Your browser is old and dusty. Try Google Chrome!

Details for slr2011

ORF slr2011
Accession NP_440578.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -367 -353 12.8809 0.201
NP_441061.1_2 Reverse -105 -119 1.76955 0.183
NP_441061.1_2 Forward -354 -340 -2.45868 0.293
NP_440557.1_1 Forward -112 -93 12.6841 0.0797
NP_440557.1_1 Reverse -70 -89 2.85105 0.225
NP_441418.1_6 Forward -113 -94 -9.63698 0.0288
NP_441418.1_6 Forward -119 -100 -20.0601 0.103
NP_441418.1_6 Forward -355 -336 -29.4015 0.224
NP_441418.1_6 Reverse -162 -181 -30.1882 0.262
NP_440897.1_6 Reverse -104 -123 -3.73788 0.256
NP_441453.1_4 Reverse -162 -170 14.8674 0.00947
NP_441453.1_4 Forward -171 -163 6.80426 0.121
NP_441453.1_4 Forward -113 -105 6.70593 0.121
NP_442151.1_6 Reverse -104 -118 8.35772 0.175
NP_441818.1_6 Reverse -112 -126 13.8643 0.204
NP_441818.1_9 Forward -379 -360 -2.0655 0.201
NP_441818.1_9 Forward -382 -363 -5.01543 0.248
NP_441818.1_9 Forward -385 -366 -9.24366 0.288
NP_441818.1_9 Forward -355 -336 -9.83364 0.291
NP_440226.1_1 Reverse -162 -181 2.65439 0.256
NP_442173.1_1 Forward -170 -162 13.8841 0.0225
NP_442173.1_1 Reverse -163 -171 12.0158 0.0316
NP_442173.1_1 Reverse -105 -113 5.82095 0.2
NP_442752.1_4 Forward -171 -164 13.8055 0.0199
NP_442752.1_4 Forward -113 -106 13.8055 0.0199
NP_443027.1_4 Forward -115 -105 10.2065 0.138
NP_442975.1_10 Reverse -100 -114 12.192 0.0477
NP_440784.1_7 Forward -170 -163 6.23397 0.241
NP_440784.1_7 Reverse -105 -112 6.23397 0.241
NP_440784.1_7 Reverse -163 -170 6.13563 0.241
NP_440784.1_7 Forward -112 -105 6.13563 0.241
NP_442909.1_7 Reverse -163 -177 6.88214 0.237
NP_441934.1_10 Forward -327 -313 17.7975 0.245
NP_440061.1_9 Reverse -213 -227 11.9953 0.103
NP_440061.1_9 Forward -80 -66 6.29216 0.251
NP_441476.1_5 Forward -83 -64 1.47442 0.189
NP_442062.1_8 Forward -171 -161 7.94484 0.0848
NP_442062.1_8 Reverse -162 -172 7.15819 0.107
NP_442062.1_8 Reverse -69 -79 4.60159 0.206
NP_441802.1_1 Reverse -277 -296 11.0125 0.197
NP_440304.1_4 Forward -101 -91 4.3066 0.271
NP_440304.1_4 Reverse -79 -89 2.24165 0.299
NP_442242.1_4 Forward -112 -105 12.4288 0.0393
NP_441200.1_4 Reverse -275 -294 5.40766 0.294
NP_442110.1_7 Forward -113 -99 1.17956 0.236
NP_442110.1_7 Reverse -266 -280 -0.197071 0.276
NP_442726.1_4 Forward -344 -325 6.09597 0.269
NP_441925.1_4 Reverse -363 -382 -5.40949 0.177
NP_441925.1_4 Reverse -91 -110 -15.8325 0.274
NP_440856.1_7 Forward -119 -100 2.85105 0.157
NP_440856.1_7 Forward -358 -339 -4.72043 0.224
NP_441083.1_5 Reverse -104 -114 9.81313 0.0224
NP_441083.1_5 Forward -171 -161 6.96153 0.0717
NP_441083.1_5 Reverse -162 -172 0.865012 0.218
NP_441083.1_5 Reverse -215 -225 -0.511621 0.269
NP_441434.1_7 Forward -76 -62 5.01447 0.225
NP_441434.1_7 Reverse -164 -178 4.03116 0.225
NP_441738.1_2 Reverse -164 -171 15.28 0.0102
NP_441738.1_2 Reverse -106 -113 15.28 0.0102
NP_441738.1_2 Forward -286 -279 8.29857 0.176
NP_441558.1_5 Forward -115 -96 6.4893 0.214
NP_440209.1_1 Forward -113 -105 14.8674 0.012
NP_440209.1_1 Forward -171 -163 8.57422 0.0425
NP_440209.1_1 Reverse -104 -112 5.62429 0.0821
NP_440447.1_5 Reverse -74 -84 11.6814 0.291
NP_442675.1_4 Forward -268 -250 -4.50408 0.257
NP_442570.1_3 Forward -22 -3 -6.68705 0.259
NP_441716.1_1 Forward -119 -105 4.03116 0.259
NP_441716.1_1 Reverse -104 -118 2.85119 0.289
NP_442111.1_4 Reverse -161 -175 3.24451 0.253
NP_440343.1_9 Forward -383 -364 9.83255 0.248
NP_440906.1_5 Forward -112 -105 12.0355 0.0724
NP_440906.1_5 Reverse -105 -112 12.0355 0.0724
NP_440906.1_5 Forward -170 -163 6.23397 0.234
NP_440906.1_5 Reverse -163 -170 6.13563 0.241
NP_440906.1_5 Reverse -48 -55 5.64398 0.292
NP_440747.1_10 Forward -116 -104 -2.32097 0.0331
NP_440747.1_10 Reverse -101 -113 -11.8591 0.161
NP_440747.1_10 Forward -81 -69 -12.1541 0.227
NP_440747.1_10 Forward -227 -215 -12.5474 0.297
NP_441486.1_1 Forward -174 -160 14.3559 0.00654
NP_441486.1_1 Reverse -159 -173 2.5562 0.0812
NP_440403.1_4 Forward -180 -161 -9.24366 0.273
NP_441014.1_8 Forward -126 -107 -0.688862 0.218
NP_442848.1_5 Forward -79 -61 3.75572 0.276
NP_442848.1_5 Reverse -364 -382 1.98577 0.276
NP_443018.1_3 Reverse -163 -170 11.7405 0.0655
NP_443018.1_3 Reverse -111 -118 10.2655 0.107
NP_443018.1_3 Reverse -216 -223 9.38056 0.128
NP_443018.1_3 Forward -170 -163 5.44732 0.193
NP_443018.1_3 Forward -112 -105 5.34899 0.212
NP_443018.1_3 Reverse -105 -112 5.34899 0.212
