Your browser is old and dusty. Try Google Chrome!

Details for slr2003

ORF slr2003
Accession NP_441211.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -324 -338 14.7492 0.0392
NP_441061.1_2 Forward -337 -323 1.96621 0.179
NP_441061.1_2 Forward -331 -317 -0.787057 0.239
NP_440795.1_7 Forward -331 -324 14.6904 0.0123
NP_440795.1_7 Reverse -324 -331 14.6904 0.0123
NP_441418.1_6 Forward -332 -313 -9.73531 0.0291
NP_441418.1_6 Reverse -323 -342 -29.1065 0.216
NP_442291.1_5 Reverse -322 -338 1.92682 0.136
NP_442272.1_2 Forward -169 -150 9.7875 0.281
NP_441453.1_1 Reverse -316 -334 7.78652 0.21
NP_441453.1_4 Reverse -323 -331 16.539 0.00633
NP_441453.1_4 Forward -332 -324 16.539 0.00633
NP_441453.1_4 Reverse -392 -400 4.05099 0.268
NP_442151.1_6 Reverse -323 -337 9.04604 0.159
NP_440561.1_1 Forward -83 -64 8.25844 0.298
NP_441818.1_1 Reverse -324 -335 9.79292 0.232
NP_441818.1_9 Forward -356 -337 -8.752 0.281
NP_440226.1_1 Forward -332 -313 2.65439 0.256
NP_440150.1_6 Forward -335 -316 9.93088 0.178
NP_442173.1_1 Forward -331 -323 15.4574 0.00633
NP_442173.1_1 Reverse -324 -332 15.4574 0.00633
NP_442752.1_4 Forward -332 -325 13.8055 0.0199
NP_442752.1_4 Reverse -323 -330 13.8055 0.0199
NP_443027.1_4 Forward -334 -324 11.0914 0.107
NP_443027.1_4 Reverse -321 -331 5.87989 0.294
NP_439997.1_4 Forward -304 -285 6.29264 0.266
NP_441812.1_3 Forward -333 -319 6.88276 0.287
NP_442975.1_10 Reverse -319 -333 2.94893 0.266
NP_441225.1_4 Forward -336 -317 -2.65548 0.239
NP_440784.1_7 Forward -331 -324 15.9687 0.0123
NP_440784.1_7 Reverse -324 -331 15.9687 0.0123
NP_440061.1_9 Reverse -321 -335 18.7801 0.00768
NP_440061.1_9 Reverse -85 -99 8.16044 0.18
NP_440061.1_9 Reverse -331 -345 5.60385 0.279
NP_441054.1_2 Forward -394 -375 9.14423 0.299
NP_441476.1_5 Reverse -318 -337 -4.91709 0.259
NP_439979.1_2 Forward -245 -226 8.06259 0.258
NP_442062.1_8 Forward -332 -322 19.4496 0.000558
NP_442062.1_8 Reverse -323 -333 17.3846 0.00193
NP_440761.1_4 Forward -119 -100 -14.4552 0.263
NP_441900.1_2 Reverse -107 -125 -2.63651 0.279
NP_441859.1_3 Forward -333 -314 3.04693 0.25
NP_440304.1_4 Forward -340 -330 4.79825 0.246
NP_440304.1_4 Forward -334 -324 1.84832 0.299
NP_440304.1_4 Reverse -321 -331 1.84832 0.299
NP_442242.1_4 Forward -331 -324 14.3954 0.0124
NP_442242.1_4 Reverse -324 -331 14.3954 0.0124
NP_439918.1_2 Forward -114 -95 5.60432 0.154
NP_439918.1_2 Forward -362 -343 -1.27885 0.24
NP_441200.1_4 Forward -245 -226 8.16093 0.257
NP_441200.1_4 Reverse -280 -299 5.89931 0.291
NP_441594.1_6 Forward -341 -322 6.4893 0.189
NP_440132.1_1 Forward -334 -316 8.18062 0.28
NP_442110.1_7 Reverse -323 -337 10.3243 0.0684
NP_441925.1_4 Reverse -331 -350 -0.984623 0.155
NP_441925.1_4 Reverse -329 -348 -11.0143 0.244
NP_441925.1_4 Reverse -332 -351 -13.3743 0.257
NP_440856.1_4 Reverse -327 -346 0.294447 0.167
