.0374
NP_442873.1_9 Forward -276 -257 8.84842 0.236
NP_440296.1_6 Forward -36 -18 11.5565 0.295
NP_441115.1_4 Reverse -232 -250 12.4081 0.105
NP_441115.1_4 Reverse -82 -100 7.3932 0.286
NP_442206.1_10 Reverse -257 -272 3.42148 0.185
NP_442206.1_10 Reverse -132 -147 -0.315096 0.29
NP_443054.1_2 Reverse -255 -269 1.47456 0.245
NP_443054.1_2 Forward -268 -254 1.08123 0.251
NP_441851.1_10 Reverse -256 -266 17.4829 0.0027
NP_441851.1_10 Forward -267 -257 15.8113 0.00552
NP_441851.1_10 Reverse -131 -141 7.74818 0.132
NP_442622.1_8 Forward -266 -248 -18.8604 0.285
NP_441668.1_4 Forward -55 -36 -0.590531 0.259
NP_442515.1_1 Forward -267 -253 12.586 0.0337
NP_442515.1_1 Reverse -256 -270 4.32615 0.107
NP_440593.1_3 Reverse -180 -199 1.67108 0.187
NP_442689.1_8 Forward -158 -141 -7.13932 0.292
NP_441349.1_10 Reverse -247 -266 8.75091 0.026
NP_441349.1_10 Reverse -304 -323 -4.91709 0.186
NP_440874.1_1 Reverse -134 -153 11.1109 0.236
NP_440432.1_9 Forward -265 -250 5.68309 0.0523
NP_440432.1_9 Forward -140 -125 -2.8717 0.176
NP_442843.1_1 Reverse -133 -152 -1.47551 0.197
NP_442843.1_1 Reverse -258 -277 -5.9004 0.244
NP_439960.1_10 Reverse -301 -319 -1.94747 0.246
NP_441124.1_5 Reverse -137 -147 10.1434 0.297
NP_440431.1_3 Reverse -184 -203 -9.93197 0.264
NP_440431.1_4 Reverse -14 -33 -9.40638 0.284
NP_442450.1_5 Reverse -255 -265 10.0098 0.115
NP_442450.1_5 Forward -268 -258 7.55152 0.13
NP_442168.1_5 Forward -265 -246 -2.26216 0.264
NP_440588.1_2 Forward -275 -256 -1.67217 0.156
NP_440588.1_5 Reverse -22 -36 17.024 0.174
NP_442237.1_1 Reverse -15 -29 17.7731 0.206
NP_440195.1_4 Forward -278 -259 3.93269 0.297
NP_440195.1_5 Reverse -251 -270 20.354 0.0409
NP_442006.1_2 Reverse -263 -280 -15.8908 0.23
NP_442006.1_2 Forward -70 -53 -16.9724 0.267
NP_441570.1_1 Reverse -257 -275 -8.24065 0.107
NP_441078.1_4 Forward -266 -257 19.6659 0.0007
NP_441078.1_4 Reverse -257 -266 19.6659 0.0007
NP_441078.1_4 Reverse -314 -323 -1.86856 0.272
NP_441078.1_4 Reverse -132 -141 -1.86856 0.272
NP_442729.1_5 Forward -195 -185 8.4365 0.248
NP_442729.1_8 Forward -270 -257 9.36073 0.125
NP_441528.1_5 Reverse -189 -203 16.4202 0.287
NP_441539.1_5 Forward -200 -181 18.0924 0.27
NP_440707.1_9 Reverse -363 -382 1.86774 0.286
NP_442443.1_1 Forward -250 -231 -6.29373 0.294
NP_440526.1_3 Forward -265 -254 10.9729 0.0646
NP_440526.1_3 Forward -140 -129 1.43483 0.267
NP_440526.1_3 Reverse -258 -269 1.04151 0.267
NP_441432.1_8 Forward -267 -258 16.8143 0.00595
NP_441432.1_8 Reverse -256 -265 8.35786 0.0755
