Your browser is old and dusty. Try Google Chrome!

Details for slr2006

ORF slr2006
Accession NP_440571.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -158 -144 13.6676 0.0392
NP_441061.1_2 Reverse -151 -165 0.982901 0.196
NP_440795.1_7 Forward -158 -151 14.6904 0.0123
NP_440795.1_7 Reverse -151 -158 14.6904 0.0123
NP_440795.1_7 Reverse -392 -399 6.92228 0.26
NP_441418.1_6 Forward -335 -316 -1.37718 0.0136
NP_441418.1_6 Forward -159 -140 -11.3086 0.0479
NP_441418.1_6 Reverse -358 -377 -28.1232 0.203
NP_442291.1_5 Forward -160 -144 2.22182 0.13
NP_441453.1_4 Reverse -150 -158 16.539 0.00633
NP_441453.1_4 Forward -159 -151 16.539 0.00633
NP_441453.1_4 Forward -335 -327 6.70593 0.121
NP_441960.1_3 Forward -308 -289 12.6504 0.291
NP_442151.1_6 Forward -159 -145 16.5192 0.0145
NP_442151.1_6 Reverse -150 -164 15.9292 0.0192
NP_441818.1_1 Forward -158 -147 18.8393 0.00301
NP_441818.1_1 Reverse -151 -162 15.8894 0.0244
NP_441818.1_1 Forward -152 -141 9.98959 0.232
NP_441818.1_9 Reverse -379 -398 -7.08038 0.268
NP_440226.1_1 Forward -159 -140 9.73422 0.0694
NP_440226.1_1 Reverse -150 -169 8.65258 0.0836
NP_440226.1_1 Forward -335 -316 8.25926 0.0904
NP_442173.1_1 Forward -158 -150 15.4574 0.00633
NP_442173.1_1 Reverse -151 -159 15.4574 0.00633
NP_442173.1_1 Reverse -327 -335 5.82095 0.2
NP_442173.1_1 Forward -152 -144 4.93597 0.241
NP_442752.1_4 Forward -335 -328 13.8055 0.0199
NP_442752.1_4 Forward -159 -152 13.8055 0.0199
NP_442752.1_4 Reverse -150 -157 13.8055 0.0199
NP_442752.1_4 Reverse -179 -186 6.52896 0.154
NP_443027.1_4 Forward -161 -151 14.0414 0.0452
NP_443027.1_4 Reverse -148 -158 14.0414 0.0452
NP_443027.1_4 Forward -337 -327 8.04317 0.219
NP_441812.1_3 Reverse -149 -163 8.65272 0.251
NP_442975.1_10 Reverse -146 -160 13.4703 0.0459
NP_442975.1_10 Forward -163 -149 3.63724 0.252
NP_442975.1_10 Reverse -322 -336 2.75226 0.269
NP_440784.1_7 Forward -158 -151 15.9687 0.0123
NP_440784.1_7 Reverse -151 -158 15.9687 0.0123
NP_440784.1_7 Reverse -327 -334 6.23397 0.241
NP_440784.1_7 Forward -334 -327 6.13563 0.241
NP_442909.1_7 Forward -158 -144 15.8302 0.0922
NP_440061.1_9 Reverse -315 -329 9.53707 0.143
NP_440061.1_9 Reverse -148 -162 9.04542 0.154
NP_441054.1_1 Reverse -143 -157 14.8476 0.212
NP_441054.1_2 Reverse -353 -372 11.6025 0.263
NP_441054.1_4 Forward -169 -151 5.32902 0.137
NP_442062.1_8 Forward -159 -149 17.3846 0.00193
NP_442062.1_8 Reverse -150 -160 17.3846 0.00193
NP_441900.1_2 Forward -191 -173 -2.73484 0.279
NP_441859.1_3 Forward -160 -141 5.30853 0.204
NP_441859.1_3 Forward -336 -317 2.26028 0.263
NP_441859.1_3 Reverse -316 -335 1.27698 0.29
NP_441802.1_1 Reverse -246 -265 4.32602 0.296
NP_440304.1_4 Forward -161 -151 10.8948 0.051
NP_440304.1_4 Reverse -148 -158 10.8948 0.051
NP_440304.1_4 Reverse -295 -305 2.83163 0.299
NP_442242.1_4 Forward -158 -151 14.3954 0.0124
NP_442242.1_4 Reverse -151 -158 14.3954 0.0124
NP_442242.1_4 Forward -334 -327 12.4288 0.0393
NP_440044.1_8 Forward -158 -139 11.9958 0.0456
NP_440765.1_3 Reverse -365 -384 8.45592 0.268
NP_440011.1_1 Reverse -165 -184 11.0125 0.286
NP_439918.1_2 Reverse -380 -399 4.916 0.163
NP_439918.1_2 Reverse -379 -398 4.916 0.163
NP_441200.1_4 Reverse -374 -393 5.11266 0.297
NP_441594.1_6 Reverse -141 -160 10.4225 0.127
NP_440370.1_10 Reverse -317 -336 7.27595 0.264
NP_442110.1_7 Forward -159 -145 18.6825 0.0142
NP_441925.1_4 Forward -191 -172 -6.68779 0.185
NP_441083.1_3 Reverse -390 -400 11.8776 0.297
NP_441083.1_5 Forward -159 -149 20.3345 0.00053
NP_441083.1_5 Reverse -150 -160 20.3345 0.00053
NP_441083.1_5 Reverse -326 -336 0.865012 0.218
NP_441149.1_9 Reverse -303 -322 1.76863 0.221
NP_441434.1_3 Reverse -294 -313 0.58944 0.208
NP_441738.1_2 Reverse -328 -335 15.28 0.0102
NP_441738.1_2 Forward -157 -150 15.28 0.0102
NP_441738.1_2 Reverse -152 -159 15.28 0.0102
NP_441738.1_2 Reverse -163 -170 8.29857 0.176
NP_441738.1_2 Forward -385 -378 8.29857 0.176
NP_441558.1_5 Forward -161 -142 4.916 0.267
NP_440209.1_1 Reverse -150 -158 18.1123 0.00295
NP_440209.1_1 Forward -159 -151 18.1123 0.00295
NP_440209.1_1 Forward -335 -327 14.8674 0.012
NP_440209.1_1 Reverse -326 -334 5.62429 0.0821
NP_442889.1_8 Reverse -147 -161 11.5037 0.0733
NP_442889.1_8 Forward -162 -148 10.3237 0.0864
NP_441713.1_1 Forward -165 -146 -13.6686 0.257
NP_441713.1_1 Forward -341 -322 -15.1435 0.26
NP_440178.1_7 Forward -160 -141 -14.7502 0.156
NP_440178.1_7 Reverse -149 -168 -22.5183 0.267
NP_442570.1_3 Reverse -376 -395 -4.52377 0.231
NP_441716.1_1 Reverse -150 -164 7.07942 0.181
NP_441716.1_1 Forward -159 -145 5.99778 0.208
NP_442111.1_4 Forward -160 -146 3.14618 0.253
NP_442111.1_4 Reverse -149 -163 1.76955 0.294
NP_441163.1_1 Reverse -318 -335 10.3628 0.217
NP_441163.1_1 Forward -314 -297 4.0697 0.294
NP_440906.1_5 Forward -158 -151 15.8704 0.0124
NP_440906.1_5 Reverse -151 -158 15.8704 0.0124
NP_440906.1_5 Forward -334 -327 12.0355 0.0724
NP_440906.1_5 Reverse -327 -334 12.0355 0.0724
NP_442596.1_10 Forward -54 -35 7.17762 0.292
NP_440747.1_10 Reverse -147 -159 7.51213 0.00286
NP_440747.1_10 Forward -162 -150 7.4138 0.00422
NP_440747.1_10 Forward -338 -326 -2.51763 0.0509
NP_441130.1_10 Forward -161 -147 7.76774 0.149
NP_441486.1_1 Reverse -147 -161 20.9441 0.00262
NP_441486.1_1 Forward -162 -148 12.1926 0.0129
NP_441486.1_1 Forward -156 -142 0.392915 0.138
NP_441486.1_1 Reverse -208 -222 0.0979218 0.145
NP_441695.1_8 Forward -373 -359 10.7177 0.283
NP_441014.1_8 Reverse -284 -303 5.01433 0.19
NP_441014.1_8 Forward -191 -172 -0.4922 0.218
NP_441014.1_10 Reverse -149 -168 10.4217 0.118
NP_441014.1_10 Forward -160 -141 1.76863 0.224