NP_441083.1_5 Reverse -323 -333 20.3345 0.00053
NP_441083.1_5 Forward -332 -322 11.3864 0.0159
NP_441738.1_2 Forward -330 -323 15.28 0.0102
NP_441738.1_2 Reverse -325 -332 15.28 0.0102
NP_441738.1_2 Reverse -379 -386 8.29857 0.176
NP_441558.1_5 Forward -334 -315 10.1275 0.105
NP_440209.1_1 Reverse -323 -331 18.1123 0.00295
NP_440209.1_1 Forward -332 -324 18.1123 0.00295
NP_442136.1_4 Forward -330 -311 5.2102 0.295
NP_440870.1_4 Forward -344 -326 2.77242 0.177
NP_442889.1_8 Reverse -320 -334 3.93223 0.27
NP_440447.1_1 Forward -337 -319 6.01734 0.194
NP_441713.1_1 Reverse -317 -336 -14.4552 0.259
NP_441770.1_4 Forward -392 -373 -5.50708 0.212
NP_440178.1_7 Reverse -322 -341 -21.3384 0.218
NP_442462.1_2 Forward -233 -214 11.3075 0.172
NP_441716.1_1 Reverse -323 -337 10.6193 0.0936
NP_441716.1_1 Forward -338 -324 9.04604 0.127
NP_442111.1_4 Forward -333 -319 10.3243 0.0545
NP_442111.1_4 Reverse -322 -336 5.21113 0.172
NP_441624.1_7 Reverse -99 -113 7.07942 0.27
NP_440906.1_5 Forward -331 -324 15.8704 0.0124
NP_440906.1_5 Reverse -324 -331 15.8704 0.0124
NP_440747.1_10 Forward -335 -323 26.5883 0.000317
NP_440747.1_10 Reverse -320 -332 15.1819 0.00196
NP_441486.1_1 Forward -335 -321 5.1128 0.0391
NP_441486.1_1 Reverse -320 -334 4.91614 0.0399
NP_442634.1_4 Forward -334 -320 -1.27871 0.149
NP_441265.1_3 Reverse -386 -400 3.24451 0.181
NP_441014.1_10 Forward -29 -10 2.75194 0.216
NP_442848.1_1 Forward -338 -324 -1.5737 0.263
NP_443018.1_3 Forward -331 -324 14.8871 0.0123
NP_443018.1_3 Reverse -324 -331 14.8871 0.0123
NP_443018.1_3 Forward -71 -64 8.49558 0.141
NP_441634.1_8 Forward -334 -320 6.58777 0.114
NP_440376.1_1 Forward -332 -323 19.4693 0.000692
NP_440376.1_1 Reverse -323 -332 19.4693 0.000692
NP_441588.1_4 Forward -330 -320 7.35486 0.178
NP_443065.1_6 Reverse -319 -338 1.86774 0.229
NP_442687.1_7 Reverse -322 -332 15.8113 0.0125
NP_442687.1_7 Forward -363 -353 9.7148 0.0994
NP_442687.1_7 Forward -333 -323 8.92815 0.0994
NP_442191.1_4 Forward -188 -174 12.0596 0.232
NP_442485.1_3 Forward -343 -324 2.26107 0.215
NP_442485.1_3 Forward -334 -315 -4.03212 0.277
NP_441846.1_10 Forward -241 -222 -22.5183 0.261
NP_441511.1_2 Forward -105 -86 11.7992 0.156
NP_441422.1_7 Reverse -321 -338 7.11867 0.0992
NP_440533.1_9 Reverse -323 -342 7.07928 0.189
NP_440667.1_9 Forward -400 -381 16.4207 0.248
NP_441950.1_7 Forward -344 -325 -9.14533 0.293
NP_442720.1_8 Reverse -245 -263 15.8504 0.297
NP_442658.1_1 Reverse -321 -331 15.9091 0.00966
NP_442658.1_1 Forward -334 -324 7.94438 0.199
NP_442782.1_2 Reverse -323 -337 2.2612 0.275
NP_440656.1_8 Forward -83 -64 -6.58872 0.245
NP_442544.1_2 Reverse -253 -267 -2.06536 0.297
NP_441414.1_9 Forward -332 -313 5.30933 0.048
NP_441487.1_9 Reverse -281 -300 -1.37718 0.278
NP_441487.1_9 Reverse -322 -341 -3.04881 0.298
NP_442937.1_5 Forward -337 -318 11.7008 0.132
NP_442937.1_5 Forward -355 -336 8.84924 0.209
