Your browser is old and dusty. Try Google Chrome!

Details for slr2012

ORF slr2012
Accession NP_440579.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -237 -251 14.8476 0.12
NP_441061.1_2 Reverse -385 -399 0.196253 0.215
NP_441061.1_2 Forward -71 -57 -0.0987402 0.221
NP_440795.1_7 Forward -245 -238 14.6904 0.0123
NP_440795.1_7 Reverse -238 -245 14.6904 0.0123
NP_440795.1_7 Forward -71 -64 14.6904 0.0123
NP_440795.1_7 Reverse -64 -71 14.6904 0.0123
NP_441418.1_6 Reverse -237 -256 -9.24366 0.0278
NP_441418.1_6 Forward -72 -53 -11.8003 0.0565
NP_441418.1_6 Forward -258 -239 -21.0434 0.136
NP_441418.1_6 Reverse -63 -82 -30.1882 0.262
NP_440897.1_6 Reverse -290 -309 3.83357 0.142
NP_441453.1_1 Reverse -56 -74 4.54162 0.258
NP_441453.1_4 Reverse -237 -245 16.539 0.00633
NP_441453.1_4 Reverse -63 -71 16.539 0.00633
NP_441453.1_4 Forward -246 -238 16.539 0.00633
NP_441453.1_4 Forward -72 -64 16.539 0.00633
NP_441453.1_7 Forward -338 -331 11.9372 0.298
NP_442151.1_6 Forward -246 -232 15.1426 0.0267
NP_442151.1_6 Reverse -290 -304 13.6676 0.0474
NP_442151.1_6 Reverse -63 -77 9.14437 0.157
NP_442151.1_6 Forward -72 -58 6.6861 0.224
NP_442151.1_6 Forward -346 -332 5.70279 0.266
NP_441818.1_1 Forward -245 -234 14.4145 0.0502
NP_441818.1_1 Forward -71 -60 9.69459 0.232
NP_440226.1_1 Forward -72 -53 16.5191 0.0215
NP_440226.1_1 Forward -246 -227 5.01433 0.17
NP_442655.1_1 Reverse -232 -251 7.37428 0.115
NP_442655.1_1 Reverse -58 -77 -1.08219 0.258
NP_442173.1_1 Forward -245 -237 15.4574 0.00633
NP_442173.1_1 Forward -71 -63 15.4574 0.00633
NP_442173.1_1 Reverse -238 -246 15.4574 0.00633
NP_442173.1_1 Reverse -64 -72 15.4574 0.00633
NP_442173.1_1 Forward -111 -103 8.47588 0.0947
NP_442173.1_1 Forward -11 -3 6.01761 0.2
NP_001035873.1_8 Reverse -153 -172 7.07928 0.26
NP_442752.1_4 Forward -246 -239 13.8055 0.0199
NP_442752.1_4 Reverse -237 -244 13.8055 0.0199
NP_442752.1_4 Forward -72 -65 13.8055 0.0199
NP_442752.1_4 Reverse -63 -70 13.8055 0.0199
NP_443027.1_4 Reverse -61 -71 14.828 0.0437
NP_443027.1_4 Forward -248 -238 13.2547 0.0521
NP_443027.1_4 Forward -74 -64 13.2547 0.0521
NP_443027.1_4 Reverse -235 -245 6.46988 0.275
NP_441812.1_3 Forward -73 -59 7.9644 0.254
NP_442975.1_10 Reverse -59 -73 13.7653 0.0459
NP_442975.1_10 Reverse -233 -247 12.2903 0.0477
NP_441225.1_4 Forward -76 -57 -12.1936 0.284
NP_440784.1_7 Forward -245 -238 15.9687 0.0123
NP_440784.1_7 Reverse -238 -245 15.9687 0.0123
NP_440784.1_7 Forward -71 -64 15.9687 0.0123
NP_440784.1_7 Reverse -64 -71 15.9687 0.0123
NP_440784.1_7 Reverse -291 -298 5.84064 0.248
NP_442861.1_1 Forward -189 -170 12.4875 0.265
NP_440061.1_9 Forward -248 -234 12.9786 0.0878
NP_440061.1_9 Reverse -61 -75 10.2254 0.126
NP_440061.1_9 Reverse -154 -168 5.01387 0.298
NP_441054.1_4 Reverse -53 -71 10.5406 0.0619
NP_441476.1_5 Reverse -329 -348 9.3409 0.0933
NP_440878.1_9 Reverse -263 -282 2.45773 0.177
NP_442062.1_8 Forward -72 -62 19.4496 0.000558
NP_442062.1_8 Forward -246 -236 17.6796 0.00193
NP_442062.1_8 Reverse -237 -247 10.3048 0.0493
NP_442062.1_8 Reverse -63 -73 10.3048 0.0493
NP_440761.1_4 Reverse -232 -251 -4.03212 0.132
NP_440761.1_4 Reverse -58 -77 -4.32711 0.132
NP_441859.1_3 Forward -247 -228 8.35677 0.139
NP_441859.1_3 Reverse -62 -81 5.2102 0.206
NP_440304.1_4 Reverse -235 -245 17.9746 0.00654
NP_440304.1_4 Forward -248 -238 10.8948 0.051
NP_440304.1_4 Forward -74 -64 10.8948 0.051
NP_440304.1_4 Reverse -61 -71 10.8948 0.051
NP_440304.1_4 Reverse -1 -11 2.43831 0.299
NP_442242.1_4 Forward -245 -238 14.3954 0.0124
NP_442242.1_4 Reverse -238 -245 14.3954 0.0124
NP_442242.1_4 Forward -71 -64 14.3954 0.0124
NP_442242.1_4 Reverse -64 -71 14.3954 0.0124
NP_440044.1_8 Reverse -238 -257 4.12936 0.12
NP_441035.1_3 Forward -321 -302 -0.688862 0.297
NP_439918.1_3 Reverse -234 -253 2.75272 0.281
NP_441208.1_1 Forward -298 -279 -4.72043 0.263
NP_441208.1_9 Reverse -234 -248 14.3559 0.0974
NP_441208.1_9 Forward -75 -61 6.09611 0.253
NP_441594.1_6 Reverse -66 -85 4.32602 0.221
NP_441594.1_6 Forward -81 -62 1.76941 0.262
NP_442110.1_7 Reverse -63 -77 3.53951 0.21
NP_442110.1_7 Reverse -237 -251 3.44117 0.21
NP_441925.1_4 Reverse -335 -354 -17.1108 0.288
NP_440856.1_1 Forward -256 -237 -0.885524 0.231
NP_440856.1_4 Forward -253 -234 18.289 0.0211
NP_440856.1_4 Forward -79 -60 3.93269 0.115
NP_441083.1_5 Forward -246 -236 19.3512 0.000718
NP_441083.1_5 Forward -72 -62 11.3864 0.0159
NP_441083.1_5 Reverse -237 -247 11.2881 0.0159
NP_441083.1_5 Reverse -63 -73 11.2881 0.0159
NP_442827.1_8 Reverse -229 -248 2.6536 0.156
NP_441149.1_9 Reverse -170 -189 3.73524 0.221
NP_441434.1_7 Forward -244 -230 3.63784 0.23
NP_441738.1_2 Forward -244 -237 15.28 0.0102
NP_441738.1_2 Reverse -239 -246 15.28 0.0102
NP_441738.1_2 Forward -70 -63 15.28 0.0102
NP_441738.1_2 Reverse -65 -72 15.28 0.0102
NP_441558.1_5 Forward -74 -55 11.4058 0.0814
NP_441558.1_5 Forward -248 -229 10.6192 0.0955
NP_440209.1_1 Reverse -237 -245 18.1123 0.00295
NP_440209.1_1 Reverse -63 -71 18.1123 0.00295
NP_440209.1_1 Forward -246 -238 18.1123 0.00295
NP_440209.1_1 Forward -72 -64 18.1123 0.00295
NP_442889.1_8 Reverse -60 -74 4.03056 0.27
NP_440447.1_6 Reverse -265 -283 0.117479 0.295
NP_441713.1_1 Reverse -57 -76 -5.40875 0.113
NP_441713.1_1 Reverse -231 -250 -12.0953 0.242
NP_441713.1_1 Forward -78 -59 -15.3402 0.261
NP_441770.1_1 Reverse -341 -360 10.1267 0.29
NP_441770.1_4 Forward -209 -190 -10.522 0.272
NP_440178.1_7 Reverse -248 -267 -22.42 0.265
NP_442570.1_3 Forward -336 -317 2.55606 0.186
NP_441716.1_1 Reverse -63 -77 10.6193 0.0936
NP_441716.1_1 Forward -246 -232 8.75105 0.133
NP_441716.1_1 Reverse -237 -251 7.86607 0.156
NP_441716.1_1 Forward -87 -73 4.03116 0.259
NP_442111.1_4 Reverse -236 -250 20.1574 0.00327
NP_442111.1_4 Reverse -62 -76 13.4709 0.0383
NP_441624.1_7 Forward -238 -224 9.34103 0.223
NP_441163.1_1 Reverse -229 -246 5.44632 0.274
NP_440906.1_5 Forward -245 -238 15.8704 0.0124
NP_440906.1_5 Reverse -238 -245 15.8704 0.0124
NP_440906.1_5 Forward -71 -64 15.8704 0.0124
NP_440906.1_5 Reverse -64 -71 15.8704 0.0124
NP_440747.1_10 Forward -249 -237 17.1486 0.000663
NP_440747.1_10 Forward -75 -63 17.1486 0.000663
NP_440747.1_10 Reverse -234 -246 -1.92764 0.0192
NP_440747.1_10 Reverse -60 -72 -2.02597 0.0196
NP_440747.1_10 Forward -15 -3 -11.9574 0.178
NP_441130.1_10 Reverse -61 -75 10.521 0.112
NP_441130.1_10 Forward -248 -234 8.94771 0.131
NP_441130.1_10 Reverse -235 -249 7.27608 0.164
NP_441486.1_1 Reverse -60 -74 4.91614 0.0399
NP_441486.1_1 Forward -75 -61 -6.39192 0.294
NP_440944.1_2 Reverse -51 -70 -0.197208 0.256
NP_442634.1_4 Reverse -235 -249 14.4542 0.0192
NP_442634.1_4 Forward -74 -60 7.07942 0.0479
NP_442634.1_4 Forward -248 -234 5.70279 0.0525
NP_442634.1_4 Reverse -61 -75 -1.18038 0.149
NP_441265.1_3 Reverse -231 -245 3.8345 0.181
NP_442848.1_1 Reverse -152 -166 0.0979218 0.263
NP_443018.1_3 Forward -245 -238 14.8871 0.0123
NP_443018.1_3 Reverse -238 -245 14.8871 0.0123
NP_443018.1_3 Forward -71 -64 14.8871 0.0123
NP_443018.1_3 Reverse -64 -71 14.8871 0.0123
NP_441316.1_7 Reverse -61 -76 6.46974 0.107
NP_441316.1_7 Reverse -235 -250 5.19144 0.121
NP_441634.1_8 Forward -248 -234 5.30946 0.114
NP_441634.1_8 Forward -74 -60 5.30946 0.114