NP_442848.1_1 Reverse -144 -158 24.779 0.00131
NP_442848.1_1 Reverse -320 -334 -4.22864 0.282
NP_442848.1_1 Reverse -138 -152 -4.52363 0.294
NP_442848.1_5 Forward -374 -356 -2.63579 0.286
NP_443018.1_3 Forward -158 -151 14.8871 0.0123
NP_443018.1_3 Reverse -151 -158 14.8871 0.0123
NP_443018.1_3 Forward -152 -145 10.7572 0.0907
NP_443018.1_3 Forward -219 -212 10.2655 0.107
NP_443018.1_3 Forward -334 -327 5.34899 0.212
NP_443018.1_3 Reverse -327 -334 5.34899 0.212
NP_443018.1_3 Reverse -145 -152 4.56234 0.241
NP_441316.1_7 Reverse -324 -339 -1.98672 0.24
NP_441634.1_8 Forward -161 -147 2.16287 0.17
NP_441634.1_8 Reverse -173 -187 -0.000409212 0.243
NP_441634.1_8 Reverse -362 -376 -1.96703 0.295
NP_441634.1_8 Forward -337 -323 -3.73699 0.295
NP_441634.1_9 Reverse -359 -378 15.7316 0.165
NP_440376.1_1 Forward -159 -150 19.4693 0.000692
NP_440376.1_1 Reverse -150 -159 19.4693 0.000692
NP_440376.1_1 Reverse -391 -400 4.52295 0.156
NP_440376.1_1 Forward -335 -326 -0.000272808 0.285
NP_440376.1_1 Reverse -326 -335 -0.0986038 0.285
NP_441588.1_4 Forward -157 -147 8.63316 0.14
NP_441588.1_4 Reverse -152 -162 6.37155 0.2
NP_442687.1_7 Forward -160 -150 8.92815 0.0994
NP_442687.1_7 Reverse -149 -159 8.92815 0.0994
NP_442687.1_7 Forward -336 -326 5.19158 0.217
NP_442687.1_7 Forward -374 -364 4.89658 0.23
NP_442191.1_4 Reverse -365 -379 10.5083 0.298
NP_441846.1_10 Reverse -172 -191 -21.535 0.256
NP_441846.1_10 Forward -326 -307 -23.305 0.282
NP_442530.1_2 Reverse -70 -80 10.9931 0.284
NP_441013.1_3 Reverse -358 -377 6.39097 0.281
NP_441388.1_10 Forward -384 -367 20.8404 0.0648
NP_441422.1_7 Forward -381 -364 -1.53445 0.194
NP_440533.1_9 Reverse -150 -169 3.24438 0.253
NP_441950.1_7 Forward -292 -273 -6.68705 0.269
NP_441950.1_7 Reverse -172 -191 -7.27704 0.278
NP_442658.1_1 Reverse -324 -334 10.4026 0.119
NP_442658.1_1 Forward -337 -327 7.25606 0.214
NP_442658.1_1 Reverse -148 -158 6.76441 0.214
NP_442658.1_1 Forward -161 -151 6.76441 0.214
NP_442198.1_3 Forward -168 -149 8.25926 0.249
NP_442198.1_3 Forward -347 -328 6.58763 0.251
NP_442782.1_2 Reverse -358 -372 6.48943 0.223
NP_440656.1_6 Reverse -367 -386 12.3892 0.161
NP_441414.1_9 Reverse -150 -169 14.6508 0.0124
NP_441414.1_9 Reverse -326 -345 -5.11376 0.169
NP_442937.1_5 Reverse -145 -164 9.3409 0.196
NP_441958.1_5 Forward -160 -150 12.2714 0.00183
NP_441958.1_5 Reverse -149 -159 12.2714 0.00183
NP_441958.1_5 Forward -336 -326 -6.41148 0.28
NP_441127.1_1 Forward -316 -302 8.65272 0.288
NP_440203.1_5 Reverse -319 -329 9.02601 0.275
NP_439905.1_1 Reverse -151 -164 7.19745 0.264
NP_439990.1_5 Forward -164 -151 17.1289 0.0266
NP_439990.1_5 Reverse -145 -158 10.049 0.128
NP_439990.1_5 Forward -340 -327 8.47575 0.17
NP_442911.1_2 Forward -169 -150 13.5691 0.0118
NP_442911.1_2 Reverse -140 -159 5.01433 0.0356
NP_441580.1_6 Reverse -139 -158 -1.27885 0.186
NP_442064.1_1 Forward -164 -145 -12.4886 0.277
NP_442064.1_4 Forward -163 -144 7.96345 0.237
NP_440200.1_3 Forward -57 -38 15.6341 0.0723
NP_440200.1_3 Reverse -377 -396 7.96426 0.298
NP_443055.1_6 Forward -307 -289 1.29671 0.233
NP_440138.1_6 Reverse -145 -164 6.68515 0.22
NP_441099.1_5 Reverse -140 -159 -9.73531 0.231
NP_441099.1_5 Forward -169 -150 -9.73531 0.231
NP_442002.1_9 Reverse -296 -303 11.3472 0.185
NP_442002.1_9 Forward -336 -329 10.7572 0.185
NP_440809.1_9 Forward -168 -150 -7.84733 0.225
NP_441294.1_7 Reverse -146 -160 14.242 0.0448
NP_441646.1_1 Reverse -270 -289 -1.57384 0.291
NP_442438.1_10 Reverse -145 -159 15.4376 0.0262
NP_442566.1_2 Reverse -321 -340 14.5524 0.27
NP_441000.1_6 Reverse -325 -339 -2.06536 0.216
NP_440147.1_4 Forward -161 -148 2.08423 0.21
NP_440147.1_4 Reverse -148 -161 2.08423 0.21
NP_441295.1_4 Reverse -365 -384 -1.27885 0.29
NP_441550.1_8 Reverse -148 -158 12.3692 0.0336
NP_441550.1_8 Forward -161 -151 12.3692 0.0336
NP_441916.1_7 Forward -159 -149 10.3048 0.0261
NP_441916.1_7 Reverse -150 -160 10.3048 0.0261
NP_441916.1_7 Reverse -211 -221 1.25834 0.289
NP_441041.1_4 Forward -159 -140 4.62101 0.0558
NP_441041.1_4 Reverse -138 -157 -4.72043 0.141
NP_441041.1_4 Reverse -150 -169 -5.60541 0.155
NP_441041.1_4 Reverse -358 -377 -12.4886 0.266
NP_442642.1_9 Reverse -143 -160 5.84037 0.192
NP_442396.1_5 Forward -163 -150 18.6038 0.0171
NP_442004.1_6 Forward -159 -145 11.6026 0.115
NP_442004.1_6 Reverse -144 -158 1.27789 0.294
NP_440703.1_9 Reverse -40 -53 6.0169 0.288
NP_441725.1_5 Forward -158 -148 11.2881 0.0247
NP_441725.1_5 Reverse -151 -161 11.2881 0.0247
NP_441725.1_5 Forward -334 -324 -0.511621 0.26
NP_439966.1_7 Reverse -148 -158 15.8108 0.0124
NP_439966.1_7 Forward -161 -151 15.8108 0.0124
NP_439966.1_7 Reverse -324 -334 10.206 0.0958
NP_439966.1_7 Forward -337 -327 8.14104 0.14
NP_439966.1_9 Forward -337 -328 0.884706 0.253
NP_442941.1_3 Forward -158 -148 19.9412 0.00262
NP_442941.1_3 Reverse -151 -161 19.9412 0.00262
NP_442941.1_3 Reverse -327 -337 1.06167 0.153
NP_440289.1_2 Reverse -147 -160 13.294 0.0132
NP_440289.1_2 Forward -162 -149 3.75586 0.0741
NP_440289.1_2 Reverse -323 -336 -4.89726 0.294
NP_440983.1_5 Reverse -29 -48 -8.94866 0.298
NP_440260.1_7 Forward -313 -294 1.0811 0.241
NP_440260.1_8 Forward -156 -138 -5.38906 0.273
NP_440260.1_8 Forward -47 -29 -6.96235 0.295
NP_441678.1_9 Reverse -379 -398 -0.295539 0.229
NP_442281.1_1 Reverse -145 -159 15.5352 0.0117
NP_442281.1_1 Reverse -139 -153 2.35894 0.269
NP_441079.1_1 Forward -373 -354 18.7807 0.126
NP_440177.1_9 Reverse -362 -381 11.9958 0.239
NP_440479.1_8 Reverse -308 -327 18.9817 0.282
NP_440437.1_1 Reverse -144 -163 -2.36049 0.218
NP_440437.1_1 Forward -341 -322 -3.14714 0.232