NP_442937.1_5 Forward -107 -88 8.84924 0.209
NP_441958.1_5 Forward -333 -323 12.2714 0.00183
NP_441958.1_5 Reverse -322 -332 12.2714 0.00183
NP_441127.1_1 Forward -338 -324 7.86607 0.3
NP_440203.1_5 Reverse -380 -390 10.4026 0.225
NP_440984.1_7 Reverse -318 -332 9.34103 0.127
NP_439990.1_5 Forward -337 -324 13.884 0.0889
NP_442911.1_2 Forward -342 -323 6.39097 0.0289
NP_442911.1_2 Reverse -313 -332 -3.3438 0.111
NP_440153.1_5 Reverse -324 -338 1.67122 0.245
NP_440153.1_8 Reverse -329 -342 -2.34066 0.235
NP_441941.1_9 Forward -367 -348 0.294447 0.268
NP_442119.1_6 Reverse -321 -340 5.50599 0.25
NP_442064.1_4 Reverse -319 -338 4.32522 0.29
NP_442536.1_7 Forward -338 -319 7.57094 0.273
NP_440934.1_2 Forward -194 -175 0.491109 0.295
NP_441913.1_3 Reverse -148 -161 17.3458 0.218
NP_441099.1_5 Forward -342 -323 8.94757 0.0333
NP_441099.1_5 Reverse -313 -332 -11.2103 0.273
NP_442002.1_9 Reverse -322 -329 10.7572 0.185
NP_442438.1_10 Forward -337 -323 10.0294 0.0581
NP_442431.1_10 Forward -111 -93 -0.374176 0.287
NP_441000.1_6 Reverse -322 -336 -3.93365 0.225
NP_440484.1_3 Forward -334 -320 10.4227 0.242
NP_440147.1_4 Reverse -321 -334 20.2755 0.00228
NP_440147.1_4 Forward -334 -321 7.49244 0.0678
NP_441550.1_8 Forward -334 -324 15.1225 0.0132
NP_441550.1_8 Reverse -321 -331 8.3377 0.124
NP_441550.1_8 Reverse -390 -400 5.48612 0.247
NP_441916.1_7 Forward -332 -322 18.4663 0.00144
NP_441916.1_7 Reverse -323 -333 10.3048 0.0261
NP_441916.1_10 Forward -340 -321 8.06259 0.176
NP_440206.1_4 Forward -342 -323 5.70185 0.242
NP_440465.1_10 Forward -335 -316 -1.08219 0.29
NP_441041.1_4 Forward -332 -313 1.76941 0.0792
NP_441041.1_4 Reverse -323 -342 -0.4922 0.0958
NP_441041.1_4 Forward -344 -325 -12.1936 0.26
NP_441041.1_7 Reverse -320 -332 15.6777 0.0222
NP_441041.1_7 Forward -335 -323 7.51478 0.162
NP_442396.1_5 Reverse -83 -96 10.5407 0.109
NP_442396.1_5 Reverse -319 -332 9.36073 0.13
NP_441547.1_2 Forward -343 -325 3.06741 0.291
NP_442004.1_6 Reverse -323 -337 9.2427 0.14
NP_441725.1_4 Forward -337 -323 12.6836 0.0693
NP_441725.1_5 Forward -331 -321 2.04498 0.115
NP_441725.1_5 Reverse -324 -334 2.04498 0.115
NP_439966.1_7 Forward -334 -324 15.3192 0.0152
NP_439966.1_7 Reverse -321 -331 9.91099 0.0968
NP_439966.1_9 Reverse -177 -186 4.42462 0.253
NP_439966.1_9 Reverse -321 -330 0.884706 0.253
NP_439966.1_9 Forward -325 -316 0.589713 0.272
NP_440736.1_10 Reverse -328 -346 12.2122 0.293
NP_442941.1_3 Reverse -324 -334 19.2529 0.00262
NP_442941.1_3 Forward -331 -321 2.63497 0.14
NP_440289.1_1 Reverse -91 -108 16.321 0.291
NP_440289.1_2 Reverse -320 -333 3.06754 0.0811
NP_440289.1_2 Forward -335 -322 -3.61896 0.267
NP_440289.1_4 Forward -100 -81 22.2223 0.0433
NP_440983.1_5 Reverse -336 -355 -2.26216 0.231
NP_440983.1_5 Reverse -323 -342 -6.09707 0.276
NP_440983.1_9 Forward -341 -322 1.0811 0.292