NP_440376.1_1 Forward -246 -237 19.4693 0.000692
NP_440376.1_1 Reverse -237 -246 19.4693 0.000692
NP_440376.1_1 Forward -72 -63 19.4693 0.000692
NP_440376.1_1 Reverse -63 -72 19.4693 0.000692
NP_440376.1_1 Reverse -166 -175 1.76968 0.242
NP_441588.1_4 Forward -70 -60 6.96153 0.178
NP_442687.1_7 Reverse -236 -246 18.5646 0.0028
NP_442687.1_7 Reverse -62 -72 15.8113 0.0125
NP_442687.1_7 Reverse -248 -258 14.6313 0.0267
NP_442687.1_7 Forward -247 -237 9.02648 0.0994
NP_442687.1_7 Forward -73 -63 9.02648 0.0994
NP_442687.1_7 Reverse -2 -12 6.56821 0.159
NP_442687.1_7 Forward -319 -309 5.38824 0.206
NP_442191.1_4 Reverse -64 -78 10.7992 0.288
NP_442485.1_3 Reverse -73 -92 -3.93378 0.277
NP_441846.1_10 Reverse -74 -93 -14.5535 0.232
NP_442958.1_3 Forward -257 -238 5.89931 0.197
NP_442583.1_8 Reverse -238 -257 8.45592 0.248
NP_442530.1_2 Reverse -206 -216 13.648 0.226
NP_441013.1_2 Forward -310 -292 3.85406 0.23
NP_441013.1_3 Forward -345 -326 7.37428 0.266
NP_441422.1_7 Reverse -61 -78 -4.09106 0.238
NP_441029.1_4 Forward -322 -303 6.29264 0.189
NP_440667.1_2 Forward -351 -332 -7.17871 0.273
NP_441763.1_10 Reverse -52 -71 10.3234 0.16
NP_440360.1_10 Reverse -374 -388 2.75286 0.261
NP_442658.1_1 Reverse -235 -245 17.6791 0.00565
NP_442658.1_1 Reverse -61 -71 15.9091 0.00966
NP_442658.1_1 Forward -248 -238 14.2375 0.0237
NP_442658.1_1 Forward -74 -64 14.2375 0.0237
NP_440141.1_4 Forward -123 -104 -5.50708 0.296
NP_440141.1_8 Forward -399 -380 4.32602 0.291
NP_442782.1_2 Reverse -63 -77 1.57289 0.281
NP_442782.1_2 Reverse -237 -251 1.47456 0.281
NP_442205.1_9 Reverse -231 -247 -0.138127 0.264
NP_442544.1_6 Forward -253 -234 -8.55534 0.298
NP_442544.1_6 Forward -79 -60 -9.14533 0.298
NP_441414.1_9 Forward -72 -53 -5.21209 0.171
NP_441478.1_5 Reverse -376 -395 14.7491 0.263
NP_439959.1_4 Forward -333 -314 17.7974 0.279
NP_442937.1_5 Forward -140 -121 14.4541 0.0758
NP_442937.1_5 Forward -392 -373 8.75091 0.212
NP_441958.1_5 Forward -247 -237 21.2195 0.000805
NP_441958.1_5 Forward -73 -63 21.2195 0.000805
NP_441958.1_5 Reverse -236 -246 20.5312 0.000966
NP_441958.1_5 Reverse -62 -72 12.2714 0.00183
NP_441127.1_1 Forward -393 -379 8.25939 0.3
NP_442486.1_6 Reverse -284 -303 1.27776 0.266
NP_442836.1_5 Forward -78 -59 5.60432 0.185
NP_442836.1_5 Reverse -231 -250 4.52268 0.206
NP_440984.1_7 Reverse -232 -246 6.19444 0.224
NP_439990.1_5 Forward -77 -64 20.1771 0.00546
NP_439990.1_5 Forward -251 -238 10.7374 0.128
NP_439990.1_5 Reverse -58 -71 6.70579 0.223
NP_442376.1_2 Reverse -232 -251 -11.0136 0.286
NP_442911.1_2 Reverse -53 -72 4.916 0.0361
NP_442911.1_2 Forward -82 -63 -1.18052 0.082
NP_442911.1_2 Reverse -227 -246 -3.54046 0.114
NP_442911.1_2 Forward -256 -237 -10.522 0.282
NP_442911.1_2 Forward -356 -337 -11.1119 0.299
NP_440153.1_5 Reverse -64 -78 4.32615 0.199
NP_440153.1_5 Reverse -238 -252 2.06454 0.239
NP_442064.1_4 Forward -97 -78 9.63507 0.204
NP_443055.1_3 Forward -174 -155 12.6504 0.205
NP_443055.1_6 Forward -246 -228 -2.63651 0.298
NP_440993.1_2 Forward -251 -235 13.2349 0.0656
NP_440471.1_7 Forward -106 -92 21.3374 0.278
NP_443044.1_1 Forward -289 -270 7.96426 0.243
NP_441099.1_5 Forward -256 -237 9.43923 0.0328
NP_441099.1_5 Forward -82 -63 -8.45701 0.194
NP_441099.1_5 Reverse -53 -72 -9.63698 0.229
NP_442002.1_9 Reverse -236 -243 14.1004 0.074
NP_442002.1_9 Reverse -272 -279 12.4288 0.185
NP_442002.1_9 Reverse -62 -69 10.7572 0.185
NP_440809.1_9 Forward -255 -237 -7.94566 0.225
NP_440809.1_9 Reverse -54 -72 -8.04399 0.225
NP_441294.1_7 Reverse -233 -247 13.2821 0.0711
NP_441646.1_1 Reverse -242 -261 -1.08219 0.278
NP_442438.1_10 Forward -351 -337 3.24451 0.165
NP_442438.1_10 Reverse -58 -72 1.57289 0.191
NP_442438.1_10 Reverse -304 -318 -1.18038 0.296
NP_442431.1_7 Forward -193 -174 12.3892 0.175
NP_441000.1_6 Reverse -236 -250 -3.04867 0.221
NP_441000.1_6 Forward -73 -59 -3.34366 0.221
NP_441000.1_6 Reverse -62 -76 -4.03198 0.225
NP_441000.1_6 Forward -247 -233 -4.7203 0.251
NP_442771.1_1 Reverse -335 -353 3.26407 0.0672
NP_440147.1_4 Forward -248 -235 19.9805 0.00251
NP_440147.1_4 Reverse -235 -248 11.0324 0.0341
NP_440147.1_4 Reverse -61 -74 10.4424 0.0355
NP_440147.1_4 Forward -74 -61 8.9674 0.0448
NP_440147.1_4 Reverse -1 -14 4.44418 0.16
NP_441550.1_8 Reverse -235 -245 19.8424 0.00352
NP_441550.1_8 Forward -248 -238 15.8108 0.0132
NP_441550.1_8 Forward -74 -64 15.8108 0.0132
NP_441550.1_8 Reverse -61 -71 6.0761 0.214
NP_441916.1_7 Reverse -237 -247 18.9579 0.00144
NP_441916.1_7 Reverse -63 -73 18.9579 0.00144
NP_441916.1_7 Forward -72 -62 18.4663 0.00144
NP_441916.1_7 Forward -246 -236 16.893 0.00407
NP_441916.1_7 Reverse -156 -166 1.55333 0.282
NP_441041.1_4 Forward -72 -53 5.40766 0.0512
NP_441041.1_4 Reverse -237 -256 -8.35868 0.2
NP_441041.1_4 Reverse -63 -82 -9.73531 0.222
NP_441041.1_7 Reverse -234 -246 21.8971 0.000853
NP_441041.1_7 Forward -249 -237 13.3454 0.0485
NP_441041.1_7 Forward -75 -63 13.3454 0.0485
NP_441041.1_7 Reverse -60 -72 10.916 0.0864
NP_441041.1_7 Forward -15 -3 7.70913 0.162
NP_442396.1_5 Reverse -59 -72 6.90245 0.215
NP_441547.1_2 Forward -257 -239 11.2289 0.169
NP_441725.1_4 Forward -251 -237 22.7134 0.00544
NP_441725.1_4 Forward -77 -63 13.7653 0.0693
NP_441725.1_4 Forward -170 -156 6.58715 0.271
NP_441725.1_5 Forward -245 -235 18.7612 0.0119
NP_441725.1_5 Forward -71 -61 11.2881 0.0247
NP_441725.1_5 Reverse -238 -248 1.94665 0.115
NP_441725.1_5 Reverse -64 -74 1.94665 0.115
NP_439966.1_7 Reverse -61 -71 18.4657 0.00473
NP_439966.1_7 Forward -248 -238 14.3359 0.0203
NP_439966.1_7 Forward -74 -64 14.3359 0.0203
NP_439966.1_7 Reverse -235 -245 8.14104 0.14
NP_439966.1_9 Reverse -235 -244 0.983037 0.253
NP_439966.1_9 Reverse -61 -70 0.983037 0.253
NP_442941.1_3 Reverse -238 -248 19.2529 0.00262
NP_442941.1_3 Reverse -64 -74 19.2529 0.00262
NP_442941.1_3 Forward -71 -61 11.4848 0.0116
NP_442941.1_3 Forward -245 -235 2.43831 0.14
NP_440289.1_2 Reverse -60 -73 14.5723 0.0107
NP_440289.1_2 Reverse -234 -247 14.1789 0.0118
NP_440289.1_2 Forward -249 -236 6.01747 0.0605
NP_440289.1_2 Forward -75 -62 -3.52063 0.267
NP_440289.1_2 Forward -170 -157 -4.20895 0.283
NP_440983.1_5 Reverse -342 -361 -5.9004 0.273
NP_442281.1_1 Forward -251 -237 17.2068 0.00633
NP_442281.1_1 Reverse -58 -72 11.012 0.0511
NP_442281.1_1 Reverse -232 -246 10.6187 0.0562
NP_442281.1_1 Forward -77 -63 8.45543 0.0808
NP_442575.1_8 Reverse -297 -316 0.392778 0.232
NP_442256.1_2 Reverse -235 -253 -1.84914 0.185
NP_440437.1_1 Forward -78 -59 12.1925 0.0354
NP_440437.1_1 Forward -252 -233 1.27776 0.153
NP_442012.1_1 Forward -252 -233 8.55425 0.099
NP_442012.1_5 Forward -358 -339 1.57275 0.275
NP_442982.1_5 Reverse -227 -246 -3.3438 0.297
NP_440453.1_7 Forward -73 -54 13.3725 0.238
NP_441644.1_6 Reverse -237 -247 19.0557 0.000803
NP_441644.1_6 Reverse -63 -73 19.0557 0.000803
NP_441644.1_6 Forward -246 -236 15.7125 0.0048
NP_441644.1_6 Forward -72 -62 10.1076 0.0628
NP_441644.1_6 Forward -305 -295 4.69947 0.228
NP_442215.1_1 Reverse -326 -345 1.86774 0.296
NP_442215.1_2 Reverse -288 -304 -1.21977 0.181
NP_442215.1_2 Forward -241 -225 -2.39974 0.197
NP_442177.1_5 Forward -360 -346 15.5359 0.22
NP_440253.1_2 Forward -72 -54 8.7706 0.0526