NP_441556.1_7 Forward -383 -364 8.25844 0.171
NP_443030.1_4 Reverse -310 -329 -0.590531 0.222
NP_441644.1_6 Forward -159 -149 17.3841 0.00127
NP_441644.1_6 Reverse -150 -160 17.3841 0.00127
NP_442215.1_2 Forward -161 -145 5.36841 0.0796
NP_442215.1_2 Forward -155 -139 -5.84132 0.26
NP_442215.1_2 Reverse -148 -164 -6.7263 0.278
NP_442029.1_1 Forward -328 -309 -11.4069 0.229
NP_440253.1_2 Forward -159 -141 9.26226 0.0507
NP_440253.1_2 Reverse -150 -168 0.805796 0.176
NP_440929.1_8 Forward -159 -150 19.2726 0.000701
NP_440929.1_8 Reverse -150 -159 19.2726 0.000701
NP_442933.1_10 Forward -159 -150 17.601 0.00325
NP_442933.1_10 Reverse -150 -159 17.601 0.00325
NP_442933.1_10 Forward -335 -326 5.40793 0.19
NP_441751.2_8 Forward -158 -144 4.22782 0.0521
NP_441751.2_8 Reverse -151 -165 4.12949 0.0534
NP_441751.2_8 Reverse -327 -341 -5.40861 0.206
NP_442554.1_8 Forward -158 -148 15.9097 0.00747
NP_442554.1_8 Reverse -151 -161 15.9097 0.00747
NP_442554.1_8 Reverse -327 -337 4.40493 0.188
NP_441762.1_7 Forward -336 -324 4.26721 0.0518
NP_441762.1_7 Reverse -325 -337 -5.07423 0.187
NP_441762.1_7 Forward -160 -148 -6.84419 0.284
NP_441762.1_7 Reverse -149 -161 -6.84419 0.284
NP_442142.1_4 Reverse -147 -160 14.1783 0.0311
NP_442142.1_4 Reverse -323 -336 13.49 0.0348
NP_442142.1_4 Forward -162 -149 6.21356 0.17
NP_442142.1_4 Forward -338 -325 4.73861 0.212
NP_442142.1_4 Forward -156 -143 3.65697 0.248
NP_442142.1_9 Forward -342 -323 2.65439 0.282
NP_442292.1_1 Forward -158 -149 18.486 0.00229
NP_442292.1_1 Reverse -151 -160 18.486 0.00229
NP_442292.1_1 Reverse -327 -336 -0.0986038 0.239
NP_442476.1_6 Reverse -151 -165 4.32615 0.144
NP_443009.1_5 Reverse -149 -160 8.90795 0.0965
NP_443009.1_5 Forward -160 -149 8.90795 0.0965
NP_441715.1_4 Forward -158 -148 14.828 0.0268
NP_441715.1_4 Reverse -151 -161 14.828 0.0268
NP_441715.1_4 Reverse -327 -337 9.12481 0.103
NP_440015.1_9 Forward -159 -141 -1.06249 0.268
NP_441448.1_2 Reverse -312 -331 -0.0996487 0.25
NP_441468.1_1 Forward -158 -151 15.8704 0.0124
NP_441468.1_1 Reverse -151 -158 15.8704 0.0124
NP_441468.1_1 Reverse -327 -334 6.13563 0.209
NP_441468.1_1 Forward -334 -327 6.0373 0.223
NP_441468.1_1 Reverse -145 -152 4.07068 0.263
NP_441020.2_6 Forward -161 -144 5.64371 0.293
NP_441015.1_10 Forward -158 -139 -11.2103 0.292
NP_441673.1_1 Forward -159 -150 20.8459 0.000698
NP_441673.1_1 Reverse -150 -159 20.8459 0.000698
NP_441673.1_1 Forward -335 -326 1.27803 0.155
NP_441673.1_1 Reverse -326 -335 1.27803 0.155
NP_441673.1_1 Reverse -391 -400 -8.06341 0.254
NP_441876.1_9 Reverse -303 -313 13.5492 0.267
NP_441826.1_2 Reverse -144 -158 13.6676 0.0214
NP_441826.1_2 Forward -159 -145 9.2427 0.0617
NP_441826.1_2 Forward -332 -318 -1.8687 0.257
NP_441826.1_2 Reverse -320 -334 -4.22864 0.293
NP_441826.1_2 Reverse -138 -152 -4.4253 0.296
NP_442811.1_2 Forward -301 -282 -2.36049 0.281
NP_441764.1_4 Forward -96 -79 12.6554 0.181
NP_442868.1_6 Forward -161 -151 9.91146 0.038
NP_442868.1_6 Reverse -148 -158 9.91146 0.038
NP_442868.1_6 Forward -337 -327 0.471689 0.226
NP_441056.1_1 Forward -159 -140 9.73422 0.0639
NP_441612.1_2 Reverse -150 -160 8.54929 0.21
NP_441612.1_2 Forward -159 -149 8.54929 0.21
NP_442227.1_2 Forward -185 -166 1.37609 0.246
NP_442227.1_2 Reverse -319 -338 -1.86883 0.268
NP_442361.1_3 Reverse -144 -157 14.9656 0.102
NP_442427.1_8 Reverse -141 -160 10.3242 0.165
NP_442427.1_8 Forward -168 -149 8.84924 0.192
NP_442808.1_1 Reverse -325 -335 17.5808 0.00507
NP_442808.1_1 Reverse -149 -159 8.63269 0.0481
NP_442808.1_1 Forward -160 -150 8.63269 0.0481
NP_442808.1_1 Forward -374 -364 3.61784 0.234
NP_442808.1_1 Forward -380 -370 0.962914 0.299
NP_442775.1_6 Forward -158 -139 12.9791 0.277
NP_442050.1_5 Reverse -148 -158 16.4991 0.00812
NP_442050.1_5 Forward -161 -151 16.4991 0.00812
NP_440342.1_1 Reverse -174 -193 10.4225 0.287
NP_440558.1_2 Forward -376 -357 2.3594 0.169
NP_440558.1_2 Forward -156 -137 -4.22878 0.243
NP_440558.1_2 Forward -162 -143 -5.01543 0.251
NP_440558.1_2 Reverse -141 -160 -5.70374 0.264
NP_440558.1_2 Forward -168 -149 -6.39206 0.274
NP_441878.1_6 Forward -160 -150 10.4031 0.0176
NP_441878.1_6 Reverse -149 -159 10.4031 0.0176
NP_441878.1_6 Reverse -390 -400 -7.19813 0.21
NP_441036.1_8 Reverse -325 -335 13.8447 0.0353
NP_441036.1_8 Forward -160 -150 8.33817 0.174
NP_441036.1_8 Reverse -149 -159 8.33817 0.174
NP_442650.1_2 Forward -159 -145 6.88276 0.13
NP_441557.1_5 Forward -159 -150 19.9609 0.000699
NP_441557.1_5 Reverse -150 -159 19.9609 0.000699
NP_441557.1_5 Forward -335 -326 0.983037 0.0911
NP_441557.1_5 Reverse -326 -335 0.688044 0.128
NP_441445.1_1 Forward -168 -149 12.8808 0.0621
NP_441445.1_1 Reverse -141 -160 10.6192 0.0942
NP_441445.1_1 Forward -325 -306 -0.197208 0.286
NP_441445.1_1 Forward -156 -137 -0.197208 0.286
NP_441590.1_4 Reverse -34 -53 1.6703 0.299
NP_442066.2_9 Forward -163 -150 11.229 0.154
NP_441224.1_2 Reverse -240 -258 16.6371 0.109
NP_441458.1_10 Reverse -141 -160 12.9791 0.0856
NP_441458.1_10 Forward -229 -210 3.83436 0.24
NP_442183.1_1 Forward -159 -145 16.1259 0.0162
NP_442183.1_1 Reverse -150 -164 11.111 0.0757
NP_442183.1_1 Forward -335 -321 10.521 0.0829
NP_442183.1_9 Reverse -388 -398 14.7297 0.206
NP_441549.1_9 Forward -163 -145 -5.48739 0.198
NP_441238.1_10 Reverse -362 -376 12.4876 0.292
NP_442347.1_2 Forward -158 -149 12.4878 0.056
NP_442347.1_2 Reverse -151 -160 12.4878 0.056
NP_442347.1_2 Reverse -278 -287 3.93297 0.284
NP_442645.1_2 Forward -167 -148 -14.1602 0.171
NP_442645.1_2 Reverse -142 -161 -14.2585 0.172
NP_442645.1_2 Reverse -203 -222 -15.1435 0.19