NP_441432.1_8 Forward -46 -37 2.75299 0.287
NP_441333.1_1 Forward -32 -22 17.2143 0.153
NP_442320.1_8 Reverse -251 -265 7.57108 0.019
NP_442320.1_8 Forward -272 -258 3.93283 0.0564
NP_442344.1_7 Reverse -258 -277 -5.11376 0.168
NP_441732.1_2 Forward -270 -254 -16.4611 0.167
NP_441732.1_2 Forward -309 -293 -17.5427 0.27
NP_440760.1_1 Reverse -257 -276 -3.14714 0.034
NP_440760.1_1 Forward -266 -247 -18.3884 0.213
NP_442797.1_2 Reverse -252 -270 22.584 0.0256
NP_442353.1_4 Forward -51 -32 10.6184 0.106
NP_442353.1_4 Forward -133 -114 0.0970122 0.281
NP_442968.1_8 Forward -109 -90 13.6675 0.196
NP_441072.1_2 Reverse -114 -133 8.35759 0.24
NP_442489.1_7 Forward -266 -257 20.1576 0.000695
NP_442489.1_7 Reverse -257 -266 20.1576 0.000695
NP_442489.1_7 Reverse -314 -323 -1.37691 0.195
NP_442489.1_7 Reverse -132 -141 -1.37691 0.195
NP_441706.1_10 Forward -269 -250 9.14423 0.245
NP_442079.1_7 Reverse -258 -277 0.687771 0.275
NP_440559.1_1 Reverse -258 -267 17.4043 0.00658
NP_440559.1_1 Forward -265 -256 17.306 0.00658
NP_441659.2_8 Forward -266 -256 19.3512 0.000966
NP_441659.2_8 Reverse -257 -267 18.1713 0.00133
NP_441659.2_8 Forward -141 -131 12.0747 0.0147
NP_441659.2_8 Forward -323 -313 6.37155 0.0774
NP_442913.1_9 Forward -272 -253 14.8474 0.134
NP_442913.1_10 Forward -275 -256 2.0644 0.132
NP_442913.1_10 Reverse -248 -267 -2.36049 0.184
NP_442913.1_10 Reverse -123 -142 -3.04881 0.198
NP_442913.1_10 Forward -332 -313 -3.93378 0.221
NP_441800.1_3 Reverse -303 -321 3.85406 0.289
NP_442776.1_1 Reverse -37 -56 9.93088 0.181
NP_442776.1_6 Reverse -336 -355 10.2259 0.213
NP_440779.1_5 Forward -141 -124 4.75873 0.0372
NP_440779.1_5 Forward -266 -249 -14.7108 0.269
NP_442346.1_5 Reverse -256 -266 17.9746 0.00128
NP_442346.1_5 Forward -267 -257 16.6963 0.00248
NP_442346.1_5 Forward -195 -185 14.1397 0.0164
NP_442346.1_5 Forward -142 -132 9.51814 0.118
NP_442346.1_5 Reverse -131 -141 7.25653 0.176
NP_442346.1_5 Reverse -313 -323 4.69992 0.276
NP_440352.1_5 Reverse -127 -146 11.0983 0.267
NP_440545.1_3 Forward -270 -253 -5.1727 0.242
NP_440831.1_3 Forward -275 -256 8.03745 0.233
NP_441786.1_10 Reverse -248 -267 11.7992 0.157
NP_441786.1_10 Forward -121 -102 6.39097 0.284
NP_440459.1_2 Reverse -123 -140 10.3636 0.2
NP_441653.1_4 Forward -206 -194 20.0002 0.26
NP_440010.1_6 Forward -277 -258 7.17762 0.217
NP_441943.1_2 Reverse -144 -163 11.2092 0.27
NP_442603.1_7 Reverse -257 -271 10.0287 0.134
NP_441888.1_7 Forward -271 -257 2.75286 0.225