NP_440253.1_2 Reverse -237 -255 4.9357 0.1
NP_440253.1_2 Reverse -158 -176 -1.94747 0.254
NP_440253.1_2 Forward -246 -228 -3.02911 0.284
NP_440929.1_8 Forward -246 -237 19.2726 0.000701
NP_440929.1_8 Reverse -237 -246 19.2726 0.000701
NP_440929.1_8 Forward -72 -63 19.2726 0.000701
NP_440929.1_8 Reverse -63 -72 19.2726 0.000701
NP_442933.1_10 Forward -246 -237 17.601 0.00325
NP_442933.1_10 Reverse -237 -246 17.601 0.00325
NP_442933.1_10 Forward -72 -63 17.601 0.00325
NP_442933.1_10 Reverse -63 -72 17.601 0.00325
NP_441095.1_6 Forward -286 -267 6.88262 0.262
NP_441751.2_8 Reverse -64 -78 14.7492 0.0119
NP_441751.2_8 Forward -245 -231 11.6026 0.0222
NP_441751.2_8 Reverse -238 -252 6.58777 0.0348
NP_441751.2_8 Forward -71 -57 3.14618 0.0713
NP_442926.1_3 Forward -257 -238 2.65439 0.295
NP_442554.1_8 Reverse -238 -248 17.2863 0.00543
NP_442554.1_8 Reverse -64 -74 17.2863 0.00543
NP_442554.1_8 Forward -245 -235 16.9913 0.0065
NP_442554.1_8 Forward -71 -61 13.8447 0.0145
NP_441762.1_7 Forward -73 -61 2.98891 0.0676
NP_441762.1_7 Forward -247 -235 2.69391 0.0676
NP_441762.1_7 Reverse -62 -74 2.30059 0.0676
NP_441762.1_7 Reverse -236 -248 1.7106 0.0735
NP_442142.1_4 Reverse -60 -73 16.4399 0.0264
NP_442142.1_4 Forward -75 -62 15.4566 0.0264
NP_442142.1_4 Reverse -234 -247 12.5067 0.0442
NP_442142.1_4 Reverse -293 -306 7.88518 0.127
NP_442142.1_4 Forward -249 -236 6.21356 0.17
NP_442142.1_4 Reverse -327 -340 4.83694 0.209
NP_442292.1_1 Reverse -238 -247 17.5026 0.00435
NP_442292.1_1 Reverse -64 -73 17.5026 0.00435
NP_442292.1_1 Forward -71 -62 9.63616 0.0183
NP_442292.1_1 Forward -245 -236 9.53783 0.0183
NP_442476.1_6 Reverse -238 -252 1.17956 0.228
NP_440895.1_6 Forward -78 -65 9.45906 0.22
NP_442381.1_8 Reverse -234 -253 -13.5702 0.276
NP_441523.1_6 Forward -250 -231 4.62101 0.251
NP_441523.1_6 Forward -76 -57 2.85105 0.283
NP_443009.1_5 Forward -73 -62 19.626 0.00102
NP_443009.1_5 Forward -247 -236 17.0694 0.00659
NP_443009.1_5 Reverse -236 -247 16.7744 0.00677
NP_443009.1_5 Reverse -62 -73 7.82632 0.118
NP_443009.1_5 Forward -319 -308 7.33466 0.132
NP_441715.1_4 Reverse -238 -248 16.7946 0.0106
NP_441715.1_4 Reverse -64 -74 16.7946 0.0106
NP_441715.1_4 Forward -71 -61 16.303 0.0117
NP_440357.1_6 Reverse -345 -364 5.60432 0.279
NP_440015.1_9 Forward -246 -228 6.31233 0.118
NP_441448.1_1 Forward -192 -173 3.83436 0.287
NP_441448.1_1 Forward -392 -373 3.34271 0.297
NP_441198.1_8 Reverse -235 -245 15.2245 0.0427
NP_441198.1_8 Reverse -307 -317 10.1462 0.296
NP_441468.1_1 Forward -245 -238 15.8704 0.0124
NP_441468.1_1 Reverse -238 -245 15.8704 0.0124
NP_441468.1_1 Forward -71 -64 15.8704 0.0124
NP_441468.1_1 Reverse -64 -71 15.8704 0.0124
NP_441020.2_6 Reverse -235 -252 10.3636 0.146
NP_441015.1_10 Forward -362 -343 -10.4236 0.284
NP_441673.1_1 Forward -246 -237 20.8459 0.000698
NP_441673.1_1 Reverse -237 -246 20.8459 0.000698
NP_441673.1_1 Forward -72 -63 20.8459 0.000698
NP_441673.1_1 Reverse -63 -72 20.8459 0.000698
NP_441731.1_1 Reverse -267 -285 12.7024 0.281
NP_441731.1_3 Forward -254 -235 -4.52377 0.284
NP_442253.1_5 Forward -321 -304 -0.157821 0.213
NP_441826.1_2 Reverse -231 -245 5.40779 0.0975
NP_441826.1_2 Forward -78 -64 -1.96703 0.261
NP_441826.1_2 Reverse -342 -356 -2.16369 0.267
NP_441826.1_2 Forward -252 -238 -4.81863 0.3
NP_441826.1_5 Forward -363 -344 2.65439 0.276
NP_441330.1_1 Forward -263 -244 -8.55534 0.183
NP_442811.1_2 Forward -395 -376 -0.197208 0.252
NP_442490.1_9 Forward -258 -239 -4.81876 0.273
NP_442490.1_9 Reverse -237 -256 -7.57203 0.278
NP_442490.1_10 Reverse -68 -86 11.0322 0.21
NP_442868.1_6 Reverse -235 -245 16.7946 0.0131
NP_442868.1_6 Forward -248 -238 10.4031 0.038
NP_442868.1_6 Forward -74 -64 10.4031 0.038
NP_442868.1_6 Reverse -61 -71 0.963343 0.205
NP_441056.1_1 Reverse -63 -82 -8.35868 0.282
NP_441612.1_2 Forward -269 -259 11.7441 0.21
NP_442227.1_2 Reverse -289 -308 6.78429 0.198
NP_442808.1_1 Reverse -62 -72 18.4657 0.00201
NP_442808.1_1 Reverse -383 -393 13.7459 0.047
NP_442808.1_1 Reverse -236 -246 8.73102 0.0481
NP_442808.1_1 Forward -247 -237 8.73102 0.0481
NP_442808.1_1 Forward -73 -63 8.73102 0.0481
NP_441101.1_10 Forward -250 -231 2.3594 0.173
NP_441315.1_2 Forward -306 -288 15.8575 0.222
NP_440145.1_3 Forward -82 -63 1.57275 0.126
NP_440145.1_3 Forward -256 -237 0.884433 0.133
NP_442542.1_2 Reverse -235 -248 11.9173 0.114
NP_442542.1_2 Forward -143 -130 4.64084 0.299
NP_442050.1_5 Forward -248 -238 15.9091 0.0091
NP_442050.1_5 Forward -74 -64 15.9091 0.0091
NP_442050.1_5 Reverse -235 -245 14.9258 0.0175
NP_442050.1_5 Reverse -61 -71 9.12434 0.193
NP_440038.1_4 Forward -80 -61 -0.590531 0.288
NP_442342.1_9 Reverse -235 -251 5.36841 0.239
NP_440558.1_2 Forward -81 -62 -1.47551 0.214
NP_440558.1_2 Forward -321 -302 -2.75381 0.229
NP_440558.1_2 Reverse -305 -324 -2.95047 0.232
NP_440558.1_2 Forward -255 -236 -4.13045 0.243
NP_441878.1_6 Reverse -236 -246 20.2362 0.0046
NP_441878.1_6 Forward -247 -237 10.5014 0.0176
NP_441878.1_6 Forward -73 -63 10.5014 0.0176
NP_441878.1_6 Reverse -62 -72 10.4031 0.0176
NP_441878.1_6 Reverse -248 -258 -6.90313 0.198
NP_441878.1_6 Reverse -308 -318 -7.39479 0.222
NP_441036.1_8 Reverse -62 -72 17.7779 0.000554
NP_441036.1_8 Forward -247 -237 15.713 0.00724
NP_441036.1_8 Forward -73 -63 15.713 0.00724
NP_441036.1_8 Reverse -236 -246 8.4365 0.174
NP_441557.1_5 Forward -246 -237 19.9609 0.000699
NP_441557.1_5 Reverse -237 -246 19.9609 0.000699
NP_441557.1_5 Forward -72 -63 19.9609 0.000699
NP_441557.1_5 Reverse -63 -72 19.9609 0.000699
NP_441445.1_1 Reverse -54 -73 3.93269 0.204
NP_441445.1_1 Forward -327 -308 2.65439 0.233
NP_441590.1_3 Reverse -286 -305 12.8808 0.205
NP_442066.2_4 Reverse -63 -82 -8.65367 0.294
NP_442066.2_9 Reverse -59 -72 9.36073 0.175
NP_441433.1_8 Forward -116 -97 -3.14714 0.276
NP_441308.1_8 Reverse -61 -71 10.1081 0.22
NP_442183.1_1 Forward -72 -58 13.4709 0.0423
NP_442183.1_1 Reverse -237 -251 9.43936 0.098
NP_442183.1_1 Forward -246 -232 8.55439 0.113
NP_442166.1_7 Reverse -64 -78 11.996 0.184
NP_442166.1_7 Reverse -4 -18 9.43936 0.191
NP_440356.1_1 Reverse -178 -197 13.0766 0.247
NP_442135.1_3 Reverse -225 -244 9.14423 0.192
NP_442347.1_2 Forward -71 -62 11.1111 0.056
NP_442347.1_2 Forward -245 -236 3.34298 0.284
NP_442347.1_2 Reverse -238 -247 3.34298 0.284
NP_442347.1_2 Reverse -64 -73 3.34298 0.284
NP_442645.1_2 Forward -80 -61 -15.1435 0.19
NP_442888.1_7 Forward -95 -76 11.6025 0.281
NP_441037.1_4 Reverse -235 -245 18.9151 0.00351
NP_441037.1_4 Forward -248 -238 7.22024 0.237
NP_441037.1_4 Forward -74 -64 7.22024 0.237
NP_441037.1_4 Reverse -61 -71 7.02532 0.237
NP_442317.1_6 Forward -251 -232 16.4207 0.0832
NP_441633.1_3 Forward -248 -235 15.4572 0.0103
NP_441633.1_3 Reverse -101 -114 6.50913 0.0481
NP_441633.1_3 Forward -74 -61 3.5592 0.0699
NP_441633.1_3 Reverse -61 -74 -3.81562 0.177
NP_440136.1_2 Forward -245 -238 15.9687 0.0123
NP_440136.1_2 Reverse -238 -245 15.9687 0.0123
NP_440136.1_2 Forward -71 -64 15.9687 0.0123
NP_440136.1_2 Reverse -64 -71 15.9687 0.0123
NP_440136.1_2 Forward -111 -104 3.97235 0.288
NP_442998.1_5 Reverse -191 -201 9.41981 0.241
NP_442998.1_10 Forward -244 -237 15.5754 0.0102
NP_442998.1_10 Reverse -239 -246 15.5754 0.0102
NP_442998.1_10 Forward -70 -63 15.5754 0.0102