NP_440376.1_1 Forward -171 -162 5.89959 0.116
NP_440376.1_1 Forward -78 -69 3.93297 0.188
NP_440376.1_1 Forward -224 -215 2.65466 0.216
NP_440376.1_1 Forward -113 -104 -0.000272808 0.285
NP_440376.1_1 Reverse -162 -171 -0.0986038 0.285
NP_440376.1_1 Reverse -104 -113 -0.0986038 0.285
NP_441588.1_4 Reverse -164 -174 7.25653 0.178
NP_442687.1_7 Forward -172 -162 12.5664 0.0712
NP_441013.1_2 Reverse -99 -117 -4.40575 0.298
NP_440533.1_9 Reverse -104 -123 16.1257 0.0669
NP_442658.1_1 Reverse -102 -112 10.4026 0.119
NP_442658.1_1 Forward -173 -163 6.17443 0.235
NP_442658.1_1 Forward -80 -70 4.89613 0.292
NP_442782.1_2 Forward -113 -99 12.9793 0.173
NP_442782.1_2 Forward -20 -6 1.86788 0.281
NP_441414.1_9 Reverse -104 -123 -9.73531 0.266
NP_441256.1_1 Reverse -101 -120 11.2092 0.0881
NP_442321.1_4 Reverse -71 -90 -6.68705 0.284
NP_441958.1_5 Forward -172 -162 8.73149 0.0255
NP_441958.1_5 Reverse -161 -171 0.963343 0.12
NP_441958.1_5 Forward -114 -104 -6.41148 0.28
NP_440203.1_5 Reverse -107 -117 15.7125 0.0611
NP_439905.1_1 Reverse -216 -229 13.4906 0.165
NP_440995.1_8 Reverse -152 -171 2.94938 0.264
NP_439990.1_5 Forward -118 -105 18.7022 0.0112
NP_440153.1_5 Reverse -163 -177 0.491246 0.299
NP_443055.1_6 Reverse -61 -79 0.313405 0.246
NP_440615.1_2 Reverse -169 -188 21.5339 0.0104
NP_441099.1_5 Reverse -336 -355 -7.57203 0.177
NP_442002.1_9 Forward -172 -165 10.7572 0.185
NP_442002.1_9 Reverse -278 -285 9.47889 0.282
NP_441646.1_1 Forward -273 -254 -1.08219 0.278
NP_442438.1_10 Reverse -99 -113 1.08123 0.206
NP_442438.1_10 Forward -118 -104 -0.885388 0.283
NP_442431.1_10 Forward -382 -364 2.96908 0.226
NP_442431.1_10 Forward -113 -95 2.77242 0.23
NP_442431.1_10 Forward -388 -370 2.28076 0.241
NP_442431.1_10 Forward -352 -334 0.707465 0.267
NP_441752.1_6 Reverse -363 -382 14.8474 0.0767
NP_441000.1_5 Forward -97 -78 3.53858 0.286
NP_441000.1_6 Reverse -161 -175 4.22782 0.0964
NP_442771.1_1 Forward -115 -97 -0.865831 0.12
NP_442771.1_1 Reverse -102 -120 -9.12563 0.216
NP_442771.1_1 Reverse -255 -273 -9.71562 0.231
NP_440147.1_4 Forward -173 -160 9.16406 0.0428
NP_440147.1_4 Forward -58 -45 0.215946 0.261
NP_440147.1_4 Reverse -160 -173 0.117615 0.265
NP_441550.1_8 Reverse -160 -170 11.8776 0.0415
NP_441550.1_8 Forward -173 -163 7.0594 0.178
NP_441916.1_7 Reverse -162 -172 9.51814 0.0338
NP_441916.1_7 Forward -171 -161 5.09324 0.146
NP_441041.1_4 Reverse -104 -123 -1.08219 0.1
NP_441041.1_7 Reverse -159 -171 10.7216 0.0888
NP_441041.1_7 Reverse -66 -78 9.06962 0.124
NP_441725.1_5 Reverse -105 -115 1.55333 0.133
NP_441725.1_5 Forward -112 -102 -0.511621 0.26
NP_439966.1_7 Reverse -102 -112 10.206 0.0958
NP_439966.1_7 Forward -115 -105 5.97777 0.199
NP_439966.1_9 Forward -173 -164 0.884706 0.253
NP_440736.1_4 Reverse -197 -216 8.25844 0.295
NP_442941.1_3 Reverse -105 -115 10.2065 0.0213
NP_440289.1_2 Reverse -101 -114 1.69091 0.118
NP_440260.1_8 Reverse -65 -83 -6.76569 0.295
NP_439908.1_5 Forward -189 -170 9.0459 0.298
NP_442281.1_1 Reverse -157 -171 12.192 0.0396
NP_442281.1_1 Forward -83 -69 2.5556 0.263
NP_442281.1_1 Reverse -210 -224 2.35894 0.269
NP_442281.1_1 Reverse -99 -113 2.06395 0.278
NP_440437.1_1 Reverse -98 -117 1.27776 0.153
NP_440437.1_1 Forward -272 -253 -3.83545 0.246
NP_440437.1_1 Forward -85 -66 -4.91709 0.271
NP_440498.1_1 Reverse -95 -113 -0.177514 0.218
NP_441644.1_6 Reverse -215 -225 13.6475 0.0181
NP_441644.1_6 Reverse -162 -172 7.45273 0.124
NP_441644.1_6 Reverse -104 -114 5.87944 0.174
NP_441644.1_6 Forward -224 -214 4.30615 0.242
NP_440867.1_10 Forward -128 -109 28.1221 0.00142
NP_442215.1_2 Forward -92 -76 1.04184 0.142
NP_442215.1_2 Forward -48 -32 -6.03799 0.263
NP_442029.1_1 Forward -378 -359 -19.1751 0.281
NP_440929.1_8 Reverse -162 -171 7.17789 0.0713
NP_441346.1_7 Forward -199 -180 14.1591 0.183
NP_442933.1_10 Reverse -162 -171 8.06287 0.0885
NP_442933.1_10 Forward -171 -162 7.96454 0.0937
NP_442933.1_10 Forward -113 -104 5.40793 0.19
NP_441310.1_10 Reverse -181 -191 14.9155 0.233
NP_441751.2_8 Reverse -105 -119 -3.04867 0.134
NP_442554.1_8 Forward -223 -213 11.3864 0.0365
NP_442554.1_8 Reverse -105 -115 6.17489 0.125
NP_442554.1_8 Reverse -216 -226 4.20827 0.193
NP_442554.1_8 Reverse -163 -173 3.42162 0.226
NP_442554.1_8 Forward -170 -160 2.24165 0.276
NP_441762.1_7 Reverse -161 -173 10.6587 0.0142
NP_441762.1_7 Forward -114 -102 -4.87757 0.183
NP_442142.1_4 Reverse -101 -114 20.0782 0.0179