NP_442888.1_9 Reverse -138 -157 14.2574 0.22
NP_441037.1_4 Forward -337 -327 5.85583 0.296
NP_442594.1_3 Reverse -40 -59 5.30933 0.253
NP_442594.1_7 Reverse -315 -334 6.39016 0.207
NP_442594.1_8 Forward -291 -272 3.04771 0.289
NP_441633.1_3 Forward -161 -148 -6.07724 0.236
NP_441633.1_3 Reverse -148 -161 -6.07724 0.236
NP_441633.1_3 Forward -337 -324 -6.56889 0.259
NP_441633.1_3 Reverse -273 -286 -6.96221 0.283
NP_441633.1_3 Reverse -315 -328 -7.25721 0.3
NP_440136.1_1 Reverse -67 -83 10.3826 0.238
NP_440136.1_2 Forward -158 -151 15.9687 0.0123
NP_440136.1_2 Reverse -151 -158 15.9687 0.0123
NP_440136.1_2 Reverse -327 -334 6.23397 0.171
NP_440136.1_2 Forward -334 -327 6.13563 0.193
NP_442590.1_9 Reverse -289 -308 3.14605 0.3
NP_442590.1_10 Forward -159 -140 12.4875 0.145
NP_442590.1_10 Reverse -172 -191 3.93269 0.283
NP_442998.1_5 Forward -309 -299 12.8614 0.158
NP_442998.1_10 Reverse -328 -335 15.5754 0.0102
NP_442998.1_10 Forward -157 -150 15.5754 0.0102
NP_442998.1_10 Reverse -152 -159 15.5754 0.0102
NP_440899.1_1 Reverse -374 -393 5.57728 0.3
NP_440299.1_1 Reverse -146 -159 14.08 0.0259
NP_440299.1_1 Forward -163 -150 12.9984 0.0319
NP_441799.1_1 Forward -163 -149 12.2903 0.0441
NP_441799.1_1 Forward -339 -325 5.1122 0.223
NP_441799.1_1 Reverse -322 -336 4.52221 0.247
NP_441799.1_1 Reverse -146 -160 3.44058 0.298
NP_441007.1_10 Reverse -145 -158 2.67422 0.183
NP_441007.1_10 Forward -164 -151 1.39592 0.203
NP_441007.1_10 Reverse -173 -186 -0.472371 0.285
NP_440256.1_1 Forward -162 -143 5.80098 0.0334
NP_440256.1_1 Forward -338 -319 -6.39206 0.21
NP_440256.1_1 Forward -156 -137 -7.76869 0.245
NP_440087.1_1 Reverse -179 -198 -7.96535 0.276
NP_441559.1_8 Forward -192 -178 5.89945 0.0832
NP_441559.1_8 Reverse -312 -326 -4.91696 0.241
NP_441559.1_8 Forward -340 -326 -7.37523 0.291
NP_441559.1_8 Reverse -70 -84 -7.76856 0.299
NP_440915.1_6 Reverse -146 -160 4.52282 0.0953
NP_440702.1_2 Forward -331 -312 -7.08038 0.265
NP_440695.1_5 Forward -159 -140 5.01433 0.186
NP_440695.1_6 Forward -230 -216 9.44178 0.285
NP_442957.1_9 Reverse -32 -51 6.19431 0.272
NP_441417.1_8 Forward -328 -309 13.4708 0.269
NP_442993.1_1 Forward -159 -143 -8.88958 0.176
NP_442993.1_1 Reverse -150 -166 -9.5779 0.188
NP_442386.1_9 Reverse -149 -158 13.8639 0.0289
NP_442386.1_9 Forward -160 -151 13.8639 0.0289
NP_442386.1_9 Reverse -143 -152 9.04574 0.175
NP_442386.1_9 Reverse -325 -334 8.06244 0.209
NP_442386.1_9 Forward -336 -327 5.89917 0.233
NP_442386.1_9 Forward -154 -145 4.81753 0.282
NP_442386.1_9 Forward -374 -365 4.7192 0.289
NP_440570.1_7 Reverse -48 -67 17.699 0.175
NP_441340.1_5 Forward -158 -151 15.6737 0.0124
NP_441340.1_5 Reverse -151 -158 15.6737 0.0124
NP_441340.1_5 Forward -334 -327 6.13563 0.175
NP_441340.1_5 Reverse -327 -334 5.93897 0.198
NP_441340.1_5 Forward -152 -145 3.97235 0.274
NP_441271.1_1 Forward -165 -147 12.1131 0.236
NP_442484.1_2 Reverse -139 -158 8.84924 0.143
NP_440327.1_6 Reverse -379 -398 8.94757 0.214
NP_440327.1_6 Reverse -380 -399 8.65258 0.216
NP_441248.1_9 Forward -113 -94 17.2065 0.294
NP_440161.1_3 Reverse -324 -343 18.9773 0.0611
NP_442714.1_7 Reverse -151 -170 5.60432 0.174
NP_440211.1_1 Reverse -39 -58 11.6017 0.231
NP_440586.1_1 Forward -175 -156 -4.52377 0.278
NP_440586.1_8 Forward -158 -151 13.2151 0.026
NP_440586.1_8 Reverse -151 -158 13.2151 0.026
NP_440586.1_8 Forward -334 -327 11.4451 0.0645
NP_440586.1_8 Forward -219 -212 9.08521 0.178
NP_440586.1_9 Reverse -353 -372 10.3242 0.258
NP_442251.1_6 Forward -158 -151 15.2804 0.0124
NP_442251.1_6 Reverse -151 -158 15.2804 0.0124
NP_442251.1_6 Reverse -327 -334 12.0355 0.0627
NP_442251.1_6 Reverse -107 -114 6.43063 0.298
NP_441262.1_3 Reverse -150 -157 14.7888 0.0223
NP_441262.1_3 Forward -335 -328 14.7888 0.0223
NP_441262.1_3 Forward -159 -152 14.7888 0.0223
NP_440027.1_3 Reverse -29 -47 6.50823 0.225
NP_440027.1_3 Reverse -316 -334 3.8533 0.263
NP_443051.1_1 Reverse -149 -158 10.4228 0.00754
NP_443051.1_1 Forward -160 -151 10.4228 0.00754
NP_443051.1_1 Forward -336 -327 0.786375 0.125
NP_439937.1_8 Forward -337 -318 -5.40875 0.295
NP_440439.1_1 Forward -338 -325 -0.275709 0.211
NP_440439.1_1 Reverse -323 -336 -1.45568 0.269
NP_442239.1_8 Reverse -168 -187 11.7008 0.239
NP_440372.1_2 Forward -158 -151 16.3621 0.0124
NP_440372.1_2 Reverse -151 -158 16.3621 0.0124
NP_440372.1_2 Forward -334 -327 6.72562 0.0929
NP_440372.1_2 Reverse -327 -334 6.62729 0.151
NP_441789.1_7 Reverse -308 -327 -3.34455 0.272
NP_441789.1_7 Forward -397 -378 -4.62285 0.284
NP_441789.1_7 Forward -396 -377 -5.31116 0.297
NP_439977.1_5 Forward -165 -146 8.94757 0.0989
NP_439977.1_5 Reverse -144 -163 1.37609 0.194
NP_442384.1_10 Reverse -150 -163 15.8506 0.00946
NP_442384.1_10 Forward -159 -146 10.049 0.047
NP_442384.1_10 Reverse -326 -339 4.93583 0.142
NP_442384.1_10 Forward -80 -67 2.57589 0.22
NP_442114.1_4 Reverse -326 -337 14.8083 0.107
NP_441980.1_4 Forward -321 -302 2.85105 0.283
NP_440364.1_7 Reverse -80 -99 16.8141 0.121
NP_441604.1_4 Forward -300 -281 -6.88371 0.293
NP_441877.1_7 Forward -384 -365 1.17865 0.242
NP_441877.1_7 Reverse -312 -331 -0.29631 0.283
NP_441018.1_7 Forward -163 -144 13.3725 0.136
NP_442262.1_10 Forward -158 -151 14.1988 0.0123
NP_442262.1_10 Reverse -151 -158 14.1988 0.0123
NP_442262.1_10 Forward -152 -145 9.87221 0.164
NP_442262.1_10 Forward -219 -212 9.18389 0.211
NP_441689.1_5 Forward -161 -151 15.3192 0.0403
NP_441689.1_5 Reverse -148 -158 15.3192 0.0403
NP_441689.1_5 Reverse -142 -152 4.99446 0.285
NP_440163.1_10 Reverse -147 -157 11.3864 0.169
NP_440163.1_10 Forward -162 -152 10.4031 0.201
NP_440344.1_10 Reverse -143 -160 12.8219 0.006