NP_442998.1_10 Reverse -65 -72 15.5754 0.0102
NP_440299.1_1 Forward -250 -237 11.1301 0.0518
NP_440299.1_1 Forward -76 -63 11.1301 0.0518
NP_440299.1_1 Reverse -59 -72 2.18201 0.294
NP_441799.1_1 Reverse -233 -247 12.2903 0.0441
NP_441799.1_1 Reverse -59 -73 11.9953 0.0487
NP_441799.1_1 Forward -76 -62 10.3237 0.0756
NP_441007.1_10 Reverse -232 -245 3.5592 0.182
NP_441007.1_10 Forward -251 -238 1.00259 0.209
NP_441007.1_10 Forward -398 -385 -0.37404 0.277
NP_442334.1_10 Reverse -69 -88 -16.4218 0.234
NP_442201.1_10 Reverse -2 -21 -13.3736 0.274
NP_442333.2_5 Reverse -326 -345 -14.3569 0.272
NP_440256.1_1 Forward -75 -56 2.55606 0.0625
NP_440256.1_1 Reverse -234 -253 -2.95047 0.125
NP_440256.1_1 Reverse -60 -79 -10.0303 0.293
NP_442961.1_9 Reverse -326 -345 23.7955 0.0238
NP_442283.1_2 Reverse -288 -307 8.94757 0.263
NP_441559.1_8 Forward -77 -63 20.4524 0.0414
NP_441559.1_8 Forward -251 -237 11.0127 0.0574
NP_441559.1_8 Forward -17 -3 4.22782 0.127
NP_441559.1_8 Reverse -161 -175 1.96621 0.151
NP_441559.1_8 Forward -107 -93 -5.60527 0.267
NP_441559.1_8 Forward -16 -2 -5.60527 0.267
NP_441559.1_8 Reverse -58 -72 -6.29359 0.276
NP_441559.1_8 Reverse -162 -176 -6.88358 0.281
NP_440915.1_6 Forward -250 -236 18.3875 0.0114
NP_440915.1_6 Reverse -233 -247 15.4376 0.0183
NP_440915.1_6 Forward -76 -62 10.6193 0.0301
NP_440915.1_6 Forward -355 -341 8.65272 0.0522
NP_440915.1_6 Reverse -59 -73 5.80112 0.0879
NP_441179.1_1 Forward -146 -127 1.67108 0.267
NP_440717.1_1 Reverse -343 -362 5.70265 0.272
NP_441464.1_1 Forward -250 -231 10.9142 0.24
NP_441464.1_8 Forward -246 -232 18.6825 0.072
NP_440695.1_5 Forward -258 -239 4.42435 0.202
NP_440695.1_5 Reverse -63 -82 -0.688862 0.284
NP_441939.1_3 Forward -245 -226 8.65258 0.167
NP_441939.1_6 Forward -137 -118 15.6332 0.28
NP_441199.1_6 Forward -250 -231 13.6675 0.0437
NP_439985.1_7 Reverse -231 -250 8.75091 0.18
NP_442993.1_1 Forward -246 -230 11.3666 0.0142
NP_442993.1_1 Forward -72 -56 9.20332 0.0215
NP_442993.1_1 Reverse -63 -79 -9.18458 0.179
NP_442993.1_1 Forward -351 -335 -12.5278 0.274
NP_442386.1_9 Reverse -62 -71 15.7322 0.0144
NP_442386.1_9 Forward -247 -238 6.39082 0.219
NP_442386.1_9 Reverse -236 -245 6.39082 0.219
NP_442386.1_9 Forward -73 -64 6.39082 0.219
NP_442386.1_9 Forward -176 -167 5.30919 0.257
NP_442386.1_9 Reverse -383 -392 4.52254 0.297
NP_442054.1_4 Reverse -373 -392 10.5209 0.275
NP_442054.1_4 Forward -317 -298 6.4893 0.299
NP_441340.1_5 Forward -245 -238 15.6737 0.0124
NP_441340.1_5 Reverse -238 -245 15.6737 0.0124
NP_441340.1_5 Forward -71 -64 15.6737 0.0124
NP_441340.1_5 Reverse -64 -71 15.6737 0.0124
NP_441947.1_10 Reverse -61 -79 2.0841 0.276
NP_441947.1_10 Forward -365 -347 0.510803 0.276
NP_442484.1_2 Forward -237 -218 -1.57384 0.294
NP_442791.1_5 Reverse -71 -90 -9.73531 0.279
NP_442240.1_1 Forward -254 -235 3.83357 0.279
NP_442240.1_2 Reverse -238 -257 -10.522 0.137
NP_440161.1_3 Forward -74 -55 10.4225 0.23
NP_440161.1_3 Reverse -235 -254 7.27595 0.299
NP_441134.1_10 Forward -89 -71 9.85225 0.26
NP_440211.1_4 Reverse -270 -280 14.0414 0.29
NP_440586.1_8 Forward -245 -238 13.2151 0.026
NP_440586.1_8 Forward -71 -64 13.2151 0.026
NP_440586.1_8 Reverse -238 -245 13.2151 0.026
NP_440586.1_8 Reverse -64 -71 13.2151 0.026
NP_442251.1_6 Forward -245 -238 15.2804 0.0124
NP_442251.1_6 Reverse -238 -245 15.2804 0.0124
NP_442251.1_6 Forward -71 -64 15.2804 0.0124
NP_442251.1_6 Reverse -64 -71 15.2804 0.0124
NP_442959.1_7 Forward -307 -288 8.35759 0.13
NP_441262.1_3 Reverse -237 -244 14.7888 0.0223
NP_441262.1_3 Reverse -63 -70 14.7888 0.0223
NP_441262.1_3 Forward -246 -239 14.7888 0.0223
NP_441262.1_3 Forward -72 -65 14.7888 0.0223
NP_440027.1_3 Reverse -324 -342 2.67334 0.289
NP_440027.1_8 Reverse -60 -79 11.405 0.227
NP_443051.1_1 Forward -247 -238 19.5676 0.00335
NP_443051.1_1 Forward -73 -64 19.5676 0.00335
NP_443051.1_1 Reverse -236 -245 18.0926 0.00402
NP_443051.1_1 Reverse -62 -71 10.4228 0.00754
NP_439937.1_9 Reverse -307 -324 -1.92846 0.136
NP_439937.1_9 Reverse -236 -253 -7.04165 0.157
NP_439937.1_9 Reverse -62 -79 -8.61494 0.176
NP_439937.1_9 Forward -247 -230 -14.7114 0.287
NP_439937.1_9 Forward -73 -56 -16.4814 0.287
NP_441595.1_3 Forward -355 -345 16.598 0.202
NP_441595.1_5 Reverse -230 -248 8.18062 0.222
NP_440398.1_6 Forward -23 -4 6.68596 0.269
NP_440408.1_7 Reverse -20 -39 7.66927 0.284
NP_440408.1_7 Reverse -348 -367 7.47261 0.288
NP_440439.1_1 Forward -249 -236 20.0788 0.0105
NP_440439.1_1 Forward -75 -62 18.1122 0.0105
NP_440439.1_1 Reverse -60 -73 8.08242 0.0559
NP_440439.1_1 Reverse -234 -247 1.19926 0.159
NP_440372.1_2 Forward -245 -238 16.3621 0.0124
NP_440372.1_2 Reverse -238 -245 16.3621 0.0124
NP_440372.1_2 Forward -71 -64 16.3621 0.0124
NP_440372.1_2 Reverse -64 -71 16.3621 0.0124
NP_440271.1_2 Reverse -354 -373 5.99764 0.23
NP_440819.1_5 Forward -291 -283 7.59091 0.272
NP_441803.1_2 Forward -251 -232 4.71934 0.175
NP_439977.1_5 Forward -252 -233 4.32602 0.153
NP_439977.1_5 Reverse -284 -303 3.24438 0.16
NP_439977.1_5 Reverse -57 -76 2.26107 0.176
NP_439977.1_5 Reverse -378 -397 1.76941 0.188
NP_441572.1_7 Reverse -57 -76 1.57275 0.147
NP_441572.1_7 Reverse -231 -250 -2.0655 0.19
NP_441572.1_7 Forward -78 -59 -3.83545 0.22
NP_440267.1_2 Forward -287 -273 13.4703 0.125
NP_440267.1_2 Forward -251 -237 12.487 0.125
NP_442384.1_10 Reverse -237 -250 18.8988 0.00338
NP_442384.1_10 Reverse -63 -76 18.8988 0.00338
NP_442384.1_10 Forward -72 -59 6.50913 0.0995
NP_440364.1_6 Forward -306 -293 14.8666 0.275
NP_440364.1_10 Reverse -229 -248 16.8141 0.233
NP_441877.1_5 Reverse -163 -182 5.50599 0.195
NP_441018.1_7 Forward -361 -342 13.9625 0.131
NP_442790.1_4 Reverse -228 -247 2.0644 0.0729
NP_442790.1_4 Forward -81 -62 -15.9302 0.3
NP_442262.1_10 Forward -245 -238 14.1988 0.0123
NP_442262.1_10 Reverse -238 -245 14.1988 0.0123
NP_442262.1_10 Forward -71 -64 14.1988 0.0123
NP_442262.1_10 Reverse -64 -71 14.1988 0.0123
NP_441689.1_5 Reverse -61 -71 8.53436 0.132
NP_441689.1_5 Forward -248 -238 8.3377 0.132
NP_441689.1_5 Forward -74 -64 8.3377 0.132
NP_442244.1_6 Forward -351 -332 1.47442 0.291
NP_440163.1_10 Reverse -60 -70 15.2213 0.0762
NP_440344.1_10 Reverse -56 -73 2.98877 0.0276
NP_440344.1_10 Forward -253 -236 -6.84433 0.115
NP_440344.1_10 Forward -79 -62 -7.53264 0.118
NP_440344.1_10 Reverse -230 -247 -9.49926 0.147
NP_440531.1_8 Forward -348 -329 8.25926 0.216
NP_442910.1_1 Forward -253 -234 -4.13045 0.254
NP_441965.1_10 Reverse -60 -76 8.71166 0.123
NP_441965.1_10 Reverse -234 -250 7.92501 0.137
NP_442750.1_1 Forward -294 -275 14.1583 0.138
NP_442750.1_3 Reverse -270 -289 6.58763 0.154
NP_440297.1_9 Forward -245 -235 9.51814 0.0917
NP_440297.1_9 Forward -71 -61 9.32148 0.0917
NP_440297.1_9 Reverse -238 -248 -0.216628 0.282
NP_440297.1_9 Reverse -64 -74 -0.216628 0.282
NP_441896.1_3 Reverse -54 -73 3.24438 0.178
NP_441896.1_3 Reverse -94 -113 1.17943 0.22
NP_441896.1_3 Reverse -228 -247 -2.95047 0.294
NP_440894.1_10 Forward -89 -70 6.58763 0.215
NP_440894.1_10 Reverse -285 -304 4.12936 0.258
NP_440999.1_9 Reverse -59 -73 8.55439 0.074
NP_440999.1_9 Forward -250 -236 7.9644 0.0802
NP_440999.1_9 Reverse -233 -247 1.86788 0.157
NP_440999.1_9 Reverse -286 -300 1.27789 0.168