NP_441050.1_5 Forward -351 -333 -2.53746 0.283
NP_442754.1_3 Forward -140 -121 18.0924 0.299
NP_441833.1_4 Forward -265 -258 15.9687 0.0124
NP_441833.1_4 Reverse -258 -265 15.9687 0.0124
NP_443040.1_1 Reverse -18 -32 16.3685 0.276
NP_441895.1_1 Reverse -222 -241 -7.37537 0.087
NP_442060.1_10 Reverse -117 -136 24.7789 0.00778
NP_442162.1_9 Forward -265 -258 16.2637 0.0124
NP_442162.1_9 Reverse -258 -265 16.2637 0.0124
NP_442162.1_9 Reverse -371 -378 3.4807 0.246
NP_442162.1_9 Forward -378 -371 3.38237 0.276
NP_440671.1_4 Reverse -251 -265 5.1128 0.292
NP_442073.1_6 Reverse -248 -267 1.47442 0.25
NP_442199.1_5 Reverse -249 -268 16.8141 0.0235
NP_442140.1_3 Reverse -258 -268 12.2714 0.0632
NP_442140.1_3 Forward -265 -255 11.5831 0.0743
NP_442140.1_3 Forward -193 -183 5.68323 0.198
NP_441671.1_1 Forward -262 -243 10.4225 0.176
NP_441671.1_3 Forward -250 -231 17.0107 0.137
NP_440875.1_9 Forward -264 -254 7.59334 0.255
NP_441813.1_5 Reverse -255 -265 18.3679 0.00743
NP_441813.1_5 Forward -268 -258 8.63316 0.0367
NP_441813.1_5 Forward -381 -371 3.22496 0.173
NP_442028.1_1 Forward -33 -20 7.03268 0.292
NP_440590.1_4 Reverse -258 -271 10.5407 0.0262
NP_440590.1_4 Forward -265 -252 2.87088 0.0788
NP_440567.1_1 Reverse -258 -272 10.0294 0.0402
NP_440567.1_1 Forward -265 -251 2.94952 0.157
NP_440567.1_1 Forward -378 -364 0.589577 0.24
NP_440567.1_1 Reverse -371 -385 -0.295402 0.276
NP_442497.1_10 Forward -265 -256 19.8626 0.00532
NP_442497.1_10 Reverse -258 -267 10.4228 0.0087
NP_442497.1_10 Forward -140 -131 0.491382 0.162
NP_440821.1_4 Reverse -255 -265 10.9931 0.0146
NP_440821.1_4 Forward -268 -258 9.41981 0.0286
NP_441239.1_9 Reverse -255 -267 12.6253 0.0446
NP_441239.1_9 Forward -381 -369 8.9871 0.117
NP_441239.1_9 Forward -268 -256 6.92215 0.173
NP_441239.1_9 Reverse -59 -71 6.23383 0.197
NP_441239.1_9 Forward -244 -232 3.08724 0.296
NP_441727.1_3 Reverse -250 -269 8.06259 0.213
NP_440624.1_6 Forward -155 -137 2.96833 0.264
NP_441892.1_1 Reverse -248 -265 -5.95935 0.294
NP_440796.1_3 Forward -273 -255 11.0314 0.204
NP_442105.1_9 Forward -314 -300 17.8465 0.151
NP_442270.1_9 Forward -277 -258 -0.590531 0.145
NP_440833.1_6 Forward -305 -291 12.8803 0.178
NP_442052.1_8 Reverse -130 -140 12.3697 0.271
NP_440546.1_4 Forward -266 -256 12.8578 0.0572
NP_440546.1_4 Reverse -257 -267 10.046 0.109
NP_440546.1_4 Forward -194 -184 7.42815 0.241
NP_440546.1_4 Reverse -370 -380 7.04032 0.264
NP_443033.1_7 Reverse -246 -265 14.2574 0.22
NP_441230.1_5 Reverse -252 -271 2.65439 0.212