NP_440344.1_10 Forward -166 -149 -6.84433 0.115
NP_440344.1_10 Reverse -319 -336 -10.8759 0.194
NP_440531.1_6 Forward -228 -209 -2.75381 0.258
NP_440487.1_1 Reverse -323 -342 -7.57203 0.296
NP_441965.1_10 Reverse -323 -339 10.285 0.107
NP_441965.1_10 Reverse -147 -163 7.43336 0.148
NP_441965.1_10 Reverse -176 -192 4.68009 0.234
NP_441640.1_8 Forward -158 -139 -4.42544 0.265
NP_440297.1_9 Forward -158 -148 9.32148 0.0917
NP_440297.1_9 Reverse -151 -161 9.32148 0.0917
NP_440894.1_10 Forward -164 -145 8.84924 0.168
NP_440937.1_5 Forward -332 -313 12.1925 0.275
NP_442067.1_4 Forward -384 -365 4.42435 0.256
NP_440999.1_9 Reverse -146 -160 4.32615 0.116
NP_440888.1_2 Forward -159 -145 18.9768 0.00173
NP_440888.1_2 Reverse -150 -164 15.8302 0.00862
NP_440888.1_2 Forward -153 -139 11.602 0.0635
NP_440888.1_2 Forward -187 -173 7.27547 0.202
NP_440888.1_2 Forward -400 -386 5.01387 0.298
NP_442892.1_9 Reverse -80 -94 18.0918 0.161
NP_440575.1_1 Reverse -268 -287 -1.96793 0.29
NP_442077.1_9 Forward -76 -57 -1.37718 0.22
NP_441543.1_2 Forward -158 -149 16.9127 0.00359
NP_441543.1_2 Reverse -151 -160 16.9127 0.00359
NP_441543.1_2 Reverse -327 -336 8.75118 0.0968
NP_442845.1_2 Forward -165 -151 14.6509 0.0775
NP_442845.1_2 Reverse -144 -158 8.06273 0.195
NP_442845.1_2 Forward -159 -145 7.57108 0.195
NP_441304.1_10 Reverse -294 -303 15.4377 0.164
NP_441319.1_8 Forward -341 -323 11.1305 0.162
NP_441469.1_8 Forward -160 -151 6.48957 0.227
NP_441469.1_8 Reverse -149 -158 6.48957 0.227
NP_441469.1_8 Forward -336 -327 6.29291 0.227
NP_441469.1_8 Reverse -325 -334 5.70292 0.257
NP_443064.1_6 Forward -159 -149 12.5669 0.0796
NP_443064.1_6 Reverse -150 -160 12.5669 0.0796
NP_442578.1_7 Forward -158 -151 14.5921 0.026
NP_442578.1_7 Reverse -151 -158 14.5921 0.026
NP_442578.1_7 Forward -355 -348 8.79057 0.163
NP_442578.1_7 Forward -334 -327 5.93897 0.183
NP_441462.1_2 Forward -159 -149 11.5831 0.00406
NP_441462.1_2 Reverse -150 -160 11.5831 0.00406
NP_441462.1_2 Forward -335 -325 -0.118297 0.184
NP_441621.1_4 Forward -303 -290 12.999 0.267
NP_441621.1_7 Reverse -324 -338 -3.54032 0.19
NP_443062.1_1 Reverse -150 -168 12.9338 0.0708
NP_443062.1_1 Forward -153 -135 4.06059 0.276
NP_443062.1_6 Reverse -318 -337 6.78429 0.18
NP_443062.1_6 Reverse -142 -161 3.93269 0.225
NP_443062.1_6 Forward -343 -324 1.0811 0.28
NP_442204.1_1 Forward -339 -328 1.7303 0.266
NP_442204.1_1 Reverse -146 -157 0.353664 0.281
NP_442204.1_2 Reverse -140 -159 6.29264 0.287
NP_441560.1_6 Forward -311 -292 15.6341 0.241
NP_442487.1_2 Reverse -312 -331 8.65176 0.159
NP_440516.1_8 Forward -335 -326 17.6993 0.00442
NP_440516.1_8 Forward -159 -150 16.9127 0.00442
NP_440516.1_8 Reverse -150 -159 16.9127 0.00442
NP_440516.1_8 Reverse -370 -379 -0.000272808 0.156
NP_441785.1_1 Forward -159 -145 16.8106 0.0943
NP_441033.1_5 Forward -254 -235 19.4681 0.257
NP_442428.1_5 Forward -158 -151 15.8704 0.0124
NP_442428.1_5 Reverse -151 -158 15.8704 0.0124
NP_442428.1_5 Reverse -327 -334 6.13563 0.209
NP_442428.1_5 Forward -334 -327 6.0373 0.212
NP_442428.1_5 Reverse -145 -152 4.46401 0.267
NP_441443.1_7 Forward -311 -292 -1.86883 0.268
NP_442120.1_10 Forward -159 -140 -10.522 0.259
NP_441867.1_2 Reverse -182 -201 -13.1769 0.277
NP_440673.1_2 Forward -169 -150 10.6822 0.198
NP_440673.1_3 Forward -157 -150 12.4288 0.0426
NP_440673.1_3 Reverse -328 -335 12.4288 0.0426
NP_440673.1_3 Reverse -152 -159 12.4288 0.0426
NP_440673.1_3 Forward -151 -144 10.5605 0.123
NP_440673.1_3 Forward -78 -71 7.51227 0.252
NP_440673.1_3 Forward -257 -250 5.54565 0.288
NP_441052.1_2 Forward -159 -149 19.9412 0.00106
NP_441052.1_2 Reverse -150 -160 19.9412 0.00106
NP_441052.1_2 Forward -400 -390 5.48657 0.116
NP_441052.1_2 Reverse -326 -336 1.35667 0.248
NP_442219.1_8 Forward -163 -144 12.7089 0.153
NP_442219.1_8 Reverse -140 -159 9.13344 0.234
NP_442219.1_9 Forward -158 -149 17.7976 0.00718
NP_442219.1_9 Reverse -151 -160 17.7976 0.00718
NP_440436.1_4 Forward -158 -149 17.2072 0.00233
NP_440436.1_4 Reverse -151 -160 17.2072 0.00233
NP_440436.1_4 Reverse -327 -336 14.9456 0.0103
NP_440436.1_4 Forward -152 -143 9.73406 0.0871
NP_440436.1_4 Forward -334 -325 5.80084 0.182
NP_441884.1_9 Forward -187 -168 -22.42 0.278
NP_441884.1_9 Forward -311 -292 -23.01 0.284
NP_441884.1_9 Forward -338 -319 -24.6816 0.288
NP_440314.1_9 Reverse -151 -170 19.9606 0.00651
NP_441719.1_4 Forward -158 -151 16.3621 0.0124
NP_441719.1_4 Reverse -151 -158 16.3621 0.0124
NP_441719.1_4 Forward -334 -327 6.72562 0.093
NP_441719.1_4 Reverse -327 -334 6.62729 0.151
NP_442366.1_3 Forward -160 -142 -4.01242 0.262
NP_442176.1_1 Reverse -184 -203 2.16274 0.294
NP_442873.1_9 Reverse -140 -159 21.5331 0.0383
NP_441115.1_8 Forward -303 -285 14.8671 0.292
NP_442206.1_10 Reverse -179 -194 5.09311 0.178
NP_443054.1_2 Forward -161 -147 3.04785 0.24
NP_441851.1_10 Forward -160 -150 15.8113 0.00552
NP_441851.1_10 Reverse -149 -159 15.8113 0.00552
NP_441851.1_10 Reverse -178 -188 4.79825 0.247
NP_441668.1_4 Reverse -381 -400 -1.37718 0.273
NP_442515.1_1 Reverse -149 -163 20.0591 0.0162
NP_442515.1_1 Forward -160 -146 1.76955 0.149
NP_440593.1_3 Reverse -139 -158 -4.81876 0.253
NP_441046.1_2 Forward -170 -151 15.5357 0.182
NP_441349.1_10 Forward -169 -150 -5.80207 0.212
NP_441349.1_10 Reverse -381 -400 -7.96535 0.262
NP_441349.1_10 Reverse -140 -159 -9.24366 0.287
NP_441409.1_6 Forward -165 -146 10.2259 0.024
NP_441409.1_6 Reverse -320 -339 -14.2585 0.253
NP_442843.1_1 Reverse -318 -337 -7.4737 0.248
NP_442843.1_1 Reverse -212 -231 -11.6036 0.291
NP_439960.1_6 Forward -265 -246 7.27595 0.283