NP_440999.1_9 Forward -76 -62 1.17956 0.169
NP_440888.1_2 Forward -72 -58 14.5519 0.0168
NP_440888.1_2 Reverse -63 -77 14.2569 0.0193
NP_440888.1_2 Reverse -237 -251 13.2736 0.0307
NP_440888.1_2 Reverse -342 -356 10.2254 0.1
NP_440888.1_2 Forward -246 -232 8.75042 0.149
NP_440888.1_2 Forward -343 -329 7.27547 0.202
NP_440888.1_2 Reverse -290 -304 6.48882 0.232
NP_442948.1_2 Reverse -236 -255 13.1758 0.114
NP_442277.1_4 Forward -255 -236 9.14342 0.116
NP_442277.1_4 Forward -81 -62 6.98015 0.152
NP_442277.1_4 Reverse -228 -247 3.34192 0.226
NP_442033.1_10 Reverse -61 -80 -0.0988766 0.115
NP_442033.1_10 Reverse -235 -254 -2.45882 0.153
NP_440575.1_8 Forward -286 -267 -4.81876 0.268
NP_441543.1_2 Forward -71 -62 18.486 0.00236
NP_441543.1_2 Reverse -238 -247 15.9293 0.00518
NP_441543.1_2 Reverse -64 -73 15.9293 0.00518
NP_441543.1_2 Forward -245 -236 9.34117 0.0818
NP_442845.1_2 Forward -78 -64 4.71948 0.254
NP_442845.1_2 Reverse -57 -71 4.32615 0.261
NP_442845.1_4 Forward -248 -229 16.5191 0.117
NP_441834.1_7 Reverse -225 -244 13.6675 0.291
NP_441551.1_5 Reverse -59 -75 9.4976 0.21
NP_441551.1_5 Reverse -233 -249 8.41597 0.238
NP_441829.1_4 Forward -348 -334 20.2558 0.0746
NP_441469.1_8 Reverse -62 -71 16.126 0.00797
NP_441469.1_8 Reverse -236 -245 13.3727 0.073
NP_441469.1_8 Forward -247 -238 6.5879 0.227
NP_441469.1_8 Forward -73 -64 6.5879 0.227
NP_443064.1_6 Forward -246 -236 13.8273 0.0796
NP_443064.1_6 Reverse -237 -247 10.8217 0.13
NP_443064.1_6 Reverse -63 -73 10.8217 0.13
NP_442578.1_7 Forward -245 -238 14.5921 0.026
NP_442578.1_7 Forward -71 -64 14.5921 0.026
NP_442578.1_7 Reverse -238 -245 14.5921 0.026
NP_442578.1_7 Reverse -64 -71 14.5921 0.026
NP_440071.1_1 Reverse -347 -364 12.7228 0.223
NP_441462.1_2 Reverse -237 -247 20.2362 0.000805
NP_441462.1_2 Reverse -63 -73 20.2362 0.000805
NP_441462.1_2 Forward -246 -236 20.1379 0.000967
NP_441462.1_2 Forward -72 -62 11.5831 0.00406
NP_441621.1_7 Reverse -235 -249 12.4876 0.0393
NP_441621.1_7 Reverse -61 -75 4.32615 0.0934
NP_443062.1_1 Reverse -63 -81 11.1786 0.103
NP_443062.1_1 Reverse -237 -255 9.42349 0.134
NP_443062.1_1 Forward -72 -54 8.15589 0.159
NP_443062.1_6 Reverse -55 -74 13.2741 0.0914
NP_443062.1_6 Forward -254 -235 7.96426 0.157
NP_441410.1_3 Reverse -228 -247 8.25926 0.21
NP_442204.1_1 Forward -250 -239 21.1015 0.0035
NP_442204.1_1 Forward -76 -65 21.1015 0.0035
NP_442204.1_1 Forward -273 -262 0.157002 0.283
NP_441560.1_8 Forward -77 -58 17.1612 0.0542
NP_441351.1_8 Forward -137 -118 1.76941 0.267
NP_440516.1_2 Reverse -57 -75 5.91901 0.122
NP_440516.1_2 Forward -78 -60 -2.73412 0.299
NP_440516.1_8 Forward -246 -237 16.9127 0.00442
NP_440516.1_8 Reverse -237 -246 16.9127 0.00442
NP_440516.1_8 Forward -72 -63 16.9127 0.00442
NP_440516.1_8 Reverse -63 -72 16.9127 0.00442
NP_442428.1_5 Forward -245 -238 15.8704 0.0124
NP_442428.1_5 Reverse -238 -245 15.8704 0.0124
NP_442428.1_5 Forward -71 -64 15.8704 0.0124
NP_442428.1_5 Reverse -64 -71 15.8704 0.0124
NP_442428.1_8 Reverse -68 -87 -2.0655 0.289
NP_442120.1_10 Forward -351 -332 -8.65367 0.237
NP_442120.1_10 Reverse -231 -250 -15.1435 0.289
NP_441835.1_2 Forward -68 -49 5.60432 0.27
NP_440673.1_3 Forward -244 -237 12.4288 0.0426
NP_440673.1_3 Forward -70 -63 12.4288 0.0426
NP_440673.1_3 Reverse -239 -246 12.4288 0.0426
NP_440673.1_3 Reverse -65 -72 12.4288 0.0426
NP_440673.1_3 Forward -316 -309 8.29892 0.221
NP_440673.1_3 Forward -280 -273 7.51227 0.252
NP_440865.1_9 Reverse -231 -250 13.5691 0.0497
NP_440865.1_9 Reverse -57 -76 -8.26035 0.263
NP_440865.1_9 Forward -352 -333 -9.73531 0.299
NP_441052.1_2 Reverse -290 -300 12.1731 0.0285
NP_441052.1_2 Forward -72 -62 10.5014 0.0285
NP_441052.1_2 Forward -246 -236 10.4031 0.0285
NP_441052.1_2 Reverse -237 -247 10.4031 0.0285
NP_441052.1_2 Reverse -63 -73 10.4031 0.0285
NP_442219.1_8 Reverse -286 -305 8.45701 0.245
NP_442219.1_9 Forward -71 -62 8.35786 0.0681
NP_442219.1_9 Forward -245 -236 8.25953 0.0681
NP_442219.1_9 Reverse -238 -247 8.25953 0.0681
NP_442219.1_9 Reverse -64 -73 8.25953 0.0681
NP_440436.1_4 Forward -71 -62 18.1905 0.00233
NP_440436.1_4 Forward -245 -236 15.9289 0.00508
NP_440436.1_4 Reverse -238 -247 9.24241 0.0871
NP_440436.1_4 Reverse -64 -73 9.24241 0.0871
NP_441884.1_8 Reverse -236 -255 -9.34199 0.268
NP_441884.1_9 Reverse -234 -253 -15.5368 0.138
NP_441884.1_9 Reverse -287 -306 -21.83 0.266
NP_440314.1_9 Reverse -64 -83 -0.885524 0.117
NP_440314.1_9 Reverse -238 -257 -6.39206 0.228
NP_440314.1_9 Forward -245 -226 -8.65367 0.251
NP_440648.1_1 Reverse -63 -82 4.22769 0.228
NP_441719.1_4 Forward -245 -238 16.3621 0.0124
NP_441719.1_4 Reverse -238 -245 16.3621 0.0124
NP_441719.1_4 Forward -71 -64 16.3621 0.0124
NP_441719.1_4 Reverse -64 -71 16.3621 0.0124
NP_441733.1_10 Reverse -234 -247 9.95071 0.106
NP_441733.1_10 Forward -75 -62 5.82081 0.203
NP_441733.1_10 Forward -249 -236 4.05085 0.276
NP_441733.1_10 Forward -388 -375 3.46087 0.3
NP_441004.1_1 Reverse -70 -89 -14.0619 0.263
NP_441004.1_1 Reverse -231 -250 -16.8151 0.287
NP_442366.1_3 Reverse -62 -80 7.29564 0.0754
NP_442366.1_3 Reverse -236 -254 -3.81576 0.258
NP_442366.1_3 Forward -247 -229 -4.01242 0.262
NP_440129.1_10 Forward -253 -239 5.01447 0.185
NP_441115.1_4 Forward -73 -55 12.1131 0.115
NP_441115.1_4 Reverse -62 -80 9.55647 0.21
NP_441115.1_4 Forward -247 -229 7.78652 0.272
NP_442206.1_10 Reverse -237 -252 12.2713 0.0889
NP_443054.1_2 Forward -248 -234 17.5025 0.0359
NP_443054.1_2 Forward -74 -60 10.521 0.0761
NP_443054.1_2 Reverse -228 -242 0.196253 0.274
NP_441966.1_6 Reverse -287 -306 2.55606 0.289
NP_442586.1_6 Forward -120 -101 10.6192 0.227
NP_441851.1_10 Reverse -236 -246 17.4829 0.0027
NP_441851.1_10 Reverse -62 -72 16.008 0.00552
NP_441851.1_10 Forward -247 -237 8.53483 0.114
NP_441851.1_10 Forward -73 -63 8.53483 0.114
NP_441851.1_10 Forward -386 -376 7.45319 0.14
NP_441851.1_10 Forward -113 -103 4.60159 0.259
NP_441542.1_4 Reverse -180 -194 4.22782 0.264
NP_442515.1_1 Forward -247 -233 6.19444 0.1
NP_442515.1_1 Forward -73 -59 -4.62196 0.298
NP_442515.1_1 Reverse -236 -250 -4.7203 0.298
NP_440593.1_3 Forward -89 -70 -5.21209 0.259
NP_440463.1_7 Reverse -377 -391 15.3392 0.265
NP_440165.1_5 Reverse -236 -255 -6.58872 0.238
NP_442709.1_3 Reverse -56 -75 2.65439 0.293
NP_441349.1_10 Forward -256 -237 0.687771 0.0867
NP_441349.1_10 Forward -82 -63 -9.83364 0.297
NP_441409.1_6 Reverse -57 -76 4.81767 0.0349
NP_441409.1_6 Forward -252 -233 0.392778 0.0649
NP_441409.1_6 Forward -78 -59 -8.16202 0.164
NP_441409.1_6 Reverse -231 -250 -14.6519 0.263
NP_440389.1_2 Forward -182 -163 11.8975 0.281
NP_440432.1_9 Forward -245 -230 0.963207 0.156
NP_440432.1_9 Reverse -238 -253 -4.54333 0.211
NP_439960.1_10 Forward -306 -288 -0.7675 0.237
NP_439960.1_10 Forward -88 -70 -1.94747 0.246
NP_440474.1_8 Forward -71 -57 13.077 0.0759
NP_440474.1_8 Forward -245 -231 10.0287 0.149
NP_440474.1_8 Reverse -104 -118 5.40719 0.25
NP_441124.1_5 Reverse -191 -201 10.4299 0.289
NP_440431.1_3 Forward -259 -240 -3.93378 0.178
NP_442450.1_5 Reverse -235 -245 10.1081 0.115
NP_442450.1_5 Reverse -61 -71 9.32148 0.115
NP_440588.1_2 Forward -255 -236 12.9791 0.0227
NP_440588.1_2 Forward -81 -62 5.80098 0.0617