NP_442142.1_4 Forward -116 -103 5.0336 0.204
NP_442142.1_4 Forward -260 -247 4.54195 0.217
NP_442142.1_4 Reverse -212 -225 4.14862 0.231
NP_442142.1_4 Forward -122 -109 2.57534 0.286
NP_442292.1_1 Reverse -105 -114 8.75118 0.0306
NP_442292.1_1 Reverse -163 -172 -0.196935 0.239
NP_443009.1_5 Reverse -68 -79 13.2345 0.036
NP_443009.1_5 Reverse -161 -172 6.94134 0.144
NP_442301.1_2 Reverse -366 -385 3.83357 0.288
NP_441715.1_4 Reverse -105 -115 5.09324 0.233
NP_441198.1_8 Reverse -67 -77 11.3181 0.211
NP_441468.1_1 Forward -170 -163 6.13563 0.209
NP_441468.1_1 Reverse -105 -112 6.13563 0.209
NP_441468.1_1 Reverse -163 -170 6.0373 0.223
NP_441468.1_1 Forward -112 -105 6.0373 0.223
NP_441020.2_6 Forward -115 -98 6.03703 0.28
NP_441015.1_10 Forward -118 -99 -3.24547 0.186
NP_441673.1_1 Forward -171 -162 1.27803 0.155
NP_441673.1_1 Reverse -162 -171 1.27803 0.155
NP_441673.1_1 Forward -113 -104 1.27803 0.155
NP_441673.1_1 Reverse -104 -113 1.27803 0.155
NP_441016.2_6 Reverse -331 -350 7.37347 0.25
NP_442757.1_7 Reverse -247 -266 15.4374 0.154
NP_441826.1_2 Reverse -98 -112 2.2612 0.132
NP_441826.1_2 Reverse -209 -223 -0.787057 0.224
NP_441826.1_2 Reverse -63 -77 -1.47537 0.248
NP_441826.1_2 Forward -170 -156 -1.67204 0.252
NP_441826.1_2 Forward -119 -105 -3.93365 0.29
NP_442868.1_6 Forward -115 -105 0.0783647 0.248
NP_441056.1_1 Reverse -104 -123 -7.57203 0.274
NP_442227.1_2 Reverse -97 -116 -2.36049 0.272
NP_442361.1_3 Forward -119 -106 10.1474 0.272
NP_442808.1_1 Reverse -103 -113 17.5808 0.00507
NP_442808.1_1 Reverse -363 -373 3.51951 0.238
NP_442775.1_6 Forward -118 -99 15.8307 0.236
NP_442820.1_5 Reverse -280 -299 8.35759 0.228
NP_442050.1_5 Forward -115 -105 6.66608 0.286
NP_442342.1_9 Forward -278 -262 1.92682 0.296
NP_440558.1_2 Forward -81 -62 -1.37718 0.214
NP_440274.1_4 Forward -122 -104 11.3272 0.157
NP_441878.1_6 Reverse -68 -78 1.16001 0.11
NP_441878.1_6 Forward -225 -215 0.668351 0.139
NP_441878.1_6 Reverse -161 -171 0.668351 0.139
NP_441878.1_6 Reverse -214 -224 0.57002 0.14
NP_441878.1_6 Forward -79 -69 -7.49312 0.231
NP_441036.1_8 Reverse -103 -113 13.8447 0.0353
NP_441036.1_8 Forward -172 -162 12.5664 0.0744
NP_442650.1_2 Reverse -104 -118 2.35953 0.277
NP_441557.1_5 Forward -171 -162 8.94785 0.0289
NP_441557.1_5 Forward -113 -104 0.983037 0.0911
NP_441557.1_5 Reverse -162 -171 0.688044 0.128
NP_441557.1_5 Reverse -104 -113 0.688044 0.128
NP_441445.1_1 Forward -310 -291 3.14605 0.218
NP_441590.1_4 Reverse -294 -313 7.76679 0.249
NP_442267.1_4 Forward -350 -331 0.392778 0.285
NP_440101.1_5 Reverse -97 -116 0.884433 0.272
NP_442397.1_9 Reverse -208 -227 7.57094 0.246
NP_441459.1_3 Reverse -364 -383 15.8856 0.168
NP_442347.1_2 Reverse -163 -172 8.94785 0.0718
NP_442347.1_2 Reverse -105 -114 3.93297 0.284
NP_442645.1_2 Reverse -61 -80 -14.9469 0.185
NP_442888.1_6 Reverse -204 -223 1.27776 0.295
NP_442594.1_8 Forward -358 -339 8.65258 0.202
NP_440690.1_5 Forward -386 -367 23.0089 0.0114
NP_441633.1_3 Forward -80 -67 4.8375 0.0671
NP_441633.1_3 Forward -268 -255 2.96921 0.0793
NP_441633.1_3 Reverse -352 -365 -3.32397 0.177
NP_441633.1_3 Reverse -88 -101 -4.79893 0.212
NP_441633.1_3 Forward -92 -79 -5.29059 0.234
NP_441633.1_3 Forward -173 -160 -6.66722 0.265
NP_440136.1_2 Forward -170 -163 6.23397 0.171
NP_440136.1_2 Reverse -105 -112 6.23397 0.171
NP_440136.1_2 Reverse -163 -170 6.13563 0.193
NP_440136.1_2 Forward -112 -105 6.13563 0.193
NP_442998.1_5 Reverse -291 -301 9.22315 0.248
NP_442998.1_10 Reverse -164 -171 15.5754 0.0102
NP_442998.1_10 Reverse -106 -113 15.5754 0.0102
NP_440299.1_1 Forward -117 -104 9.95012 0.0631
NP_440299.1_1 Reverse -100 -113 8.08184 0.098
NP_441799.1_1 Reverse -158 -172 12.3887 0.0441
NP_441799.1_1 Reverse -1 -15 4.32555 0.255
NP_441007.1_5 Forward -118 -99 7.86593 0.3
NP_442201.1_10 Reverse -268 -287 -6.88371 0.184
NP_440256.1_1 Reverse -159 -178 -5.11376 0.174
NP_440256.1_1 Forward -116 -97 -9.047 0.273
NP_442007.1_8 Reverse -366 -384 10.8348 0.258
NP_441559.1_8 Forward -83 -69 10.816 0.0574
NP_441270.1_5 Forward -386 -367 13.0919 0.236
NP_440915.1_6 Forward -82 -68 7.07942 0.0757
NP_440915.1_6 Forward -280 -266 -3.04867 0.29
NP_441179.1_9 Reverse -338 -348 16.3025 0.236
NP_441866.1_4 Forward -210 -197 12.7586 0.28
NP_441464.1_8 Forward -171 -157 5.01447 0.26
NP_440702.1_2 Forward -115 -96 0.786102 0.257
NP_440702.1_2 Reverse -249 -268 -5.21209 0.257