NP_440260.1_8 Forward -341 -323 4.44404 0.154
NP_441678.1_9 Forward -362 -343 -3.83545 0.288
NP_442281.1_1 Reverse -318 -332 20.5501 0.00192
NP_442281.1_1 Forward -337 -323 15.2402 0.0132
NP_001035871.2_7 Forward -111 -101 12.6647 0.262
NP_441164.1_4 Reverse -55 -74 20.3531 0.0283
NP_442012.1_1 Reverse -317 -336 6.98095 0.117
NP_441556.1_10 Forward -337 -323 13.2393 0.182
NP_440498.1_1 Reverse -314 -332 16.5388 0.0213
NP_442068.1_4 Reverse -330 -349 5.60352 0.251
NP_440453.1_2 Forward -352 -338 17.1092 0.1
NP_441644.1_6 Reverse -323 -333 17.3841 0.00127
NP_441644.1_6 Forward -332 -322 10.1076 0.0628
NP_441644.1_6 Reverse -329 -339 3.51951 0.277
NP_442215.1_2 Reverse -321 -337 6.84337 0.0702
NP_442215.1_2 Forward -334 -318 -4.1697 0.228
NP_442029.1_10 Reverse -71 -90 5.01433 0.29
NP_440929.1_8 Forward -332 -323 19.2726 0.000701
NP_440929.1_8 Reverse -323 -332 19.2726 0.000701
NP_442933.1_10 Forward -332 -323 17.601 0.00325
NP_442933.1_10 Reverse -323 -332 17.601 0.00325
NP_441751.2_8 Reverse -324 -338 14.9459 0.0119
NP_441751.2_8 Forward -331 -317 -1.77037 0.13
NP_441751.2_8 Reverse -64 -78 -4.4253 0.173
NP_442926.1_1 Forward -344 -325 -6.1954 0.278
NP_442554.1_8 Reverse -324 -334 16.2046 0.0065
NP_442554.1_8 Forward -331 -321 13.2547 0.0187
NP_442554.1_8 Reverse -330 -340 7.55152 0.0893
NP_442970.1_1 Reverse -148 -162 11.1842 0.269
NP_441762.1_7 Forward -333 -321 10.1671 0.0142
NP_441762.1_7 Reverse -322 -334 2.39892 0.0676
NP_442142.1_4 Forward -335 -322 16.0466 0.0264
NP_442142.1_4 Reverse -320 -333 13.8833 0.0324
NP_442142.1_4 Reverse -326 -339 6.90188 0.153
NP_442292.1_1 Reverse -324 -333 18.486 0.00229
NP_442292.1_1 Forward -331 -322 9.63616 0.0183
NP_442476.1_6 Forward -331 -317 11.7993 0.0543
NP_442476.1_6 Reverse -324 -338 0.687908 0.247
NP_440895.1_6 Forward -338 -325 17.6205 0.0643
NP_442381.1_8 Reverse -320 -339 -15.1435 0.298
NP_443009.1_5 Forward -333 -322 18.3477 0.00265
NP_443009.1_5 Forward -189 -178 4.77807 0.23
NP_441741.1_6 Forward -36 -17 8.94757 0.249
NP_441715.1_4 Reverse -324 -334 17.3846 0.0106
NP_441715.1_4 Forward -331 -321 9.41981 0.097
NP_440379.1_5 Forward -341 -322 -10.227 0.276
NP_441468.1_1 Forward -331 -324 15.8704 0.0124
NP_441468.1_1 Reverse -324 -331 15.8704 0.0124
NP_441015.1_10 Forward -337 -318 -4.52377 0.205
NP_441015.1_10 Forward -343 -324 -10.9153 0.289
NP_441673.1_1 Forward -332 -323 20.8459 0.000698
NP_441673.1_1 Reverse -323 -332 20.8459 0.000698
NP_441956.1_9 Forward -339 -320 17.7974 0.166
NP_441826.1_2 Forward -338 -324 6.88276 0.0899
NP_441330.1_1 Forward -337 -318 -14.2585 0.216
NP_442490.1_9 Reverse -323 -342 -6.58872 0.273
NP_441764.1_8 Reverse -22 -32 11.1193 0.287
NP_442868.1_6 Forward -334 -324 19.2529 0.00563
NP_442868.1_6 Reverse -321 -331 0.865012 0.205
NP_442719.1_2 Reverse -368 -386 15.948 0.0429
NP_442719.1_2 Reverse -147 -165 0.411736 0.162