NP_439950.1_1 Reverse -118 -127 13.1761 0.277
NP_440195.1_5 Reverse -231 -250 0.786102 0.295
NP_442006.1_3 Reverse -70 -88 -4.79907 0.298
NP_442006.1_3 Reverse -35 -53 -5.68405 0.298
NP_440483.1_1 Forward -398 -379 -2.26216 0.208
NP_442243.1_1 Forward -252 -234 2.08335 0.204
NP_441570.1_1 Reverse -290 -308 -2.3408 0.065
NP_441570.1_1 Reverse -237 -255 -17.4838 0.278
NP_441078.1_4 Forward -246 -237 19.6659 0.0007
NP_441078.1_4 Reverse -237 -246 19.6659 0.0007
NP_441078.1_4 Forward -72 -63 19.6659 0.0007
NP_441078.1_4 Reverse -63 -72 19.6659 0.0007
NP_441078.1_4 Forward -258 -249 -0.786921 0.207
NP_441078.1_4 Reverse -249 -258 -1.96689 0.282
NP_442729.1_8 Reverse -59 -72 9.45906 0.125
NP_441663.1_8 Forward -311 -292 11.2092 0.0741
NP_441663.1_8 Forward -78 -59 1.0811 0.212
NP_441663.1_8 Forward -252 -233 0.294447 0.22
NP_440707.1_6 Forward -80 -61 14.0599 0.172
NP_440526.1_3 Forward -245 -234 20.7076 0.0073
NP_440526.1_3 Forward -71 -60 1.92649 0.267
NP_440526.1_3 Forward -345 -334 0.64819 0.273
NP_440526.1_3 Reverse -310 -321 0.156538 0.297
NP_441432.1_5 Forward -315 -301 12.8809 0.271
NP_441432.1_8 Forward -247 -238 16.8143 0.00595
NP_441432.1_8 Forward -73 -64 16.8143 0.00595
NP_441432.1_8 Reverse -236 -245 8.35786 0.0755
NP_441432.1_8 Reverse -62 -71 8.25953 0.0755
NP_441432.1_8 Forward -259 -250 2.85133 0.281
NP_442320.1_8 Reverse -57 -71 6.88276 0.0227
NP_442320.1_8 Reverse -231 -245 -1.8687 0.0845
NP_442320.1_8 Forward -252 -238 -2.95034 0.1
NP_441732.1_2 Forward -250 -234 3.10679 0.0141
NP_441732.1_2 Forward -76 -60 -6.62797 0.0495
NP_441030.1_6 Reverse -247 -266 16.4134 0.155
NP_440629.1_5 Reverse -92 -111 9.24257 0.269
NP_442815.1_2 Forward -301 -283 4.34571 0.243
NP_440760.1_1 Forward -246 -227 -13.8652 0.115
NP_440760.1_1 Reverse -63 -82 -20.7484 0.225
NP_441131.1_2 Forward -154 -135 5.40766 0.289
NP_440199.1_10 Reverse -60 -70 14.533 0.0861
NP_440199.1_10 Forward -302 -292 8.63316 0.231
NP_442146.1_5 Forward -64 -45 14.2574 0.188
NP_441945.1_10 Forward -312 -293 8.45592 0.273
NP_442353.1_4 Reverse -297 -316 6.58682 0.175
NP_441072.1_2 Reverse -226 -245 9.24257 0.22
NP_442400.1_1 Forward -249 -230 2.0644 0.203
NP_442400.1_10 Reverse -54 -67 7.12818 0.298
NP_442489.1_7 Forward -246 -237 20.1576 0.000695
NP_442489.1_7 Reverse -237 -246 20.1576 0.000695
NP_442489.1_7 Forward -72 -63 20.1576 0.000695
NP_442489.1_7 Reverse -63 -72 20.1576 0.000695
NP_442489.1_7 Forward -12 -3 -1.57357 0.213
NP_442489.1_7 Forward -258 -249 -1.96689 0.28
NP_442079.1_7 Reverse -238 -257 7.96426 0.13
NP_440559.1_1 Forward -245 -236 17.306 0.00658
NP_440559.1_1 Forward -71 -62 8.75118 0.0586
NP_440559.1_1 Reverse -238 -247 8.65285 0.0586
NP_440559.1_1 Reverse -64 -73 8.65285 0.0586
NP_441659.2_8 Reverse -237 -247 20.9245 0.000805
NP_441659.2_8 Reverse -63 -73 20.9245 0.000805
NP_441659.2_8 Forward -246 -236 19.3512 0.000966
NP_441659.2_8 Forward -72 -62 11.9764 0.0147
NP_441092.1_3 Reverse -65 -84 4.81767 0.183
NP_442913.1_10 Reverse -228 -247 -3.04881 0.198
NP_441040.1_2 Forward -359 -340 -7.86702 0.227
NP_442008.1_2 Reverse -234 -253 6.78429 0.217
NP_442776.1_1 Forward -257 -238 6.09597 0.234
NP_440779.1_5 Forward -246 -229 -3.99273 0.103
NP_442346.1_5 Reverse -236 -246 17.9746 0.00128
NP_442346.1_5 Forward -247 -237 16.303 0.00248
NP_442346.1_5 Forward -73 -63 16.303 0.00248
NP_442346.1_5 Reverse -62 -72 9.02648 0.118
NP_442346.1_5 Reverse -308 -318 8.92815 0.121
NP_440545.1_3 Reverse -233 -250 15.7718 0.0128
NP_440545.1_3 Forward -76 -59 4.16874 0.0738
NP_440545.1_3 Forward -250 -233 0.530496 0.137
NP_440545.1_3 Reverse -333 -350 -4.77938 0.232
NP_441856.1_3 Reverse -60 -79 0.982764 0.213
NP_441856.1_3 Forward -75 -56 0.884433 0.213
NP_440831.1_1 Forward -264 -245 9.3409 0.29
NP_441629.1_1 Reverse -55 -74 12.0942 0.154
NP_441629.1_3 Forward -28 -9 -3.14789 0.277
NP_441629.1_3 Reverse -317 -336 -3.54122 0.282
NP_440555.1_1 Forward -83 -64 2.0644 0.294
NP_441923.1_6 Forward -356 -342 15.5359 0.168
NP_441126.1_8 Forward -396 -383 6.01747 0.291
NP_440459.1_2 Reverse -294 -311 9.28195 0.23
NP_442603.1_7 Reverse -290 -304 14.2569 0.0707
NP_442603.1_7 Reverse -63 -77 9.53707 0.146
NP_442603.1_7 Reverse -237 -251 7.27547 0.211
NP_441888.1_7 Forward -251 -237 13.3726 0.0743
NP_441888.1_7 Forward -77 -63 3.8345 0.225
NP_440449.1_6 Reverse -229 -247 9.42299 0.177
NP_441948.1_4 Forward -119 -101 -5.48739 0.268
NP_442070.1_1 Reverse -220 -239 13.0775 0.229
NP_441833.1_4 Forward -245 -238 15.9687 0.0124
NP_441833.1_4 Reverse -238 -245 15.9687 0.0124
NP_441833.1_4 Forward -71 -64 15.9687 0.0124
NP_441833.1_4 Reverse -64 -71 15.9687 0.0124
NP_442699.1_8 Reverse -82 -101 -11.0136 0.238
NP_442162.1_9 Forward -245 -238 16.2637 0.0124
NP_442162.1_9 Reverse -238 -245 16.2637 0.0124
NP_442162.1_9 Forward -71 -64 16.2637 0.0124
NP_442162.1_9 Reverse -64 -71 16.2637 0.0124
NP_440671.1_4 Forward -78 -64 9.73436 0.172
NP_440671.1_4 Forward -252 -238 9.14437 0.184
NP_440671.1_4 Reverse -57 -71 7.86607 0.207
NP_440671.1_4 Reverse -231 -245 5.21113 0.289
NP_440224.1_1 Forward -257 -238 8.25926 0.0783
NP_442199.1_5 Forward -254 -235 0.392778 0.173
NP_442140.1_3 Forward -245 -235 14.828 0.0433
NP_442140.1_3 Forward -71 -61 8.33817 0.119
NP_442140.1_3 Reverse -238 -248 4.69992 0.238
NP_442140.1_3 Reverse -64 -74 4.69992 0.238
NP_442140.1_3 Forward -392 -382 4.0116 0.265
NP_440875.1_9 Reverse -239 -249 16.5483 0.0145
NP_440875.1_9 Reverse -65 -75 16.5483 0.0145
NP_440875.1_9 Forward -244 -234 8.5667 0.233
NP_440875.1_9 Forward -70 -60 8.37203 0.233
NP_441813.1_5 Forward -248 -238 18.1713 0.00743
NP_441813.1_5 Forward -74 -64 18.1713 0.00743
NP_441813.1_5 Reverse -61 -71 17.188 0.00979
NP_441813.1_5 Reverse -235 -245 8.92815 0.0347
NP_441813.1_5 Reverse -101 -111 -0.609952 0.261
NP_440590.1_4 Reverse -64 -77 6.4108 0.0575
NP_440590.1_4 Forward -71 -58 5.32916 0.0585
NP_440590.1_4 Forward -245 -232 4.8375 0.0585
NP_440590.1_4 Reverse -238 -251 -2.63565 0.247
NP_440567.1_1 Forward -71 -57 7.47274 0.0707
NP_440567.1_1 Reverse -238 -252 6.58777 0.0816
NP_440567.1_1 Forward -245 -231 0.786239 0.232
NP_442497.1_10 Forward -245 -236 19.8626 0.00532
NP_442497.1_10 Reverse -238 -247 17.601 0.00813
NP_442497.1_10 Reverse -64 -73 17.601 0.00813
NP_442497.1_10 Forward -71 -62 10.4228 0.0087
NP_440821.1_4 Reverse -235 -245 19.5479 0.00399
NP_440821.1_4 Reverse -61 -71 19.0562 0.00399
NP_440821.1_4 Forward -248 -238 2.24165 0.131
NP_440821.1_4 Forward -74 -64 2.24165 0.131
NP_440821.1_4 Forward -114 -104 -0.314959 0.251
NP_441239.1_9 Forward -248 -236 16.5586 0.0166
NP_441239.1_9 Forward -74 -62 15.5753 0.0186
NP_441239.1_9 Reverse -235 -247 14.4936 0.0272
NP_441239.1_9 Reverse -61 -73 13.3137 0.037
NP_441239.1_9 Reverse -307 -319 4.36554 0.253
NP_441009.1_4 Reverse -3 -22 14.2574 0.17
NP_440156.1_4 Forward -202 -192 16.7941 0.176
NP_441892.1_1 Reverse -228 -245 4.75873 0.107
NP_441892.1_1 Forward -81 -64 0.825489 0.161
NP_440665.1_1 Forward -311 -292 -10.0303 0.244
NP_442044.1_1 Forward -251 -232 -13.5702 0.277
NP_442643.1_1 Reverse -57 -76 -1.08219 0.143
NP_442643.1_3 Reverse -218 -237 -6.68705 0.261
NP_440900.1_1 Forward -336 -317 10.0292 0.208
NP_440354.1_7 Forward -167 -149 10.3439 0.224
NP_440546.1_4 Reverse -237 -247 13.5365 0.0459