NP_440462.1_6 Reverse -255 -265 9.7148 0.0429
NP_440462.1_6 Forward -381 -371 3.42162 0.247
NP_440462.1_6 Forward -268 -258 1.35667 0.294
NP_440868.1_4 Reverse -253 -265 1.12062 0.192
NP_440868.1_4 Forward -270 -258 -0.944332 0.284
NP_442499.1_1 Reverse -186 -205 4.81767 0.226
NP_441269.1_10 Reverse -127 -144 17.1484 0.228
NP_440036.1_10 Forward -201 -189 13.9036 0.284
NP_441848.1_7 Reverse -27 -46 -3.34455 0.282
NP_441084.1_6 Reverse -255 -269 14.7737 0.0972
NP_441084.1_6 Forward -244 -230 10.8954 0.226
NP_442039.1_4 Forward -265 -258 15.1821 0.0124
NP_442039.1_4 Reverse -258 -265 15.1821 0.0124
NP_442039.1_4 Reverse -119 -126 8.39725 0.202
NP_442039.1_7 Forward -131 -121 7.25653 0.277
NP_442625.1_1 Forward -358 -339 4.22769 0.267
NP_440825.1_7 Reverse -258 -268 12.9096 0.152
NP_442837.1_3 Forward -265 -258 15.7721 0.0124
NP_442837.1_3 Reverse -258 -265 15.7721 0.0124
NP_442053.1_1 Forward -266 -257 18.3876 0.0007
NP_442053.1_1 Reverse -257 -266 18.3876 0.0007
NP_440505.1_3 Reverse -255 -265 9.61647 0.122
NP_440505.1_3 Forward -268 -258 9.22315 0.122
NP_441203.1_2 Reverse -302 -321 -4.13045 0.22
NP_442532.1_1 Reverse -19 -33 9.23901 0.284
NP_442532.1_7 Forward -70 -56 11.996 0.114
NP_440914.1_1 Reverse -257 -267 17.5935 0.000537
NP_440914.1_1 Forward -266 -256 8.51751 0.186
NP_442470.1_3 Reverse -187 -206 8.94676 0.286
NP_441011.1_8 Forward -265 -256 14.356 0.0249
NP_441011.1_8 Reverse -258 -267 8.25953 0.144
NP_442101.1_10 Forward -274 -255 -0.787193 0.101
NP_442533.1_1 Reverse -360 -379 -8.752 0.211
NP_442533.1_6 Forward -266 -257 17.2076 0.00137
NP_442533.1_6 Reverse -257 -266 17.2076 0.00137
NP_442533.1_6 Reverse -132 -141 11.5045 0.0432
NP_442533.1_6 Reverse -97 -106 10.2261 0.0558
NP_442533.1_6 Forward -194 -185 4.62128 0.179
NP_442533.1_6 Reverse -314 -323 3.7363 0.204
NP_442533.1_6 Forward -45 -36 2.458 0.255
NP_440263.1_3 Forward -140 -121 5.01433 0.243
NP_442232.1_3 Forward -351 -332 -15.4385 0.291
NP_442229.1_1 Forward -268 -254 7.07881 0.198
NP_443016.1_1 Forward -272 -253 -2.95047 0.225
NP_441482.1_7 Reverse -251 -265 -0.885388 0.0612
NP_441482.1_7 Forward -272 -258 -2.85201 0.1
NP_439944.1_9 Reverse -258 -268 10.5014 0.0887
NP_439944.1_9 Forward -265 -255 8.82982 0.101
NP_441697.1_5 Forward -38 -19 -4.24981 0.22
NP_441697.1_5 Reverse -20 -39 -7.40105 0.243
NP_441697.1_5 Reverse -19 -38 -10.4568 0.279
NP_440116.1_8 Reverse -258 -277 18.9773 0.00742
NP_440116.1_8 Forward -265 -246 -5.80207 0.195
NP_440115.1_6 Reverse -254 -264 7.15819 0.158