NP_440702.1_2 Forward -354 -335 -6.1954 0.257
NP_440702.1_2 Reverse -252 -271 -7.4737 0.276
NP_441939.1_3 Forward -112 -93 7.86593 0.188
NP_441199.1_6 Reverse -100 -119 4.32602 0.17
NP_441494.1_6 Reverse -76 -89 7.00078 0.269
NP_442993.1_1 Forward -171 -155 1.33684 0.0555
NP_442386.1_9 Forward -79 -70 8.35743 0.201
NP_442386.1_9 Reverse -103 -112 8.06244 0.209
NP_442386.1_9 Reverse -214 -223 6.48915 0.219
NP_442386.1_9 Forward -172 -163 5.9975 0.23
NP_441340.1_5 Forward -170 -163 13.5105 0.0314
NP_441340.1_5 Forward -112 -105 6.13563 0.175
NP_441340.1_5 Reverse -105 -112 5.93897 0.198
NP_441340.1_5 Reverse -163 -170 5.84064 0.208
NP_440168.1_4 Forward -123 -104 -7.37537 0.283
NP_440251.1_4 Forward -308 -291 19.9017 0.0897
NP_440586.1_8 Forward -112 -105 11.4451 0.0645
NP_440586.1_8 Reverse -163 -170 9.47853 0.146
NP_440586.1_8 Reverse -111 -118 9.08521 0.178
NP_440586.1_8 Forward -170 -163 5.74197 0.283
NP_440586.1_8 Reverse -6 -13 5.64364 0.297
NP_442251.1_6 Reverse -105 -112 12.0355 0.0627
NP_440192.1_5 Forward -383 -364 2.75272 0.299
NP_440684.1_9 Reverse -251 -265 8.65272 0.225
NP_441262.1_3 Forward -171 -164 14.7888 0.0223
NP_441262.1_3 Forward -113 -106 14.7888 0.0223
NP_443051.1_1 Forward -172 -163 7.47288 0.0571
NP_443051.1_1 Forward -114 -105 0.786375 0.125
NP_443051.1_1 Reverse -161 -170 -1.08191 0.281
NP_440398.1_2 Reverse -245 -264 5.211 0.231
NP_440408.1_3 Reverse -98 -117 0.58944 0.204
NP_440439.1_1 Forward -174 -161 11.229 0.0339
NP_440439.1_1 Forward -81 -68 0.904263 0.168
NP_440372.1_2 Forward -170 -163 13.8055 0.0214
NP_440372.1_2 Forward -112 -105 6.72562 0.0929
NP_440372.1_2 Reverse -105 -112 6.62729 0.151
NP_440372.1_2 Reverse -163 -170 6.52896 0.188
NP_441789.1_7 Reverse -363 -382 6.58682 0.193
NP_440139.1_1 Reverse -98 -117 1.86696 0.245
NP_441572.1_7 Reverse -98 -117 -6.29373 0.288
NP_442384.1_10 Reverse -215 -228 5.52582 0.127
NP_442384.1_10 Reverse -104 -117 5.03416 0.139
NP_442384.1_10 Reverse -162 -175 4.73917 0.148
NP_441018.1_7 Forward -228 -209 14.8474 0.118
NP_441018.1_7 Forward -344 -325 10.1275 0.217
NP_442262.1_10 Reverse -163 -170 13.2155 0.0213
NP_442262.1_10 Reverse -216 -223 9.47889 0.187
NP_442262.1_10 Reverse -111 -118 9.18389 0.211
NP_442262.1_10 Reverse -143 -150 7.21728 0.281
NP_441689.1_5 Forward -115 -105 5.68278 0.215
NP_440163.1_10 Forward -116 -106 12.4681 0.159
NP_440344.1_10 Reverse -97 -114 -6.64766 0.114
NP_440282.1_10 Reverse -100 -119 -8.26035 0.26
NP_440531.1_6 Forward -309 -290 -3.44213 0.266
NP_440487.1_1 Reverse -101 -120 9.73422 0.102
NP_440487.1_1 Forward -116 -97 -4.22878 0.214
NP_440562.1_10 Reverse -345 -363 6.214 0.284
NP_441640.1_8 Reverse -105 -124 3.14605 0.142
NP_441640.1_8 Forward -118 -99 -3.3438 0.255
NP_442750.1_3 Forward -313 -294 -12.1936 0.274
NP_440297.1_9 Forward -223 -213 -0.41329 0.283
NP_440297.1_9 Reverse -105 -115 -0.41329 0.283
NP_440350.1_5 Forward -213 -194 -3.63879 0.261
NP_442187.1_3 Forward -114 -104 16.893 0.0619
NP_442280.1_10 Forward -72 -54 6.91543 0.268
NP_440894.1_10 Reverse -99 -118 4.62101 0.249
NP_442078.1_9 Reverse -292 -309 14.1002 0.21
NP_442067.1_4 Reverse -93 -112 2.85105 0.289
NP_440999.1_9 Reverse -100 -114 3.44117 0.13
NP_440999.1_9 Forward -82 -68 -1.37704 0.236
NP_440888.1_2 Reverse -69 -83 10.717 0.0861
NP_440888.1_2 Reverse -104 -118 5.40719 0.28
NP_440491.1_1 Forward -116 -97 6.7221 0.289
NP_440052.1_8 Reverse -246 -265 18.0924 0.0498
NP_442033.1_10 Reverse -102 -121 -5.50708 0.179
NP_441917.1_2 Forward -352 -334 5.62401 0.288
NP_441543.1_2 Reverse -163 -172 8.65285 0.0968
NP_441543.1_2 Reverse -105 -114 7.17789 0.131
NP_442845.1_2 Forward -230 -216 5.01447 0.247
NP_441304.1_10 Reverse -66 -75 14.356 0.175
NP_441918.1_7 Forward -225 -206 -1.27885 0.297
NP_441469.1_4 Forward -379 -360 7.07928 0.282
NP_441469.1_8 Forward -172 -163 6.39124 0.227
NP_441469.1_8 Reverse -103 -112 5.70292 0.257
NP_442315.1_1 Forward -384 -366 6.11567 0.256
NP_443064.1_6 Forward -171 -161 9.07643 0.247
NP_443064.1_6 Reverse -104 -114 8.39772 0.292
NP_442578.1_7 Forward -170 -163 6.0373 0.18
NP_442578.1_7 Forward -112 -105 5.93897 0.183
NP_441462.1_2 Forward -171 -161 17.3846 0.00406
NP_441462.1_2 Forward -113 -103 -0.118297 0.184
NP_441462.1_5 Forward -368 -349 3.34271 0.285
NP_441621.1_7 Reverse -67 -81 -6.49025 0.295
NP_441601.1_2 Reverse -156 -175 0.786102 0.219
NP_441601.1_4 Reverse -97 -116 -2.85214 0.293