NP_440546.1_4 Reverse -63 -73 13.5365 0.0459
NP_440546.1_4 Forward -246 -236 12.8578 0.0572
NP_440546.1_4 Forward -72 -62 11.8882 0.0679
NP_440546.1_4 Forward -143 -133 8.20381 0.199
NP_441230.1_5 Forward -263 -244 7.86593 0.16
NP_440462.1_6 Forward -248 -238 18.7612 0.00454
NP_440462.1_6 Forward -74 -64 18.7612 0.00454
NP_440462.1_6 Reverse -61 -71 15.418 0.0142
NP_440462.1_6 Reverse -235 -245 10.4031 0.0396
NP_440868.1_4 Reverse -59 -71 10.7571 0.0364
NP_440868.1_4 Forward -250 -238 8.00379 0.0602
NP_440868.1_4 Forward -76 -64 8.00379 0.0602
NP_440868.1_4 Reverse -233 -245 0.530633 0.21
NP_440868.1_8 Reverse -233 -252 -3.93378 0.263
NP_442499.1_1 Forward -251 -232 2.65439 0.286
NP_441249.1_1 Reverse -271 -290 3.93269 0.197
NP_440341.1_1 Reverse -12 -31 8.45592 0.192
NP_442402.1_10 Reverse -378 -388 10.6976 0.282
NP_441084.1_6 Forward -74 -60 10.2167 0.25
NP_440579.1_1 Forward -359 -340 23.7955 0.0279
NP_440579.1_2 Forward -338 -319 30.8754 0.000133
NP_440579.1_3 Forward -398 -379 32.4487 0.00000817
NP_440579.1_5 Forward -233 -214 22.0186 0.0746
NP_440579.1_7 Forward -148 -130 20.177 0.131
NP_440579.1_8 Forward -376 -362 22.4184 0.0119
NP_442039.1_4 Forward -245 -238 15.1821 0.0124
NP_442039.1_4 Reverse -238 -245 15.1821 0.0124
NP_442039.1_4 Forward -71 -64 15.1821 0.0124
NP_442039.1_4 Reverse -64 -71 15.1821 0.0124
NP_441926.1_3 Forward -246 -230 7.13836 0.17
NP_441926.1_3 Reverse -249 -265 2.71347 0.257
NP_442837.1_3 Forward -245 -238 15.7721 0.0124
NP_442837.1_3 Reverse -238 -245 15.7721 0.0124
NP_442837.1_3 Forward -71 -64 15.7721 0.0124
NP_442837.1_3 Reverse -64 -71 15.7721 0.0124
NP_440160.1_3 Reverse -351 -370 8.84842 0.275
NP_440160.1_9 Reverse -63 -82 7.57094 0.287
NP_439994.1_3 Forward -247 -228 16.9256 0.0741
NP_442053.1_1 Forward -246 -237 18.3876 0.0007
NP_442053.1_1 Reverse -237 -246 18.3876 0.0007
NP_442053.1_1 Forward -72 -63 18.3876 0.0007
NP_442053.1_1 Reverse -63 -72 18.3876 0.0007
NP_440505.1_3 Forward -248 -238 17.188 0.00332
NP_440505.1_3 Forward -74 -64 17.188 0.00332
NP_440505.1_3 Reverse -61 -71 13.8447 0.0247
NP_440505.1_3 Reverse -235 -245 7.84651 0.147
NP_440505.1_7 Forward -250 -231 4.42435 0.197
NP_441102.1_1 Reverse -238 -257 9.83255 0.154
NP_441252.1_6 Reverse -270 -277 11.9372 0.25
NP_442532.1_7 Forward -299 -285 2.16287 0.252
NP_440914.1_1 Reverse -237 -247 16.3248 0.00196
NP_440914.1_1 Reverse -63 -73 16.3248 0.00196
NP_440914.1_1 Forward -72 -62 8.6151 0.186
NP_440914.1_1 Forward -246 -236 8.51751 0.186
NP_441011.1_8 Forward -71 -62 16.9127 0.00602
NP_441011.1_8 Reverse -238 -247 16.6177 0.00602
NP_441011.1_8 Reverse -64 -73 16.6177 0.00602
NP_441011.1_8 Forward -245 -236 14.356 0.0249
NP_441011.1_8 Forward -375 -366 5.3096 0.271
NP_440303.1_2 Forward -274 -255 7.7676 0.241
NP_442533.1_6 Forward -246 -237 17.2076 0.00137
NP_442533.1_6 Reverse -237 -246 17.2076 0.00137
NP_442533.1_6 Forward -72 -63 17.2076 0.00137
NP_442533.1_6 Reverse -63 -72 17.2076 0.00137
NP_442232.1_3 Reverse -301 -320 -0.983855 0.153
NP_442232.1_3 Reverse -229 -248 -12.7836 0.282
NP_443016.1_10 Forward -360 -341 11.7008 0.218
NP_441482.1_7 Forward -252 -238 14.4542 0.0118
NP_441482.1_7 Forward -78 -64 6.98109 0.0257
NP_441482.1_7 Forward -171 -157 -3.54032 0.129
NP_439944.1_9 Forward -245 -235 17.4829 0.00423
NP_439944.1_9 Forward -71 -61 10.3048 0.0887
NP_439944.1_9 Reverse -238 -248 9.12481 0.1
NP_439944.1_9 Reverse -64 -74 9.12481 0.1
NP_441028.1_6 Forward -34 -24 3.42118 0.296
NP_440116.1_8 Reverse -64 -83 -3.93378 0.159
NP_440116.1_8 Reverse -238 -257 -7.08038 0.222
NP_440115.1_6 Forward -249 -239 14.0414 0.0615
NP_440115.1_6 Forward -75 -65 14.0414 0.0615
NP_440115.1_6 Reverse -234 -244 10.1081 0.115
NP_440115.1_6 Forward -168 -158 5.28991 0.259
NP_440115.1_6 Reverse -270 -280 5.09324 0.271
NP_440007.1_9 Forward -76 -62 2.06454 0.281
NP_440007.1_9 Forward -250 -236 1.96621 0.281
NP_440007.1_9 Reverse -59 -73 1.37622 0.285
NP_441347.1_5 Forward -252 -238 9.43874 0.269
NP_441972.1_5 Forward -257 -238 1.37609 0.135
NP_441972.1_5 Reverse -238 -257 -9.24366 0.282
NP_441106.1_1 Forward -247 -238 18.486 0.0028
NP_441106.1_1 Forward -73 -64 18.486 0.0028
NP_441106.1_1 Reverse -62 -71 18.191 0.0028
NP_441106.1_1 Reverse -236 -245 9.73449 0.0311
NP_441106.1_9 Reverse -278 -288 15.3197 0.289
NP_441420.1_1 Forward -352 -333 -3.04881 0.288
NP_441420.1_1 Forward -247 -228 -4.42544 0.292
NP_439903.1_6 Forward -261 -242 -0.787962 0.285
NP_442306.1_10 Forward -251 -232 -10.6203 0.11
NP_442306.1_10 Forward -77 -58 -19.4701 0.197
NP_442306.1_10 Forward -107 -88 -21.1417 0.247
NP_441286.1_1 Forward -247 -235 14.7886 0.00418
NP_441286.1_1 Forward -73 -61 5.05386 0.0259
NP_441286.1_1 Reverse -236 -248 -3.50094 0.145
NP_441286.1_1 Reverse -62 -74 -3.59927 0.145
NP_440670.1_8 Forward -246 -237 18.3876 0.000699
NP_440670.1_8 Reverse -237 -246 18.3876 0.000699
NP_440670.1_8 Forward -72 -63 18.3876 0.000699
NP_440670.1_8 Reverse -63 -72 18.3876 0.000699
NP_441479.1_1 Reverse -234 -253 6.39097 0.296
NP_441479.1_1 Reverse -60 -79 6.39097 0.296
NP_440886.1_7 Reverse -62 -72 17.7774 0.0011
NP_440886.1_7 Forward -247 -237 8.04271 0.0805
NP_440886.1_7 Reverse -236 -246 8.04271 0.0805
NP_440886.1_7 Forward -73 -63 8.04271 0.0805
NP_440886.1_7 Reverse -289 -299 7.0594 0.106
NP_440828.1_4 Reverse -338 -357 -7.57277 0.288
NP_440828.1_4 Reverse -125 -144 -7.76943 0.291
NP_442614.1_2 Forward -72 -58 7.17775 0.275
NP_442614.1_2 Reverse -303 -317 6.48943 0.291
NP_442614.1_2 Forward -246 -232 6.29277 0.291
NP_439995.1_5 Reverse -53 -72 3.73603 0.291
NP_442072.1_9 Forward -73 -55 -12.2722 0.0831
NP_442072.1_9 Reverse -236 -254 -12.5672 0.0852
NP_442072.1_9 Forward -247 -229 -20.6304 0.204
NP_442072.1_9 Reverse -62 -80 -22.6953 0.253
NP_441808.1_8 Forward -311 -292 5.89931 0.294
NP_440907.2_8 Forward -245 -235 19.449 0.00351
NP_440907.2_8 Reverse -238 -248 9.616 0.103
NP_440907.2_8 Reverse -64 -74 9.616 0.103
NP_440907.2_8 Forward -71 -61 7.84605 0.117
NP_441021.1_1 Reverse -238 -257 -3.54046 0.158
NP_441021.1_1 Forward -245 -226 -5.9004 0.177
NP_441463.1_3 Forward -256 -237 -1.37718 0.14
NP_441463.1_3 Reverse -53 -72 -8.752 0.273
NP_441626.1_2 Forward -245 -238 15.7721 0.0124
NP_441626.1_2 Reverse -238 -245 15.7721 0.0124
NP_441626.1_2 Forward -71 -64 15.7721 0.0124
NP_441626.1_2 Reverse -64 -71 15.7721 0.0124
NP_442365.1_5 Reverse -310 -329 10.0292 0.194
NP_442362.1_5 Reverse -102 -121 16.6165 0.15
NP_442238.1_3 Reverse -28 -47 17.7974 0.0498
NP_442794.1_1 Forward -250 -238 10.5604 0.0721
NP_442794.1_1 Forward -76 -64 10.5604 0.0721
NP_442615.1_1 Reverse -228 -246 9.16393 0.0264
NP_442615.1_1 Forward -255 -237 -0.275845 0.114
NP_442615.1_1 Reverse -240 -258 -0.865831 0.122
NP_442615.1_1 Reverse -54 -72 -5.48739 0.215
NP_441962.1_4 Reverse -304 -323 -6.49039 0.177
NP_441962.1_4 Reverse -232 -251 -12.9802 0.268
NP_441962.1_9 Reverse -150 -169 6.78429 0.258
NP_440387.1_1 Reverse -237 -253 -0.334789 0.137
NP_440387.1_1 Reverse -63 -79 -0.334789 0.137
NP_440387.1_1 Forward -72 -56 -2.98973 0.153
NP_441431.1_2 Forward -249 -235 13.4703 0.0891
NP_441431.1_2 Reverse -234 -248 7.27547 0.244
NP_441431.1_2 Forward -75 -61 7.27547 0.244
NP_441488.1_8 Forward -77 -63 8.75042 0.178