NP_440007.1_4 Reverse -246 -265 8.55425 0.294
NP_440007.1_9 Reverse -253 -267 1.67122 0.285
NP_441972.1_5 Forward -265 -246 -7.27704 0.247
NP_441972.1_5 Forward -328 -309 -8.752 0.272
NP_441106.1_1 Reverse -256 -265 9.73449 0.0311
NP_441106.1_1 Forward -267 -258 9.63616 0.0311
NP_441420.1_1 Forward -267 -248 -4.52377 0.292
NP_439903.1_6 Reverse -254 -273 2.55527 0.225
NP_442588.1_6 Reverse -121 -140 -1.37718 0.268
NP_441286.1_1 Forward -267 -255 15.4769 0.00418
NP_441286.1_1 Reverse -256 -268 3.48056 0.0467
NP_440670.1_8 Forward -266 -257 18.3876 0.000699
NP_440670.1_8 Reverse -257 -266 18.3876 0.000699
NP_440886.1_7 Reverse -256 -266 8.04271 0.0805
NP_440886.1_7 Forward -267 -257 7.94438 0.0805
NP_442614.1_2 Forward -266 -252 5.80112 0.297
NP_439995.1_4 Reverse -291 -310 15.4366 0.28
NP_440907.2_8 Forward -265 -255 9.91099 0.103
NP_440907.2_8 Reverse -258 -268 7.64939 0.117
NP_440907.2_8 Forward -378 -368 5.28945 0.209
NP_442264.1_2 Forward -204 -187 10.1669 0.188
NP_441021.1_1 Reverse -258 -277 -1.96717 0.128
NP_441021.1_1 Forward -140 -121 -8.85033 0.201
NP_440841.1_4 Forward -268 -249 -5.70374 0.208
NP_440962.1_4 Reverse -278 -293 8.73135 0.298
NP_441463.1_3 Reverse -247 -266 0.491109 0.131
NP_441463.1_3 Forward -276 -257 -8.06369 0.264
NP_441626.1_2 Forward -265 -258 15.7721 0.0124
NP_441626.1_2 Reverse -258 -265 15.7721 0.0124
NP_441626.1_2 Reverse -371 -378 9.08556 0.1
NP_442209.1_6 Forward -140 -121 15.2408 0.185
NP_442794.1_1 Forward -270 -258 19.1152 0.00716
NP_442615.1_1 Reverse -248 -266 5.72234 0.0374
NP_442615.1_1 Reverse -123 -141 -1.25915 0.127
NP_442615.1_1 Forward -203 -185 -5.58572 0.217
NP_442615.1_1 Reverse -361 -379 -7.45401 0.291
NP_441962.1_4 Reverse -252 -271 -4.42544 0.158
NP_441962.1_4 Forward -376 -357 -5.80207 0.174
NP_441962.1_4 Forward -75 -56 -15.0452 0.297
NP_440387.1_1 Reverse -257 -273 23.953 0.00129
NP_441431.1_2 Reverse -254 -268 15.6336 0.045
NP_441431.1_2 Forward -137 -123 9.04542 0.198
NP_441431.1_2 Forward -322 -308 6.39049 0.272
NP_441065.1_2 Reverse -20 -39 13.5586 0.18
NP_441193.1_1 Reverse -332 -351 12.585 0.229
NP_441993.1_1 Forward -272 -253 2.04414 0.265
NP_441993.1_1 Reverse -362 -381 0.777198 0.292
NP_441993.1_1 Forward -117 -98 0.679741 0.294
NP_442224.1_1 Reverse -255 -274 -2.55715 0.233
NP_440114.1_10 Forward -266 -252 19.8624 0.00349
NP_440114.1_10 Reverse -185 -199 6.88276 0.253
NP_442090.1_10 Forward -353 -340 12.8023 0.179
NP_442324.1_7 Reverse -10 -29 5.18382 0.277
NP_441421.1_6 Reverse -18 -35 9.88781 0.28