NP_440519.1_8 Reverse -66 -82 3.59845 0.244
NP_442204.1_1 Forward -117 -106 9.69511 0.0736
NP_442872.1_1 Reverse -362 -381 -10.1286 0.241
NP_440516.1_2 Reverse -156 -174 0.314141 0.233
NP_440516.1_8 Forward -113 -104 17.6993 0.00442
NP_440516.1_8 Forward -171 -162 9.4395 0.0183
NP_440516.1_8 Reverse -162 -171 5.11294 0.118
NP_442428.1_4 Reverse -103 -122 6.19431 0.2
NP_442428.1_5 Forward -170 -163 6.13563 0.209
NP_442428.1_5 Reverse -105 -112 6.13563 0.209
NP_442428.1_5 Reverse -163 -170 6.0373 0.212
NP_442428.1_5 Forward -112 -105 6.0373 0.212
NP_441443.1_7 Forward -122 -103 7.96426 0.13
NP_440673.1_3 Reverse -164 -171 12.4288 0.0426
NP_440673.1_3 Reverse -106 -113 12.4288 0.0426
NP_441052.1_2 Reverse -104 -114 10.7964 0.0285
NP_441052.1_2 Forward -224 -214 4.20827 0.163
NP_441052.1_2 Reverse -215 -225 3.91327 0.17
NP_442219.1_8 Reverse -250 -269 7.00751 0.28
NP_442219.1_9 Reverse -105 -114 8.06287 0.0696
NP_440436.1_4 Reverse -105 -114 13.9623 0.0193
NP_440436.1_4 Reverse -70 -79 9.04574 0.092
NP_440436.1_4 Reverse -163 -172 8.55409 0.0997
NP_440436.1_4 Forward -112 -103 5.80084 0.182
NP_440436.1_4 Forward -170 -161 5.11253 0.222
NP_441884.1_9 Forward -122 -103 -24.6816 0.288
NP_440577.1_1 Forward -366 -347 34.317 0.0000061
NP_440577.1_2 Forward -330 -311 29.7937 0.000145
NP_440577.1_5 Forward -309 -290 28.1221 0.00032
NP_440577.1_6 Forward -390 -371 27.0405 0.0011
NP_441719.1_4 Forward -170 -163 6.82395 0.0855
NP_441719.1_4 Forward -112 -105 6.72562 0.093
NP_441719.1_4 Reverse -105 -112 6.62729 0.151
NP_441719.1_4 Reverse -163 -170 6.52896 0.188
NP_441004.1_5 Forward -284 -270 8.35772 0.274
NP_442366.1_3 Forward -172 -154 11.0322 0.04
NP_442366.1_3 Forward -114 -96 -4.20908 0.266
NP_442366.1_5 Forward -174 -164 15.2208 0.0375
NP_440296.1_10 Forward -366 -347 -6.98204 0.229
NP_443054.1_2 Forward -80 -66 16.2242 0.0579
NP_441851.1_10 Forward -172 -162 7.55152 0.137
NP_441851.1_10 Reverse -68 -78 4.10993 0.287
NP_442856.1_7 Forward -275 -256 -5.60541 0.283
NP_441396.1_5 Forward -345 -336 8.65285 0.21
NP_440593.1_9 Forward -75 -61 7.86607 0.267
NP_441982.1_6 Reverse -182 -191 11.053 0.288
NP_440940.1_1 Forward -382 -363 11.4058 0.155
NP_441409.1_6 Reverse -98 -117 -6.29373 0.124
NP_441409.1_8 Reverse -191 -210 16.2715 0.209
NP_441394.1_10 Reverse -355 -373 18.8979 0.115
NP_441107.1_10 Reverse -109 -123 19.1741 0.231
NP_442168.1_5 Forward -77 -58 -2.36049 0.264
NP_440588.1_2 Forward -122 -103 -4.42544 0.216
NP_441031.1_6 Forward -126 -107 0.0977854 0.296
NP_442006.1_2 Reverse -110 -127 -16.8741 0.265
NP_441570.1_1 Forward -355 -337 -2.53746 0.0659
NP_441078.1_4 Reverse -162 -171 0.0980582 0.205
NP_441078.1_4 Reverse -104 -113 0.0980582 0.205
NP_441078.1_4 Forward -171 -162 0.0980582 0.205
NP_441078.1_4 Forward -113 -104 0.0980582 0.205
NP_441078.1_4 Reverse -69 -78 -1.57357 0.266
NP_441078.1_4 Forward -78 -69 -1.57357 0.266
NP_441078.1_4 Forward -224 -215 -1.6719 0.266
NP_441078.1_4 Reverse -215 -224 -1.77023 0.266
NP_442729.1_5 Forward -114 -104 8.1415 0.248
NP_442388.1_3 Forward -361 -342 5.60432 0.282
NP_441663.1_8 Reverse -98 -117 3.6377 0.179
NP_442348.1_2 Forward -218 -209 6.8829 0.298
NP_440707.1_7 Reverse -250 -269 4.12936 0.284
NP_442443.1_1 Forward -381 -362 13.8641 0.0815
NP_442443.1_1 Forward -85 -66 6.29264 0.155
NP_442443.1_1 Forward -326 -307 -6.49039 0.294
NP_440793.1_1 Forward -198 -184 11.4053 0.279
NP_440526.1_3 Reverse -355 -366 5.36805 0.249
NP_440526.1_3 Reverse -105 -116 5.07306 0.258
NP_441432.1_8 Forward -114 -105 7.17789 0.102
NP_441432.1_8 Forward -172 -163 5.50626 0.151
NP_441432.1_8 Forward -225 -216 3.44131 0.245
NP_441732.1_2 Reverse -121 -137 -16.0677 0.164
NP_441732.1_2 Reverse -100 -116 -17.641 0.281
NP_440759.1_6 Reverse -36 -55 4.03102 0.237
NP_440760.1_1 Reverse -215 -234 -22.42 0.257
NP_442797.1_7 Reverse -97 -115 0.0191479 0.279
NP_440199.1_10 Forward -116 -106 7.64985 0.231
NP_440578.1_1 Forward -34 -15 29.8921 0.000612
NP_440578.1_2 Forward -210 -192 20.5703 0.0506
NP_440578.1_3 Forward -136 -117 29.6954 0.000577
NP_440578.1_4 Forward -330 -311 29.2038 0.000188
NP_440578.1_5 Forward -306 -287 26.9421 0.00201
NP_440578.1_7 Forward -82 -63 29.1045 0.000281
NP_440578.1_8 Forward -355 -336 28.5154 0.000201
NP_440578.1_10 Forward -55 -36 13.2741 0.246
NP_441057.1_4 Forward -114 -96 -4.01242 0.299
NP_440913.1_1 Forward -80 -62 9.16393 0.179
NP_443011.1_4 Forward -311 -292 24.4839 0.00646