NP_441836.1_2 Reverse -57 -76 -1.27885 0.217
NP_440634.1_1 Forward -248 -229 12.2908 0.275
NP_441993.1_1 Reverse -231 -250 14.4212 0.0768
NP_441993.1_1 Forward -357 -338 6.52718 0.179
NP_440467.1_3 Forward -257 -238 13.8931 0.183
NP_440114.1_10 Forward -246 -232 15.4376 0.0252
NP_440114.1_10 Forward -72 -58 13.5693 0.0531
NP_442698.1_10 Forward -303 -284 2.55606 0.284
NP_442323.1_7 Forward -77 -58 5.30853 0.207
NP_442323.1_7 Forward -251 -232 3.34192 0.245
NP_441206.1_2 Forward -345 -326 11.0125 0.298
NP_441510.2_6 Reverse -324 -343 18.7798 0.0974
NP_440287.1_5 Forward -34 -15 15.6332 0.158
NP_440287.1_6 Reverse -54 -73 4.81767 0.196
NP_440293.1_3 Forward -345 -326 -1.67217 0.239
NP_440766.1_4 Forward -76 -62 7.76774 0.0871
NP_440766.1_4 Forward -250 -236 5.21113 0.113
NP_439988.1_7 Reverse -105 -119 12.0937 0.292
NP_441237.1_9 Forward -245 -235 17.2863 0.00348
NP_441531.1_6 Forward -308 -295 10.7374 0.254
NP_439910.1_2 Reverse -55 -72 16.0668 0.00131
NP_439910.1_2 Reverse -229 -246 -21.3973 0.183
NP_440457.1_1 Reverse -233 -245 8.20045 0.101
NP_440457.1_1 Forward -250 -238 7.70879 0.101
NP_440457.1_1 Forward -76 -64 7.70879 0.101
NP_440457.1_1 Forward -116 -104 2.98891 0.204
NP_440457.1_1 Reverse -59 -71 -0.0593532 0.25
NP_440798.1_6 Forward -245 -232 1.9859 0.188
NP_440142.1_7 Reverse -224 -243 8.94757 0.219
NP_440473.1_9 Reverse -226 -245 -7.37537 0.236
NP_442509.1_9 Forward -246 -236 17.3841 0.00128
NP_442509.1_9 Forward -72 -62 16.2041 0.00739
NP_442509.1_9 Forward -175 -165 10.5993 0.167
NP_442509.1_9 Reverse -237 -247 8.04271 0.192
NP_442509.1_9 Reverse -63 -73 8.04271 0.192
YP_003858595.1_2 Forward -37 -20 7.3146 0.234
NP_441765.1_4 Forward -210 -191 12.1925 0.183
NP_440554.1_4 Reverse -238 -248 17.9746 0.0131
NP_440554.1_4 Reverse -64 -74 17.9746 0.0131
NP_440554.1_4 Forward -71 -61 14.6313 0.02
NP_440554.1_4 Forward -245 -235 6.27322 0.123
NP_441885.1_5 Forward -72 -62 11.4848 0.00668
NP_441885.1_5 Forward -246 -236 11.3864 0.00668
NP_441885.1_5 Reverse -237 -247 11.3864 0.00668
NP_441885.1_5 Reverse -63 -73 11.3864 0.00668
NP_440478.1_10 Reverse -61 -75 6.3911 0.291
NP_441428.1_8 Reverse -55 -74 1.67108 0.298
NP_442341.1_7 Forward -73 -59 7.57108 0.102
NP_442341.1_7 Reverse -62 -76 1.67122 0.282
NP_442341.1_9 Forward -248 -234 12.192 0.109
NP_442341.1_9 Forward -74 -60 11.7987 0.118
NP_442341.1_9 Reverse -61 -75 5.50552 0.267
NP_441756.1_5 Forward -250 -231 -1.57384 0.258
NP_442395.2_4 Reverse -318 -337 2.9486 0.213
NP_442395.2_4 Reverse -62 -81 2.55527 0.221
NP_440191.1_8 Forward -27 -9 16.7346 0.254
NP_440423.1_6 Reverse -229 -248 -10.7186 0.159
NP_443000.1_7 Forward -248 -238 20.3345 0.00223
NP_443000.1_7 Forward -74 -64 20.3345 0.00223
NP_443000.1_7 Reverse -61 -71 8.73149 0.0437
NP_443000.1_7 Reverse -235 -245 2.14332 0.226
NP_443000.1_7 Forward -301 -291 1.65166 0.235
NP_440275.1_3 Reverse -235 -245 19.5479 0.00756
NP_440275.1_3 Forward -248 -238 16.1063 0.0155
NP_440275.1_3 Forward -74 -64 16.1063 0.0155
NP_440275.1_3 Reverse -61 -71 8.4365 0.0602
NP_440275.1_3 Reverse -335 -345 5.97822 0.129
NP_440275.1_3 Reverse -101 -111 4.79825 0.172
NP_440091.1_1 Reverse -233 -245 10.8554 0.0429
NP_440091.1_1 Reverse -59 -71 10.7571 0.0429
NP_440679.1_10 Forward -306 -287 -14.7502 0.245
NP_440679.1_10 Forward -355 -336 -20.3551 0.284
NP_442451.1_2 Reverse -329 -348 -9.44032 0.259
NP_442451.1_2 Reverse -301 -320 -10.227 0.265
NP_442591.1_3 Forward -269 -250 16.1257 0.286
NP_440149.1_8 Reverse -290 -309 -4.72043 0.213
NP_441105.1_3 Forward -83 -64 11.7008 0.0363
NP_441105.1_3 Forward -257 -238 -2.85214 0.169
NP_441105.1_3 Reverse -226 -245 -3.93378 0.188
NP_440216.1_1 Reverse -63 -77 7.37441 0.00942
NP_440216.1_1 Reverse -237 -251 7.27608 0.00942
NP_440216.1_1 Forward -246 -232 6.3911 0.0156
NP_440216.1_1 Forward -72 -58 -1.47537 0.0328
NP_440216.1_9 Reverse -350 -359 6.29291 0.289
NP_440172.1_1 Reverse -237 -247 17.5813 0.00421
NP_440172.1_1 Reverse -63 -73 17.5813 0.00421
NP_440172.1_1 Forward -246 -236 16.303 0.00854
NP_440172.1_1 Forward -72 -62 8.73149 0.0586
NP_440172.1_1 Reverse -273 -283 4.0116 0.208
NP_442015.1_10 Forward -250 -237 13.4906 0.0354
NP_442015.1_10 Forward -76 -63 13.4906 0.0354
NP_442015.1_10 Forward -303 -290 1.59258 0.204
NP_442015.1_10 Reverse -59 -72 0.805932 0.218
NP_442015.1_10 Reverse -245 -258 -1.06236 0.293
NP_441226.1_7 Forward -245 -238 14.4934 0.0123
NP_441226.1_7 Reverse -238 -245 14.4934 0.0123
NP_441226.1_7 Forward -71 -64 14.4934 0.0123
NP_441226.1_7 Reverse -64 -71 14.4934 0.0123
NP_441111.1_7 Forward -245 -237 18.7023 0.00294
NP_441111.1_7 Forward -71 -63 18.7023 0.00294
NP_441111.1_7 Reverse -238 -246 18.7023 0.00294
NP_441111.1_7 Reverse -64 -72 18.7023 0.00294
NP_441766.1_2 Forward -246 -237 17.5026 0.00297
NP_441766.1_2 Reverse -237 -246 17.5026 0.00297
NP_441766.1_2 Forward -72 -63 17.5026 0.00297
NP_441766.1_2 Reverse -63 -72 17.5026 0.00297
NP_442417.1_5 Reverse -237 -251 16.2242 0.0423
NP_442417.1_5 Reverse -63 -77 7.07942 0.197
NP_440416.1_9 Forward -253 -234 -13.2752 0.164
NP_440416.1_9 Forward -79 -60 -14.8485 0.18
NP_440416.1_9 Reverse -289 -308 -18.8801 0.266
NP_443052.1_8 Reverse -227 -246 -10.9153 0.218
NP_443052.1_8 Reverse -53 -72 -11.8986 0.241
NP_443052.1_8 Forward -151 -132 -13.4719 0.286
NP_443052.1_9 Reverse -101 -120 -5.70374 0.273
NP_442552.1_1 Reverse -168 -187 10.2259 0.191
NP_442116.1_6 Reverse -213 -230 5.78166 0.291
NP_440591.1_9 Reverse -230 -248 14.4738 0.0893
NP_442154.1_1 Forward -365 -347 1.88744 0.0787
NP_442154.1_1 Forward -119 -101 -15.1238 0.218
NP_441430.1_6 Reverse -298 -317 13.3725 0.187
NP_440261.1_5 Forward -245 -232 6.70579 0.0318
NP_440261.1_5 Reverse -64 -77 4.8375 0.0516
NP_440261.1_5 Reverse -238 -251 -2.73398 0.0924
NP_440261.1_5 Forward -71 -58 -2.93064 0.0983
NP_440261.1_5 Reverse -310 -323 -4.79893 0.17
NP_440988.1_10 Reverse -346 -360 6.2542 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGACAGAGGCGTTGGTGGGAACCATGTTATCCGTTACCCTGTTTGCAGTGGCGGTGCGGTCTTCCCTGGTGCTGCGTTTAGGGGTCATTGCTCCCCCCGATGGTGATGACGGCAAAAAATTGATTGCCCCAGAAGATGAACAGGCTATTACCCAGGCGATCGCCCCTTACCATTTGCGGTTAGAAATTATTGCCTATGAAGATTTAGCCAGTTTGACGGAAGCTTGGCAAACCCGGGCTATCCATTGTTGGTATGAAGCCGATGTGGCCATTTTAAATACCCCCGTGGTGCGGTTGCAGGAAATTCTCGCTCCGGCCCTAGTGTCCCAGGCGATCGCCGTTAAATTTGTGCCTGCTAGTACCAGTCCTGTTCCCCCTCTATACTCCCCGGAGGTTGCCCA

CDS

ATGAAAATTGTTTACCTAATTGCGGCCCTATTGTTCTACGCCAAAATGTTGTTCATCACGGGCAATGCTGTAGAACCATTAGAAGAAGTGGCGGTGGTGGAGAATTTGCTAGAGCAAACGGGAGCGCCCAATGTGGTGTCGGGGATTATTTTCCGCAATCGTTTGTACGACACCATGCTGGAGGTGGTGGTGTTTACCATTGCCATTATGGGGGTGCGCTTTTTGATGGCGGAGGAAAAGCCGGCCGCTATGGTCTATCAAGTGAGCGATGCTCCGTCGGTGGTGCTGGCCCGATTGGGGGCCATGATTGCCCTGCTGATTGGCATAGAATTGGCCATCCGGGGTCACCTTAGTCCGGGGGGAGGCTTTGCGGCCGGGGTAGCGGGGGGAACCGCCATTGGTCTAGTGGCCATTATTTCTTCGCCGGAATGGTTGCATCAACTGTACGAAAAATGGCAAGCCGCCAAGGTAGAAAAGTTATCGGTGTTGATTTTCCTCGTTCTGGCCGCCCTGAGTTTGCTGGGCATTAATTTTCCCTTGGATAATGCGGGCTGGATTCCTCTGTTGAACATGGTGGTGGCCCTAAAAGTGGCGATCGGTTCCTGGGGAGCGATTTTGGTCTTTATCCGCTATCGGGGGTTATTGTGA

Protein

MKIVYLIAALLFYAKMLFITGNAVEPLEEVAVVENLLEQTGAPNVVSGIIFRNRLYDTMLEVVVFTIAIMGVRFLMAEEKPAAMVYQVSDAPSVVLARLGAMIALLIGIELAIRGHLSPGGGFAAGVAGGTAIGLVAIISSPEWLHQLYEKWQAAKVEKLSVLIFLVLAALSLLGINFPLDNAGWIPLLNMVVALKVAIGSWGAILVFIRYRGLL