NP_439988.1_7 Forward -68 -54 13.8636 0.292
NP_441237.1_9 Reverse -258 -268 14.828 0.0242
NP_439910.1_2 Reverse -249 -266 -12.6459 0.0924
NP_442867.1_8 Forward -279 -260 3.93269 0.295
NP_440457.1_1 Reverse -253 -265 9.18376 0.0949
NP_440457.1_1 Reverse -366 -378 1.02229 0.248
NP_440801.1_8 Reverse -256 -275 8.45592 0.142
NP_441984.1_3 Reverse -114 -132 7.4923 0.246
NP_441984.1_3 Reverse -253 -271 7.00065 0.259
NP_442509.1_9 Forward -266 -256 17.3841 0.00128
NP_442509.1_9 Reverse -257 -267 8.14104 0.192
NP_443037.1_7 Forward -26 -7 -2.45882 0.276
NP_442514.1_5 Forward -319 -300 13.7649 0.0426
NP_440554.1_4 Forward -265 -255 8.82982 0.0646
NP_442862.1_3 Reverse -297 -314 7.41366 0.255
NP_441845.1_6 Forward -278 -260 9.36059 0.116
NP_441885.1_5 Reverse -257 -267 20.9245 0.000538
NP_441885.1_5 Forward -266 -256 11.3864 0.00668
NP_441885.1_5 Reverse -132 -142 0.471689 0.145
NP_440898.1_5 Forward -281 -262 10.0292 0.274
NP_442341.1_7 Reverse -256 -270 15.1426 0.0245
NP_442341.1_9 Forward -136 -122 5.99717 0.247
NP_442534.1_7 Forward -135 -116 11.4058 0.183
NP_442534.1_7 Reverse -225 -244 7.17762 0.271
NP_440423.1_6 Reverse -249 -268 -15.1435 0.229
NP_443000.1_7 Reverse -255 -265 11.6814 0.0344
NP_443000.1_7 Forward -268 -258 10.3048 0.0345
NP_440507.2_3 Forward -275 -256 13.0766 0.145
NP_441842.1_10 Forward -273 -259 12.1926 0.107
NP_441842.1_10 Reverse -250 -264 7.07942 0.267
NP_440275.1_3 Reverse -255 -265 16.9913 0.0133
NP_440275.1_3 Forward -268 -258 8.04317 0.0602
NP_440275.1_3 Forward -325 -315 1.455 0.29
NP_440091.1_1 Reverse -253 -265 1.41561 0.197
NP_443060.1_5 Reverse -170 -189 9.63507 0.196
NP_442275.1_1 Forward -127 -108 3.83436 0.275
NP_441122.1_1 Reverse -181 -196 3.81481 0.28
NP_439962.1_4 Reverse -302 -321 -5.01543 0.272
NP_440149.1_8 Reverse -257 -276 -1.47551 0.16
NP_441105.1_3 Reverse -246 -265 12.8808 0.0315
NP_441105.1_3 Reverse -297 -316 -3.93378 0.188
NP_441105.1_3 Forward -205 -186 -7.96535 0.263
NP_440216.1_1 Forward -266 -252 16.1259 0.00307
NP_440216.1_1 Reverse -257 -271 -10.6202 0.145
NP_440216.1_1 Forward -323 -309 -12.6851 0.296
NP_440216.1_8 Reverse -27 -44 18.8201 0.161
NP_440216.1_9 Forward -309 -300 8.25953 0.286
NP_440172.1_1 Forward -266 -256 16.303 0.00854
NP_440172.1_1 Reverse -257 -267 15.0247 0.00945
NP_440172.1_1 Reverse -132 -142 5.09324 0.153
NP_442015.1_10 Forward -270 -257 11.229 0.0372
NP_442015.1_10 Reverse -253 -266 3.75586 0.178
NP_441226.1_7 Forward -265 -258 14.4934 0.0123
NP_441226.1_7 Reverse -258 -265 14.4934 0.0123