NP_442719.1_2 Reverse -369 -387 -2.43985 0.186
NP_441056.1_1 Reverse -323 -342 14.1591 0.0381
NP_441612.1_2 Reverse -87 -97 10.5824 0.21
NP_441612.1_2 Forward -229 -219 9.71104 0.21
NP_441612.1_2 Reverse -323 -333 8.54929 0.21
NP_441612.1_2 Forward -78 -68 7.29072 0.256
NP_442808.1_1 Reverse -322 -332 18.4657 0.00201
NP_442808.1_1 Reverse -98 -108 9.616 0.0481
NP_442808.1_1 Forward -333 -323 8.63269 0.0481
NP_442808.1_1 Forward -52 -42 1.84789 0.281
NP_441101.1_10 Forward -336 -317 1.47442 0.173
NP_441101.1_10 Reverse -330 -349 -5.31042 0.281
NP_440145.1_3 Forward -342 -323 12.6841 0.0277
NP_442542.1_2 Reverse -321 -334 9.36073 0.135
NP_442050.1_5 Forward -334 -324 14.3359 0.0206
NP_442342.1_7 Reverse -184 -203 17.6299 0.177
NP_441114.1_3 Reverse -70 -79 6.5879 0.262
NP_440558.1_2 Forward -341 -322 15.9291 0.0626
NP_440558.1_2 Reverse -326 -345 -2.45882 0.227
NP_440111.2_2 Forward -184 -165 3.93269 0.195
NP_441518.1_3 Reverse -346 -365 -9.63698 0.225
NP_441878.1_6 Forward -333 -323 10.4031 0.0176
NP_441878.1_6 Reverse -322 -332 10.4031 0.0176
NP_441878.1_6 Forward -339 -329 0.0783647 0.152
NP_441878.1_10 Reverse -152 -166 11.406 0.289
NP_441036.1_8 Reverse -322 -332 17.7779 0.000554
NP_441036.1_8 Forward -333 -323 8.33817 0.174
NP_442650.1_2 Reverse -323 -337 9.2427 0.13
NP_441557.1_5 Forward -332 -323 19.9609 0.000699
NP_441557.1_5 Reverse -323 -332 19.9609 0.000699
NP_441557.1_8 Reverse -227 -237 10.9926 0.269
NP_441445.1_1 Forward -341 -322 0.786102 0.269
NP_441445.1_1 Reverse -314 -333 -0.688862 0.3
NP_441590.1_4 Reverse -330 -349 3.44025 0.29
NP_442419.1_2 Forward -337 -318 0.491109 0.242
NP_440101.1_3 Reverse -318 -337 16.3224 0.0505
NP_442830.1_5 Reverse -178 -192 5.50552 0.233
NP_442183.1_1 Forward -332 -318 11.7993 0.0675
NP_442183.1_1 Reverse -323 -337 5.21113 0.226
NP_442183.1_1 Forward -72 -58 3.8345 0.295
NP_441116.1_9 Forward -165 -151 14.0609 0.231
NP_441116.1_9 Forward -201 -187 12.4876 0.252
NP_441819.1_5 Forward -165 -146 10.8379 0.261
NP_442347.1_2 Reverse -324 -333 12.4878 0.056
NP_442347.1_2 Forward -331 -322 11.1111 0.056
NP_442347.1_2 Forward -95 -86 7.07956 0.134
NP_442645.1_2 Forward -340 -321 23.2056 0.00106
NP_441037.1_4 Reverse -321 -331 14.7245 0.028
NP_441633.1_3 Forward -334 -321 10.8357 0.0286
NP_441633.1_3 Reverse -321 -334 3.46087 0.0699
NP_440136.1_2 Forward -331 -324 15.9687 0.0123
NP_440136.1_2 Reverse -324 -331 15.9687 0.0123
NP_442998.1_5 Forward -300 -290 14.238 0.151
NP_442998.1_10 Forward -330 -323 15.5754 0.0102
NP_442998.1_10 Reverse -325 -332 15.5754 0.0102
NP_440299.1_1 Forward -336 -323 20.2748 0.00128
NP_440299.1_1 Reverse -319 -332 10.4418 0.0573
NP_441799.1_1 Reverse -319 -333 16.4202 0.0151
NP_441799.1_1 Forward -336 -322 9.14375 0.0988
NP_441007.1_5 Forward -331 -312 10.1275 0.225
NP_441007.1_10 Reverse -318 -331 1.59258 0.203
NP_441007.1_10 Forward -337 -324 1.29759 0.203