NP_442944.1_6 Forward -205 -191 18.0581 0.28
NP_440396.1_10 Reverse -318 -334 10.7759 0.219
NP_442450.1_5 Reverse -148 -158 9.32148 0.115
NP_442450.1_5 Forward -161 -151 9.32148 0.115
NP_440588.1_2 Forward -344 -325 -1.86883 0.157
NP_439950.1_1 Reverse -377 -386 16.0277 0.145
NP_439950.1_1 Reverse -189 -198 14.5527 0.212
NP_440195.1_4 Reverse -138 -157 12.6841 0.127
NP_441570.1_1 Forward -159 -141 -0.0791831 0.0433
NP_441570.1_1 Forward -335 -317 -5.48739 0.0756
NP_441078.1_4 Forward -159 -150 19.6659 0.0007
NP_441078.1_4 Reverse -150 -159 19.6659 0.0007
NP_441078.1_4 Reverse -326 -335 0.0980582 0.205
NP_441078.1_4 Forward -335 -326 0.0980582 0.205
NP_441078.1_4 Reverse -391 -400 -1.77023 0.266
NP_441078.1_4 Forward -400 -391 -1.77023 0.266
NP_442729.1_8 Forward -163 -150 19.1938 0.0312
NP_442729.1_8 Reverse -146 -159 8.47575 0.125
NP_442348.1_2 Forward -170 -161 7.76787 0.28
NP_440707.1_7 Forward -333 -314 9.0459 0.207
NP_442443.1_1 Forward -377 -358 -6.98204 0.299
NP_440526.1_3 Forward -158 -147 10.1862 0.0646
NP_440526.1_3 Reverse -151 -162 0.943182 0.267
NP_441432.1_8 Reverse -149 -158 16.8143 0.00595
NP_441432.1_8 Forward -160 -151 16.8143 0.00595
NP_441432.1_8 Reverse -143 -152 5.3096 0.17
NP_441432.1_8 Reverse -70 -79 5.11294 0.187
NP_442320.1_8 Reverse -144 -158 14.2576 0.0136
NP_442320.1_8 Forward -165 -151 5.60446 0.0334
NP_441732.1_2 Reverse -146 -162 -6.82463 0.0533
NP_441732.1_2 Forward -163 -147 -16.8544 0.207
NP_440760.1_1 Reverse -150 -169 -11.7019 0.0878
NP_440760.1_1 Forward -159 -140 -21.6334 0.24
NP_440199.1_10 Reverse -147 -157 16.7946 0.0381
NP_440199.1_10 Forward -162 -152 7.64985 0.231
NP_440199.1_10 Reverse -204 -214 6.76487 0.269
NP_442353.1_4 Reverse -311 -330 4.12856 0.206
NP_442353.1_4 Reverse -144 -163 3.24359 0.22
NP_440713.1_4 Reverse -140 -159 5.30933 0.212
NP_442489.1_2 Forward -164 -145 7.96426 0.172
NP_442489.1_2 Reverse -139 -158 2.75272 0.256
NP_442489.1_7 Forward -159 -150 20.1576 0.000695
NP_442489.1_7 Reverse -150 -159 20.1576 0.000695
NP_442489.1_7 Reverse -326 -335 0.786375 0.152
NP_442489.1_7 Forward -335 -326 0.589713 0.17
NP_442489.1_7 Reverse -391 -400 -1.27858 0.185
NP_442079.1_7 Reverse -151 -170 12.4875 0.084
NP_440559.1_1 Forward -158 -149 17.4043 0.00658
NP_440559.1_1 Reverse -151 -160 17.4043 0.00658
NP_440559.1_1 Reverse -327 -336 5.50626 0.14
NP_442763.1_10 Reverse -41 -60 5.89931 0.26
NP_441659.2_8 Forward -159 -149 18.1713 0.00133
NP_441659.2_8 Reverse -150 -160 18.1713 0.00133
NP_441659.2_8 Forward -400 -390 3.32329 0.164
NP_440363.1_9 Reverse -355 -373 12.2122 0.291
NP_442913.1_10 Forward -89 -70 -0.688862 0.162
NP_442849.1_1 Forward -286 -272 18.9775 0.123
NP_441800.1_7 Forward -378 -360 5.72234 0.177
NP_441800.1_7 Forward -189 -171 -2.24246 0.259
NP_442346.1_5 Forward -160 -150 16.6963 0.00248
NP_442346.1_5 Reverse -149 -159 16.6963 0.00248
NP_442346.1_5 Reverse -70 -80 8.73149 0.128
NP_440545.1_3 Forward -191 -174 -7.13932 0.298
NP_441856.1_3 Reverse -147 -166 7.57094 0.102
NP_441856.1_3 Reverse -323 -342 4.81767 0.146
NP_440459.1_10 Forward -142 -123 15.1424 0.196
NP_442603.1_7 Reverse -150 -164 17.8952 0.0187
NP_441585.1_5 Reverse -38 -57 5.60352 0.211
NP_441888.1_8 Reverse -293 -312 10.9142 0.28
NP_441047.1_2 Reverse -145 -164 -2.85214 0.281
NP_441358.1_2 Reverse -374 -393 9.14423 0.246
NP_441833.1_4 Forward -158 -151 15.9687 0.0124
NP_441833.1_4 Reverse -151 -158 15.9687 0.0124
NP_441833.1_4 Reverse -327 -334 14.1004 0.0258
NP_441833.1_4 Forward -334 -327 6.13563 0.198
NP_441895.1_10 Reverse -194 -213 -18.9784 0.282
NP_442162.1_9 Forward -158 -151 16.2637 0.0124
NP_442162.1_9 Reverse -151 -158 16.2637 0.0124
NP_442162.1_9 Reverse -327 -334 6.62729 0.142
NP_442162.1_9 Forward -334 -327 6.52896 0.178
NP_443015.1_2 Reverse -240 -259 11.6025 0.182
NP_440671.1_4 Reverse -144 -158 17.9942 0.0156
NP_442140.1_3 Forward -334 -324 8.63316 0.119
NP_442140.1_3 Reverse -327 -337 4.79825 0.238
NP_442140.1_3 Forward -158 -148 4.40493 0.243
NP_442140.1_3 Reverse -151 -161 4.40493 0.243
NP_442723.1_1 Reverse -274 -293 3.9319 0.276
NP_441671.1_10 Reverse -173 -192 4.52268 0.219
NP_440875.1_9 Reverse -328 -338 17.327 0.0126
NP_441813.1_5 Reverse -148 -158 15.9097 0.01
NP_441813.1_5 Forward -161 -151 15.9097 0.01
NP_441813.1_5 Forward -337 -327 9.61647 0.027
NP_441813.1_5 Reverse -324 -334 7.64985 0.068
NP_440590.1_4 Forward -158 -145 12.409 0.0141
NP_440590.1_4 Reverse -151 -164 3.06754 0.0772
NP_440590.1_4 Reverse -327 -340 2.87088 0.0788
NP_440567.1_1 Forward -158 -144 6.3911 0.0837
NP_440567.1_1 Reverse -151 -165 5.21113 0.105
NP_442497.1_10 Forward -158 -149 10.4228 0.0087
NP_442497.1_10 Reverse -151 -160 10.4228 0.0087
NP_442497.1_10 Reverse -327 -336 0.688044 0.141
NP_440821.1_4 Reverse -148 -158 18.2696 0.00448
NP_440821.1_4 Forward -161 -151 18.2696 0.00448
NP_440821.1_4 Reverse -324 -334 6.96153 0.0781
NP_440821.1_4 Forward -337 -327 0.373358 0.18
NP_441239.1_9 Reverse -324 -336 6.33216 0.193
NP_441239.1_9 Reverse -148 -160 4.36554 0.253
NP_441239.1_9 Forward -161 -149 4.36554 0.253
NP_441239.1_9 Forward -384 -372 2.98891 0.3
NP_441951.1_9 Forward -377 -358 5.40766 0.254
NP_441727.1_3 Reverse -143 -162 7.37428 0.226
NP_441892.1_1 Reverse -141 -158 2.59545 0.14
NP_442193.1_1 Reverse -379 -397 17.8171 0.113
NP_442193.1_8 Forward -162 -143 11.3067 0.267
NP_442270.1_9 Reverse -139 -158 -5.9004 0.207
NP_440219.1_1 Reverse -87 -106 15.0377 0.186
NP_441508.1_1 Forward -108 -89 10.3654 0.295
NP_442643.1_5 Forward -52 -33 -4.6221 0.293
NP_441017.1_6 Reverse -146 -160 18.0918 0.0376
NP_441017.1_6 Reverse -140 -154 16.3219 0.0681