NP_441111.1_7 Forward -265 -257 18.7023 0.00294
NP_441111.1_7 Reverse -258 -266 18.7023 0.00294
NP_441111.1_7 Forward -140 -132 -0.668896 0.274
NP_442379.1_10 Reverse -331 -348 -2.51776 0.233
NP_441766.1_2 Forward -266 -257 17.5026 0.00297
NP_441766.1_2 Reverse -257 -266 17.5026 0.00297
NP_441766.1_2 Forward -379 -370 5.70292 0.109
NP_441766.1_2 Reverse -132 -141 4.91628 0.154
NP_442417.1_5 Reverse -257 -271 11.0127 0.106
NP_440416.1_1 Forward -266 -247 -2.45882 0.116
NP_440416.1_9 Forward -273 -254 -5.70374 0.0814
NP_443052.1_8 Reverse -247 -266 -6.39206 0.143
NP_443052.1_8 Reverse -307 -326 -8.85033 0.179
NP_443052.1_9 Forward -321 -302 5.211 0.149
NP_443052.1_9 Reverse -232 -251 -6.39206 0.282
NP_442154.1_1 Reverse -303 -321 -15.3205 0.218
NP_442154.1_1 Reverse -264 -282 -17.8771 0.272
NP_440261.1_5 Forward -265 -252 -2.43899 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTAAGCACCCTAGCGTGGTAACCCGCTCGCTCCACCGCATCTGTGAGGATTTGGGGGGTCGTTTCCCCGTGATAACTGACCACCGCCTGCTCCAGGGCAAAATTCACCTGGCAAGACTGCACCCCCGGCACTTTGGCGATCGCCCGTTCAATGCTGGAAGCACAGGCCGCACAGCGCATTCCCTCTAGTTGCAGATTGATGGTTTGGGCCATGGTTAATCGGTAATACTCAGTACAAAGAAAAGCTTACCTTCAATTTTAGCCACCGCCCATTGGCAAGCTCAGGAATAGCTCCGGGCCCCGCCTTGGTATAATTGCCTAGCTAAAGACGGACGATGTCAGCAGTGGAACTCTTTGGCAGTGACCAAATTTTTAATTTTTTAATTTACTGAGATAAGTAC

CDS

ATGAAAACTGCATGGGTATTCCCCGGCCAAGGTTCCCAAGCTGTGGGCATGGGGGTAGATCTGCTCTCAACGGCGATCGCCAAGGAAAAATATCAGCAAGCCGAAGAAATTCTTGGCTGGTCAGTGGTGGAAAAATGCCAAGGGGATGAAGCTAGCCTGGCCCTGACCCAAAATACCCAACCCTGTTTGTACGTTATTGAAGCAATTTTGGCTGATTTGCTCAGGGATAAAGGTTTTCAGCCCGATTACGTAGCCGGTCATAGTCTGGGGGAATATTCCGCCCTCTACGCCGCTGGGGTATTTGATTTTGCCACGGGTTTGCAACTGGTTAAACAACGGTCAGAGGTGATGGCCAGCGCTTCCGGGGGCATGATGGCCGCCCTGATGAAGTTCGATCAAACCCAGTTACAGCAAGCCCTGACGGATAATACAGAGGTTGTATTAGCTAACGATAACAGCCCCGAACAGGTAGTAATTTCCGGTACTGTGGCCGGTGTAGAAGCAATTTTAGCCAACGTCAAGGCACGCCGAGCCGTGCCTCTGAAGGTTTCCGGTGCTTTCCACTCCAGCTTTATGGCCCAACCTTCCCAATCCTTCGCCCAAACCCTGACAGCTTGCCATTTCAACGACGCCACTGTGCCCGTACTCTCCAACGTTGATCCTAGCCCTACCCAAAACGGCGATCGCCTGAAAGAAAAACTAATTCAACAAATGACCGGTTCCGTGCGCTGGCGGGAAACCATGGTTAACCTAGGAGAAATTGGGGCAACGGATTATTGGGAAGTGGGCCCAGGCAAAGTACTGACTGGTCTATGTAAACGAACTTGCCCTGATCTGAACCTGAAAAATATTGGCCAATTAGACGACTTGAATTCCCTGTAG

Protein

MKTAWVFPGQGSQAVGMGVDLLSTAIAKEKYQQAEEILGWSVVEKCQGDEASLALTQNTQPCLYVIEAILADLLRDKGFQPDYVAGHSLGEYSALYAAGVFDFATGLQLVKQRSEVMASASGGMMAALMKFDQTQLQQALTDNTEVVLANDNSPEQVVISGTVAGVEAILANVKARRAVPLKVSGAFHSSFMAQPSQSFAQTLTACHFNDATVPVLSNVDPSPTQNGDRLKEKLIQQMTGSVRWRETMVNLGEIGATDYWEVGPGKVLTGLCKRTCPDLNLKNIGQLDDLNSL