NP_442751.1_2 Reverse -103 -122 4.52188 0.261
NP_442489.1_7 Reverse -162 -171 0.786375 0.152
NP_442489.1_7 Reverse -104 -113 0.786375 0.152
NP_442489.1_7 Forward -171 -162 0.589713 0.17
NP_442489.1_7 Forward -113 -104 0.589713 0.17
NP_442489.1_7 Reverse -215 -224 -1.57357 0.213
NP_442489.1_7 Forward -78 -69 -1.57357 0.213
NP_442489.1_7 Forward -224 -215 -1.6719 0.235
NP_442489.1_7 Reverse -69 -78 -2.06522 0.288
NP_442079.1_7 Reverse -105 -124 4.42435 0.192
NP_440559.1_1 Forward -170 -161 14.651 0.0144
NP_440559.1_1 Reverse -105 -114 14.1594 0.0317
NP_441659.2_8 Reverse -162 -172 6.56821 0.0714
NP_441659.2_8 Reverse -215 -225 3.22496 0.169
NP_441659.2_8 Forward -171 -161 0.176696 0.271
NP_441040.1_2 Forward -115 -96 -15.7335 0.286
NP_440442.1_3 Reverse -103 -117 15.6342 0.271
NP_441800.1_7 Reverse -368 -386 0.707465 0.21
NP_442346.1_5 Forward -114 -104 6.8632 0.188
NP_442346.1_5 Reverse -256 -266 6.27322 0.208
NP_442346.1_5 Reverse -161 -171 5.97822 0.219
NP_442346.1_5 Forward -225 -215 5.5849 0.238
NP_442346.1_5 Forward -57 -47 5.5849 0.238
NP_442346.1_5 Reverse -214 -224 4.89658 0.269
NP_442346.1_10 Forward -80 -61 1.47442 0.217
NP_440545.1_3 Reverse -65 -82 -4.97604 0.237
NP_440545.1_3 Forward -117 -100 -6.15601 0.27
NP_441629.1_3 Forward -270 -251 -1.67294 0.267
NP_441923.1_6 Reverse -111 -125 9.83269 0.278
NP_440010.1_4 Reverse -100 -119 0.883656 0.243
NP_440010.1_10 Forward -125 -106 6.78429 0.226
NP_440847.1_3 Reverse -355 -369 12.2903 0.252
NP_442603.1_7 Reverse -104 -118 9.04542 0.158
NP_442603.1_9 Forward -85 -67 9.0656 0.214
NP_441888.1_7 Forward -83 -69 6.6861 0.225
NP_441833.1_4 Reverse -105 -112 14.1004 0.0258
NP_441833.1_4 Reverse -163 -170 6.52896 0.0924
NP_441833.1_4 Forward -170 -163 6.23397 0.163
NP_441833.1_4 Forward -112 -105 6.13563 0.198
NP_440751.1_3 Reverse -112 -131 5.70185 0.29
NP_441895.1_1 Forward -330 -311 -7.86702 0.276
NP_442060.1_9 Forward -390 -371 11.4058 0.134
NP_442162.1_8 Reverse -98 -117 -3.93378 0.291
NP_442162.1_9 Forward -170 -163 12.9205 0.0282
NP_442162.1_9 Reverse -163 -170 12.9205 0.0282
NP_442162.1_9 Reverse -105 -112 6.62729 0.142
NP_442162.1_9 Forward -112 -105 6.52896 0.178
NP_442404.1_9 Forward -263 -249 10.3237 0.263
NP_442140.1_3 Reverse -163 -173 14.1397 0.0501
NP_442140.1_3 Forward -112 -102 8.63316 0.119
NP_442140.1_3 Forward -170 -160 4.0116 0.265
NP_442140.1_3 Reverse -216 -226 3.42162 0.297
NP_441813.1_5 Reverse -102 -112 7.64985 0.068
NP_441813.1_5 Forward -115 -105 6.07655 0.104
NP_441813.1_5 Reverse -160 -170 4.89658 0.143
NP_441813.1_5 Forward -173 -163 0.176696 0.215
NP_441813.1_7 Reverse -292 -306 10.5204 0.23
NP_441813.1_7 Reverse -370 -384 8.06211 0.297
NP_440590.1_4 Reverse -105 -118 3.26421 0.0749
NP_440567.1_1 Forward -112 -98 5.80112 0.0959
NP_442497.1_10 Forward -170 -161 8.25953 0.047
NP_442497.1_10 Reverse -105 -114 0.688044 0.141
NP_442497.1_10 Reverse -163 -172 0.589713 0.153
NP_440821.1_4 Forward -115 -105 8.4365 0.0503
NP_440821.1_4 Reverse -102 -112 6.96153 0.0781
NP_440821.1_4 Forward -173 -163 0.471689 0.174
NP_441239.1_9 Forward -80 -68 11.5437 0.0589
NP_441239.1_9 Reverse -160 -172 10.4621 0.0783
NP_441239.1_9 Reverse -102 -114 3.77555 0.276
NP_441239.1_9 Reverse -352 -364 3.57889 0.283
NP_441239.1_9 Reverse -213 -225 3.18557 0.292
NP_442568.1_8 Reverse -196 -210 9.83269 0.257
NP_441892.1_1 Reverse -101 -118 -6.05768 0.296
NP_440665.1_1 Forward -355 -336 -8.752 0.244
NP_442044.1_1 Forward -271 -252 -7.57203 0.224
NP_441874.1_1 Reverse -174 -188 19.2725 0.149
NP_440546.1_4 Forward -171 -161 15.4756 0.0459
NP_440546.1_4 Forward -113 -103 11.0156 0.0991
NP_440546.1_4 Reverse -162 -172 10.046 0.109
NP_440546.1_4 Forward -224 -214 8.78555 0.171
NP_440675.1_1 Forward -358 -339 9.0459 0.195
NP_440462.1_4 Forward -356 -342 8.06273 0.268
NP_440462.1_6 Reverse -102 -112 4.89658 0.18
NP_442465.1_8 Reverse -359 -378 16.0265 0.156
NP_441184.1_3 Reverse -61 -80 1.96607 0.296
NP_440868.1_4 Forward -175 -163 15.4769 0.0164
NP_440868.1_4 Reverse -100 -112 0.727295 0.201
NP_440401.1_9 Reverse -334 -341 12.6251 0.287
NP_441269.1_6 Forward -389 -371 15.5554 0.136
NP_441474.1_1 Reverse -94 -113 3.24359 0.242
NP_440653.1_10 Forward -229 -210 1.86774 0.293
NP_439942.1_7 Reverse -67 -86 2.45773 0.19
NP_442039.1_4 Forward -170 -163 11.6422 0.0747
NP_440008.1_9 Forward -224 -205 22.5172 0.0341
NP_440825.1_6 Forward -365 -346 8.45592 0.285