NP_440833.1_6 Forward -308 -294 14.3553 0.157
NP_442216.1_4 Forward -386 -378 8.1805 0.255
NP_440354.1_7 Forward -341 -323 11.1305 0.224
NP_442138.1_9 Reverse -33 -52 13.175 0.202
NP_440546.1_4 Forward -335 -325 11.0156 0.0991
NP_440546.1_4 Forward -159 -149 10.046 0.109
NP_440546.1_4 Reverse -150 -160 10.046 0.109
NP_440462.1_4 Forward -45 -31 10.9143 0.214
NP_440462.1_6 Reverse -148 -158 7.74818 0.0699
NP_440462.1_6 Forward -161 -151 7.74818 0.0699
NP_440462.1_6 Forward -337 -327 7.64985 0.0705
NP_440462.1_6 Reverse -324 -334 4.89658 0.18
NP_440868.1_4 Reverse -322 -334 12.3303 0.0242
NP_440868.1_4 Forward -339 -327 9.97041 0.0405
NP_440868.1_4 Forward -163 -151 8.10212 0.0602
NP_440868.1_4 Reverse -146 -158 -0.846001 0.282
NP_441084.1_6 Reverse -37 -51 11.4772 0.201
NP_440696.1_3 Forward -310 -292 -0.472507 0.243
NP_440696.1_3 Forward -48 -30 -2.43913 0.274
NP_440696.1_6 Reverse -167 -186 6.58763 0.266
NP_442358.1_1 Forward -167 -149 18.407 0.0915
NP_442358.1_1 Forward -343 -325 16.4404 0.154
NP_442039.1_4 Forward -158 -151 15.1821 0.0124
NP_442039.1_4 Reverse -151 -158 15.1821 0.0124
NP_442039.1_7 Reverse -366 -376 7.35486 0.277
NP_441811.1_8 Reverse -144 -158 6.09611 0.287
NP_442696.1_6 Reverse -156 -175 -5.31042 0.197
NP_442837.1_3 Forward -158 -151 15.7721 0.0124
NP_442837.1_3 Reverse -151 -158 15.7721 0.0124
NP_442837.1_3 Reverse -327 -334 6.13563 0.25
NP_442837.1_3 Forward -334 -327 5.93897 0.265
NP_442053.1_1 Forward -159 -150 18.3876 0.0007
NP_442053.1_1 Reverse -150 -159 18.3876 0.0007
NP_442053.1_1 Forward -335 -326 7.76787 0.0895
NP_442053.1_1 Reverse -326 -335 7.17789 0.104
NP_440505.1_3 Reverse -148 -158 16.303 0.00696
NP_440505.1_3 Forward -161 -151 16.303 0.00696
NP_440505.1_3 Forward -337 -327 14.6313 0.019
NP_440505.1_7 Reverse -360 -379 -0.4922 0.271
NP_441102.1_1 Forward -158 -139 5.11266 0.256
NP_441203.1_1 Reverse -151 -170 -13.9635 0.174
NP_440013.1_2 Reverse -143 -157 12.3893 0.294
NP_442532.1_7 Forward -335 -321 2.65453 0.231
NP_440914.1_1 Forward -159 -149 17.5935 0.000537
NP_440914.1_1 Reverse -150 -160 17.5935 0.000537
NP_440914.1_1 Reverse -144 -154 11.9332 0.0746
NP_441011.1_8 Forward -158 -149 8.25953 0.144
NP_441011.1_8 Reverse -151 -160 8.25953 0.144
NP_441011.1_8 Reverse -327 -336 7.17789 0.179
NP_441011.1_8 Forward -334 -325 5.60459 0.247
NP_442101.1_10 Forward -167 -148 -10.0303 0.255
NP_442533.1_1 Reverse -172 -191 -2.45882 0.14
NP_442533.1_6 Forward -159 -150 17.2076 0.00137
NP_442533.1_6 Reverse -150 -159 17.2076 0.00137
NP_442533.1_6 Forward -400 -391 7.47288 0.0898
NP_442533.1_6 Reverse -391 -400 3.83464 0.202
NP_442322.1_4 Forward -375 -358 -0.453507 0.219
NP_441482.1_7 Reverse -144 -158 10.226 0.0135
NP_441482.1_7 Forward -165 -151 -11.1118 0.237
NP_439944.1_9 Forward -158 -148 19.0562 0.00329
NP_439944.1_9 Reverse -151 -161 19.0562 0.00329
NP_440116.1_8 Forward -158 -139 7.96426 0.0405
NP_440116.1_8 Reverse -151 -170 -5.70374 0.194
NP_440116.1_8 Forward -152 -133 -8.55534 0.254
NP_441527.1_4 Forward -27 -8 -7.40105 0.232
NP_441527.1_4 Forward -135 -116 -7.974 0.24
NP_440115.1_6 Forward -338 -328 7.64985 0.146
NP_440007.1_9 Reverse -146 -160 10.3243 0.163
NP_439965.1_1 Reverse -317 -336 -9.24366 0.284
NP_441680.1_4 Reverse -321 -340 0.196116 0.246
NP_440608.1_6 Reverse -151 -170 9.34008 0.238
NP_442673.1_5 Reverse -131 -149 13.5888 0.272
NP_441972.1_5 Forward -158 -139 -5.21209 0.215
NP_441106.1_1 Forward -160 -151 9.63616 0.0311
NP_441106.1_1 Reverse -149 -158 9.63616 0.0311
NP_441106.1_1 Forward -336 -327 8.35786 0.0585
NP_441106.1_1 Reverse -325 -334 5.70292 0.131
NP_440429.1_2 Forward -158 -139 12.0942 0.218
NP_440429.1_2 Reverse -359 -378 10.6192 0.267
NP_439903.1_6 Forward -162 -143 12.0933 0.0872
NP_441286.1_1 Forward -160 -148 21.3768 0.00196
NP_441286.1_1 Reverse -149 -161 21.3768 0.00196
NP_441286.1_1 Forward -336 -324 1.41561 0.0865
NP_442674.1_3 Reverse -142 -161 7.76679 0.213
NP_440670.1_8 Forward -159 -150 18.3876 0.000699
NP_440670.1_8 Reverse -150 -159 18.3876 0.000699
NP_440670.1_8 Reverse -326 -335 6.8829 0.0907
NP_440886.1_7 Forward -336 -326 12.5659 0.0805
NP_440886.1_7 Reverse -325 -335 8.53436 0.0805
NP_440886.1_7 Forward -160 -150 7.94438 0.0805
NP_440886.1_7 Reverse -149 -159 7.94438 0.0805
NP_440886.1_7 Forward -380 -370 6.0761 0.147
NP_442614.1_2 Reverse -150 -164 9.14437 0.242
NP_440404.1_9 Forward -125 -106 10.3605 0.209
NP_442072.1_9 Forward -160 -142 -14.0422 0.129
NP_442213.1_5 Forward -49 -30 6.19431 0.212
NP_441808.1_8 Forward -328 -309 10.0292 0.242
NP_442022.1_4 Reverse -379 -398 7.17762 0.268
NP_442022.1_4 Forward -328 -309 5.40766 0.286
NP_442264.1_2 Forward -163 -146 19.6067 0.0534
NP_442264.1_2 Reverse -140 -157 9.18362 0.199
NP_442264.1_2 Reverse -134 -151 6.62702 0.251
NP_441021.1_1 Forward -158 -139 -2.75381 0.145
NP_441463.1_3 Reverse -140 -159 -0.787193 0.133
NP_441463.1_3 Forward -163 -144 -4.91709 0.217
NP_441463.1_3 Forward -157 -138 -5.50708 0.229
NP_441463.1_6 Reverse -148 -162 14.3399 0.165
NP_441463.1_6 Reverse -142 -156 12.6005 0.224
NP_441463.1_6 Forward -161 -147 7.96207 0.25
NP_441626.1_2 Forward -158 -151 15.7721 0.0124
NP_441626.1_2 Reverse -151 -158 15.7721 0.0124
NP_441626.1_2 Forward -334 -327 6.0373 0.212
NP_441626.1_2 Reverse -327 -334 6.0373 0.212
NP_442211.1_3 Reverse -138 -157 10.1954 0.257
NP_442365.1_7 Reverse -152 -171 -2.45882 0.2
NP_442365.1_7 Forward -163 -144 -4.42544 0.245
NP_442238.1_3 Reverse -353 -372 7.7676 0.197
NP_440107.1_5 Forward -160 -141 0.294447 0.178
NP_440107.1_5 Reverse -357 -376 -0.295539 0.178
NP_442794.1_1 Reverse -146 -158 10.1671 0.0721