NP_442837.1_3 Reverse -105 -112 6.13563 0.25
NP_442837.1_3 Forward -170 -163 6.0373 0.25
NP_442837.1_3 Reverse -163 -170 6.0373 0.25
NP_442837.1_3 Forward -112 -105 5.93897 0.265
NP_442053.1_1 Forward -113 -104 7.76787 0.0895
NP_442053.1_1 Reverse -162 -171 7.17789 0.104
NP_442053.1_1 Reverse -104 -113 7.17789 0.104
NP_440505.1_3 Forward -115 -105 15.0247 0.0149
NP_440505.1_3 Forward -173 -163 5.19158 0.241
NP_440505.1_3 Forward -80 -70 4.40493 0.292
NP_441203.1_1 Forward -143 -124 -13.6686 0.17
NP_440914.1_1 Reverse -104 -114 13.4947 0.0297
NP_440914.1_1 Reverse -209 -219 6.85846 0.263
NP_441011.1_8 Forward -170 -161 12.0944 0.0517
NP_441011.1_8 Forward -143 -134 8.35786 0.144
NP_441011.1_8 Reverse -163 -172 7.07956 0.179
NP_441011.1_8 Forward -112 -103 5.60459 0.247
NP_442101.1_10 Forward -121 -102 -9.14533 0.245
NP_442533.1_1 Forward -355 -336 4.62101 0.0798
NP_442533.1_1 Forward -116 -97 -4.22878 0.14
NP_442533.1_1 Reverse -251 -270 -7.17871 0.188
NP_442533.1_1 Reverse -107 -126 -15.8318 0.257
NP_442533.1_6 Reverse -215 -224 13.5694 0.021
NP_442533.1_6 Reverse -69 -78 7.57121 0.0898
NP_442533.1_6 Forward -224 -215 6.78456 0.103
NP_442533.1_6 Forward -171 -162 5.40793 0.14
NP_442533.1_6 Reverse -162 -171 4.52295 0.179
NP_442541.1_3 Reverse -58 -77 4.03102 0.29
NP_442232.1_3 Reverse -61 -80 -6.29373 0.182
NP_442229.1_1 Forward -173 -159 11.602 0.18
NP_441482.1_7 Forward -119 -105 -9.24352 0.196
NP_439944.1_9 Reverse -105 -115 9.32148 0.1
NP_441028.1_6 Forward -191 -181 7.35439 0.229
NP_442202.1_4 Forward -136 -122 14.3866 0.218
NP_440116.1_8 Reverse -105 -124 5.80098 0.0608
NP_441527.1_4 Reverse -194 -213 -2.14899 0.154
NP_441527.1_4 Reverse -196 -215 -11.0297 0.278
NP_441527.1_4 Reverse -187 -206 -11.9847 0.285
NP_441527.1_4 Reverse -179 -198 -12.9396 0.296
NP_441527.1_7 Forward -57 -38 17.1082 0.227
NP_440115.1_6 Forward -116 -106 9.41981 0.115
NP_440115.1_6 Reverse -254 -264 5.28991 0.259
NP_442492.1_2 Forward -171 -152 0.392778 0.241
NP_441961.1_4 Reverse -61 -80 12.3892 0.213
NP_441961.1_4 Forward -382 -363 8.75091 0.259
NP_441170.1_2 Forward -85 -66 15.0441 0.0485
NP_441972.1_5 Forward -89 -70 -2.95047 0.194
NP_441106.1_1 Forward -172 -163 8.45619 0.0548
NP_441106.1_1 Reverse -103 -112 5.70292 0.131
NP_441286.1_1 Forward -114 -102 10.9537 0.0145
NP_442674.1_3 Forward -127 -108 11.0117 0.174
NP_440670.1_8 Forward -363 -354 10.9145 0.0386
NP_440670.1_8 Forward -171 -162 8.65285 0.0627
NP_440670.1_8 Reverse -104 -113 6.8829 0.0907
NP_440670.1_8 Reverse -162 -171 6.29291 0.124
NP_440670.1_8 Forward -355 -346 3.14632 0.296
NP_440886.1_7 Reverse -336 -346 9.41933 0.0805
NP_440886.1_7 Reverse -103 -113 8.53436 0.0805
NP_440886.1_7 Reverse -372 -382 6.17443 0.141
NP_440886.1_7 Reverse -97 -107 3.61784 0.272
NP_442614.1_2 Reverse -184 -198 7.17775 0.275
NP_442614.1_2 Reverse -292 -306 6.19444 0.291
NP_441808.1_8 Forward -382 -363 8.75091 0.259
NP_440907.2_8 Reverse -163 -173 12.4676 0.0624
NP_440907.2_8 Forward -170 -160 3.8145 0.297
NP_441905.1_3 Reverse -373 -391 17.8162 0.193
NP_442264.1_2 Forward -123 -106 6.72535 0.25
NP_442264.1_2 Forward -228 -211 6.52869 0.254
NP_441021.1_8 Forward -176 -158 6.60732 0.202
NP_441463.1_3 Reverse -378 -397 -7.57203 0.259
NP_441463.1_6 Forward -115 -101 9.99138 0.242
NP_441463.1_6 Reverse -207 -221 5.44959 0.287
NP_442842.1_10 Forward -213 -194 8.52284 0.207
NP_442842.1_10 Forward -214 -195 0.756665 0.257
NP_441626.1_2 Forward -170 -163 12.2322 0.0511
NP_441626.1_2 Forward -112 -105 6.0373 0.212
NP_441626.1_2 Reverse -105 -112 6.0373 0.212
NP_441626.1_2 Reverse -163 -170 5.93897 0.231
NP_440107.1_5 Reverse -103 -122 -1.47551 0.178
NP_442794.1_1 Forward -117 -105 9.87208 0.0772
NP_442794.1_1 Reverse -100 -112 9.87208 0.0772
NP_442615.1_1 Reverse -153 -171 -1.55415 0.13
NP_441962.1_4 Reverse -64 -83 -9.047 0.211
NP_441962.1_4 Reverse -76 -95 -13.7669 0.277
NP_440387.1_1 Forward -113 -97 -4.46469 0.187
NP_440387.1_1 Reverse -104 -120 -6.23465 0.273
NP_441431.1_2 Forward -174 -160 14.7486 0.0588
NP_441431.1_2 Reverse -159 -173 11.7003 0.135
NP_441836.1_2 Forward -230 -211 -4.72043 0.262
NP_440634.1_10 Forward -269 -250 14.4533 0.131
NP_441993.1_5 Forward -129 -111 18.5054 0.28
NP_440114.1_10 Forward -171 -157 12.6843 0.0754
NP_440114.1_10 Forward -78 -64 11.996 0.0955
NP_440114.1_10 Reverse -162 -176 9.14437 0.183
NP_440114.1_10 Forward -363 -349 7.57108 0.231