NP_442794.1_1 Forward -163 -151 7.02048 0.152
NP_442615.1_1 Reverse -141 -159 -1.35749 0.128
NP_442615.1_1 Forward -168 -150 -3.81576 0.17
NP_442615.1_1 Forward -344 -326 -6.76569 0.26
NP_441962.1_4 Reverse -145 -164 0.58944 0.111
NP_440387.1_1 Reverse -150 -166 4.48343 0.0417
NP_440387.1_1 Forward -159 -143 3.99177 0.0487
NP_440387.1_1 Forward -335 -319 -6.62797 0.298
NP_441836.1_2 Forward -165 -146 -4.91709 0.268
NP_441993.1_1 Reverse -364 -383 7.79413 0.16
NP_441993.1_1 Forward -159 -140 2.53143 0.257
NP_442323.1_7 Forward -394 -375 4.32522 0.217
NP_441510.2_7 Reverse -138 -152 9.73373 0.281
NP_441552.1_3 Reverse -143 -162 14.2566 0.235
NP_440293.1_3 Forward -50 -31 6.39097 0.192
NP_440293.1_3 Forward -334 -315 -4.91709 0.268
NP_440293.1_9 Forward -43 -29 9.79811 0.285
NP_440766.1_4 Reverse -146 -160 8.25939 0.0871
NP_441531.1_6 Forward -338 -325 10.7374 0.254
NP_442103.1_6 Forward -182 -168 18.0088 0.277
NP_439910.1_2 Forward -167 -150 -12.7442 0.0944
NP_439910.1_2 Reverse -142 -159 -13.7275 0.162
NP_442867.1_8 Reverse -41 -60 5.89931 0.273
NP_440457.1_1 Reverse -146 -158 7.02048 0.105
NP_440457.1_1 Forward -360 -348 2.49725 0.21
NP_440457.1_1 Forward -163 -151 -0.0593532 0.25
NP_440798.1_2 Reverse -280 -294 17.9935 0.191
NP_441801.1_4 Forward -385 -375 3.12662 0.231
NP_441984.1_3 Forward -383 -365 6.41066 0.269
NP_441332.1_6 Reverse -306 -316 12.9053 0.201
NP_442509.1_6 Reverse -176 -195 9.0459 0.294
NP_442509.1_9 Reverse -326 -336 12.3692 0.0947
NP_442509.1_9 Forward -159 -149 8.14104 0.192
NP_442509.1_9 Reverse -150 -160 8.14104 0.192
NP_442784.1_8 Reverse -29 -48 17.5015 0.214
NP_440554.1_4 Forward -158 -148 7.05986 0.106
NP_440554.1_4 Reverse -151 -161 7.05986 0.106
NP_440554.1_4 Reverse -327 -337 6.96153 0.107
NP_441885.1_5 Forward -159 -149 20.9245 0.000538
NP_441885.1_5 Reverse -150 -160 20.9245 0.000538
NP_441885.1_5 Forward -400 -390 -0.118297 0.186
NP_442310.1_1 Reverse -356 -375 12.0942 0.244
NP_442341.1_7 Forward -160 -146 18.0925 0.0111
NP_442341.1_7 Reverse -149 -163 13.6676 0.0334
NP_442341.1_7 Reverse -316 -330 4.22782 0.198
NP_442341.1_9 Forward -161 -147 7.07881 0.204
NP_443000.1_7 Forward -161 -151 17.0896 0.00865
NP_443000.1_7 Reverse -148 -158 17.0896 0.00865
NP_443000.1_7 Forward -337 -327 1.74999 0.229
NP_440507.2_3 Reverse -141 -160 10.2251 0.208
NP_440507.2_3 Forward -162 -143 9.7334 0.216
NP_441842.1_10 Reverse -143 -157 8.16106 0.233
NP_440275.1_3 Forward -161 -151 8.1415 0.0602
NP_440275.1_3 Reverse -148 -158 8.1415 0.0602
NP_440275.1_3 Forward -337 -327 5.78156 0.131
NP_440091.1_1 Reverse -146 -158 8.88877 0.0567
NP_440091.1_1 Reverse -249 -261 -0.256015 0.273
NP_440091.1_1 Reverse -322 -334 -0.452677 0.273
NP_440091.1_1 Forward -163 -151 -0.452677 0.273
NP_441307.1_4 Forward -57 -38 1.37609 0.236
NP_440679.1_10 Forward -323 -304 -3.14714 0.136
NP_443010.1_10 Reverse -147 -164 2.48089 0.275
NP_441190.1_2 Forward -385 -366 9.24257 0.17
NP_439962.1_4 Forward -186 -167 -3.63879 0.256
NP_440175.1_4 Forward -328 -309 -12.5869 0.235
NP_440149.1_8 Forward -159 -140 11.1109 0.0437
NP_441105.1_3 Reverse -139 -158 9.73422 0.0455
NP_441105.1_3 Forward -164 -145 0.196116 0.129
NP_440216.1_1 Forward -159 -145 -9.73518 0.145
NP_440216.1_1 Reverse -150 -164 -10.6202 0.145
NP_440216.1_1 Reverse -326 -340 -11.6035 0.203
NP_440216.1_9 Forward -218 -209 6.39124 0.289
NP_440172.1_1 Forward -159 -149 15.0247 0.00945
NP_440172.1_1 Reverse -150 -160 15.0247 0.00945
NP_440172.1_1 Reverse -71 -81 3.91327 0.213
NP_442015.1_10 Reverse -146 -159 10.344 0.0391
NP_442015.1_10 Forward -163 -150 0.412608 0.227
NP_442015.1_10 Forward -339 -326 -0.964025 0.289
NP_441226.1_7 Forward -158 -151 14.4934 0.0123
NP_441226.1_7 Reverse -151 -158 14.4934 0.0123
NP_441111.1_7 Forward -158 -150 18.7023 0.00294
NP_441111.1_7 Reverse -151 -159 18.7023 0.00294
NP_441111.1_7 Reverse -327 -335 8.96754 0.0463
NP_441766.1_2 Forward -159 -150 17.5026 0.00297
NP_441766.1_2 Reverse -150 -159 17.5026 0.00297
NP_441766.1_2 Reverse -326 -335 8.65285 0.0495
NP_441766.1_2 Forward -379 -370 1.96635 0.265
NP_442969.1_4 Reverse -186 -205 4.12936 0.295
NP_442252.1_4 Reverse -172 -191 11.9958 0.298
NP_440416.1_9 Forward -154 -135 -7.27704 0.0988
NP_440416.1_9 Reverse -143 -162 -14.6519 0.179
NP_443052.1_8 Forward -169 -150 -12.1936 0.249
NP_443052.1_9 Forward -185 -166 4.81767 0.149
NP_443052.1_9 Forward -380 -361 -5.80207 0.274
NP_443052.1_9 Forward -191 -172 -7.17871 0.294
NP_442403.1_9 Forward -338 -319 6.88262 0.193
NP_442154.1_1 Reverse -356 -374 -12.9605 0.217
NP_441430.1_2 Forward -195 -176 8.84924 0.0512
NP_440261.1_5 Reverse -327 -340 4.64084 0.0544
NP_440261.1_5 Reverse -151 -164 -2.83231 0.0932
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGCCACCCCCAAACTAAATCCCCCGGCCGCCAAAGCTAGCCCCGTGCGGTAGAGAATTACTTCCCGGCGATCGTGGTCATTGACGGTGAAGGGGCCAAATTGCCCTTGGTAGGTGGGGTTAACAGAGGTACTTTCTCGCATAATCGTTGCTCCAGAATCAGCACAGTTCAGACCATTTTCAGCCATGGATAACCATTAATCCTAATTATCCCAGGCCTCCCCCTCCATCAGGGGATTTTATGGCGATCGCCATTGCTATTGGTACCAAAACAAGGATAGAATCTATGCAATCTAAAACTTAAATTACATAACTAAAGGTAAATGATTGCCAAACTATTATTCGGGCCTGATTGGTCTGGGTTTGTGCTGGTCTAAACGAATAAATAAGGAGGAGCGGGCC

CDS

ATGGTCGCCCTAGAGGCTTGTATTTTTGTGACTGTGATCATCGGCTTTTTAGGTCTGATTTATAAATCTAATGTGTTTATGAAAATCATTGCCATGGACGTGATGGGCACTGGAGTCATTGCCTACTATTGCCTGATCGCTTCCCGCACTGGCTTTCTTACTCCTATTGTCACTAGCCAGGAATCCACCATTCCCTATGCCGATCCCGTTCCCCAAGCAGTTATCCTCACAGCCATTGTGATTGGTCTATCGATTCAGGCGTTGATGTTGGTGGCCACCATGAAACTGGCCCGGGAAAATCCCACCCTAGAAGTAAAGGCGATTGAAAAACAGTACTGGCCATGA

Protein

MVALEACIFVTVIIGFLGLIYKSNVFMKIIAMDVMGTGVIAYYCLIASRTGFLTPIVTSQESTIPYADPVPQAVILTAIVIGLSIQALMLVATMKLARENPTLEVKAIEKQYWP