NP_442437.1_8 Reverse -70 -89 7.57094 0.242
NP_441510.2_2 Reverse -100 -119 3.14526 0.272
NP_441510.2_7 Forward -177 -163 11.4053 0.28
NP_440293.1_3 Reverse -61 -80 -1.7705 0.239
NP_440293.1_3 Forward -86 -67 -6.1954 0.287
NP_440766.1_4 Forward -117 -103 11.996 0.0581
NP_440766.1_4 Forward -175 -161 0.589577 0.276
NP_439988.1_3 Reverse -106 -120 6.09611 0.278
NP_441979.1_5 Reverse -98 -117 -11.8986 0.228
NP_441133.1_1 Forward -113 -94 13.8641 0.24
NP_439910.1_2 Reverse -154 -171 -12.4492 0.0863
NP_440457.1_1 Forward -367 -355 1.90727 0.223
NP_440457.1_1 Forward -117 -105 1.21895 0.244
NP_440213.1_5 Forward -51 -32 11.6025 0.214
NP_440798.1_6 Reverse -163 -176 12.999 0.0458
NP_441801.1_4 Forward -87 -77 3.12662 0.231
NP_440801.1_8 Reverse -103 -122 3.14605 0.229
NP_440801.1_10 Forward -117 -98 5.11266 0.289
NP_440554.1_4 Reverse -163 -173 4.40493 0.19
NP_442862.1_4 Reverse -335 -354 18.9765 0.231
NP_441845.1_6 Forward -125 -107 3.55906 0.223
NP_441885.1_5 Forward -171 -161 7.84651 0.0419
NP_441885.1_5 Reverse -104 -114 1.35667 0.11
NP_441885.1_5 Forward -224 -214 -0.314959 0.195
NP_442341.1_9 Forward -173 -159 8.16044 0.178
NP_442341.1_9 Reverse -102 -116 4.52221 0.299
NP_443000.1_7 Forward -115 -105 7.25653 0.0927
NP_440507.2_3 Forward -122 -103 14.0599 0.137
NP_440275.1_3 Forward -173 -163 5.78156 0.131
NP_440275.1_3 Forward -365 -355 4.3066 0.199
NP_440679.1_5 Reverse -107 -126 5.30933 0.292
NP_442451.1_2 Reverse -82 -101 4.22769 0.123
NP_440149.1_8 Reverse -162 -181 -7.4737 0.285
NP_440149.1_8 Forward -355 -336 -7.67036 0.29
NP_442373.1_2 Forward -385 -366 -8.26035 0.249
NP_440216.1_1 Reverse -162 -176 -5.31028 0.126
NP_440216.1_1 Forward -113 -99 -11.9968 0.236
NP_440216.1_9 Reverse -217 -226 5.89959 0.289
NP_440172.1_1 Forward -171 -161 8.82982 0.0586
NP_442015.1_10 Forward -82 -69 6.90245 0.103
NP_442015.1_10 Forward -117 -104 6.31247 0.119
NP_442015.1_10 Reverse -100 -113 2.57589 0.19
NP_442015.1_10 Reverse -342 -355 0.904263 0.216
NP_442015.1_10 Forward -270 -257 -0.964025 0.289
NP_441226.1_7 Forward -170 -163 12.7234 0.0312
NP_441226.1_7 Reverse -163 -170 11.5435 0.0757
NP_441757.1_3 Forward -114 -95 0.294447 0.193
NP_441111.1_7 Reverse -105 -113 8.96754 0.0463
NP_441111.1_7 Reverse -163 -171 8.86921 0.0589
NP_441177.1_6 Reverse -365 -384 18.2882 0.135
NP_441766.1_2 Reverse -104 -113 8.65285 0.0495
NP_441766.1_2 Forward -171 -162 8.1612 0.0645
NP_441766.1_2 Reverse -162 -171 5.89959 0.103
NP_442417.1_5 Forward -113 -99 9.93102 0.124
NP_440416.1_9 Reverse -97 -116 -14.1602 0.173
NP_440416.1_9 Forward -120 -101 -17.3068 0.237
NP_443052.1_9 Reverse -363 -382 -5.21209 0.265
NP_442403.1_8 Forward -117 -98 -2.75381 0.282
NP_442154.1_1 Forward -357 -339 -10.4039 0.206
NP_442154.1_1 Forward -348 -330 -11.8789 0.217
NP_442154.1_1 Forward -384 -366 -14.9272 0.218
NP_442154.1_1 Reverse -111 -129 -16.8938 0.246
NP_442154.1_1 Forward -382 -364 -17.2871 0.251
NP_442154.1_1 Forward -118 -100 -17.5821 0.26
NP_442154.1_1 Forward -390 -372 -17.8771 0.272
NP_441430.1_6 Reverse -58 -77 12.2908 0.236
NP_440261.1_5 Reverse -111 -124 -3.32397 0.127
NP_440988.1_10 Reverse -213 -227 9.44903 0.204
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACATCAATCATCATTTTGGTGGTGTCGGTGTTGCGGGACGATTGGATGATTGGCATGGTGGGGGTTTTAATTCTCAGTGCCGGTAATGCGGCTTTGATGCTTTTGGCCCAATTAATTCGCCGGATGGAGGCCCTATGATCACCACCATCATTAACTGGCTGACTAACGGTTTTCTGGCCATGGGCATTCTTTTTTGGCTCTTTGGTACTTTTCCCCTACTTCAAAGTCGGCGATCGGTCATTACTAAACTCCATCTGCTAACGGTGTCGGACACCCTCGGCTCCATGGCGATCGTGGTGGGGCTATTTCTGAAACTGCCCCGGGAATGGCCCCTCCTGCTCTTAGCTATCATTTGTCTTTGTCTATGGAATACCATTCTGGGTTACGTGTTGGCCTACT

CDS

GTGCCACCGGGGAGAAGCGCACTAATGTTTAATTTGGCAGACCAAACGGAAATTTTAGCTTTTACCCCCCTATTGCCTTTTTGCGCTTTGTTGGTGGTAATTCAAGGCAATCCCTACCAGGCCTTGGTAATGCGGGGGATTTTGGGGGCGGTGGCGGCCCTGATTTATACACTGTTGGGAGCAGCGGATGTGGCCTTGACAGAGGCGTTGGTGGGAACCATGTTATCCGTTACCCTGTTTGCAGTGGCGGTGCGGTCTTCCCTGGTGCTGCGTTTAGGGGTCATTGCTCCCCCCGATGGTGATGACGGCAAAAAATTGATTGCCCCAGAAGATGAACAGGCTATTACCCAGGCGATCGCCCCTTACCATTTGCGGTTAGAAATTATTGCCTATGAAGATTTAGCCAGTTTGACGGAAGCTTGGCAAACCCGGGCTATCCATTGTTGGTATGAAGCCGATGTGGCCATTTTAAATACCCCCGTGGTGCGGTTGCAGGAAATTCTCGCTCCGGCCCTAGTGTCCCAGGCGATCGCCGTTAAATTTGTGCCTGCTAGTACCAGTCCTGTTCCCCCTCTATACTCCCCGGAGGTTGCCCAATGA

Protein

MPPGRSALMFNLADQTEILAFTPLLPFCALLVVIQGNPYQALVMRGILGAVAALIYTLLGAADVALTEALVGTMLSVTLFAVAVRSSLVLRLGVIAPPDGDDGKKLIAPEDEQAITQAIAPYHLRLEIIAYEDLASLTEAWQTRAIHCWYEADVAILNTPVVRLQEILAPALVSQAIAVKFVPASTSPVPPLYSPEVAQ