NP_442334.1_2 Forward -342 -325 -5.76269 0.214
NP_442201.1_10 Forward -343 -324 -14.0619 0.28
NP_440256.1_1 Forward -335 -316 1.67108 0.0729
NP_440256.1_1 Forward -112 -93 -7.96535 0.248
NP_442961.1_4 Forward -30 -11 11.6025 0.118
NP_440087.1_1 Forward -341 -322 0.786102 0.167
NP_441559.1_8 Reverse -175 -189 6.09611 0.0814
NP_441559.1_8 Forward -337 -323 3.04785 0.143
NP_441559.1_8 Forward -287 -273 0.196253 0.169
NP_441559.1_8 Reverse -328 -342 -4.7203 0.236
NP_441559.1_8 Forward -194 -180 -5.90027 0.271
NP_441559.1_8 Reverse -318 -332 -7.08024 0.283
NP_440915.1_6 Forward -336 -322 10.6193 0.0301
NP_442855.1_3 Forward -244 -225 12.6841 0.237
NP_442855.1_3 Forward -111 -92 12.5858 0.237
NP_442866.1_1 Forward -367 -348 -2.85214 0.216
NP_440695.1_5 Reverse -323 -342 6.68596 0.15
NP_441199.1_6 Reverse -319 -338 1.37609 0.22
NP_441494.1_6 Forward -15 -2 9.55739 0.227
NP_439985.1_7 Forward -344 -325 8.84924 0.18
NP_442957.1_8 Forward -359 -340 12.5858 0.287
NP_440677.1_1 Reverse -314 -333 16.2241 0.1
NP_442386.1_9 Reverse -322 -331 15.7322 0.0144
NP_442386.1_9 Forward -333 -324 13.8639 0.0289
NP_440570.1_5 Forward -88 -69 -2.36049 0.278
NP_441340.1_5 Forward -331 -324 15.6737 0.0124
NP_441340.1_5 Reverse -324 -331 15.6737 0.0124
NP_441340.1_5 Forward -400 -393 3.97235 0.274
NP_441340.1_9 Reverse -23 -33 7.29115 0.289
NP_441947.1_10 Reverse -321 -339 0.412472 0.276
NP_442791.1_10 Forward -339 -320 15.5357 0.299
NP_440168.1_8 Reverse -317 -336 3.14605 0.246
NP_440168.1_9 Forward -334 -315 -2.45882 0.28
NP_440161.1_3 Forward -334 -315 13.5691 0.136
NP_440586.1_1 Forward -348 -329 3.6377 0.202
NP_440586.1_8 Forward -331 -324 13.2151 0.026
NP_440586.1_8 Reverse -324 -331 13.2151 0.026
NP_442251.1_6 Forward -331 -324 15.2804 0.0124
NP_442251.1_6 Reverse -324 -331 15.2804 0.0124
NP_442251.1_6 Reverse -309 -316 8.20058 0.23
NP_440684.1_9 Reverse -317 -331 10.0294 0.209
NP_441262.1_3 Reverse -323 -330 14.7888 0.0223
NP_441262.1_3 Forward -332 -325 14.7888 0.0223
NP_440027.1_3 Reverse -329 -347 11.1298 0.159
NP_440027.1_3 Forward -189 -171 4.24662 0.262
NP_440027.1_3 Reverse -323 -341 2.57501 0.289
NP_440027.1_8 Reverse -320 -339 13.0766 0.19
NP_443051.1_1 Reverse -322 -331 10.4228 0.00754
NP_443051.1_1 Forward -333 -324 10.4228 0.00754
NP_439937.1_9 Reverse -178 -195 -12.4498 0.272
NP_439937.1_9 Reverse -331 -348 -13.1381 0.28
NP_440626.1_1 Forward -331 -312 9.7334 0.256
NP_440439.1_1 Forward -335 -322 9.16406 0.0465
NP_440439.1_1 Reverse -320 -333 1.39592 0.156
NP_439943.1_1 Reverse -69 -88 -6.98204 0.237
NP_440372.1_2 Forward -331 -324 16.3621 0.0124
NP_440372.1_2 Reverse -324 -331 16.3621 0.0124
NP_440316.1_10 Forward -394 -384 17.188 0.153
NP_440316.1_10 Forward -339 -329 16.6963 0.153
NP_441803.1_2 Reverse -318 -337 2.75272 0.204
NP_439977.1_5 Reverse -317 -336 -2.26216 0.273
NP_441572.1_7 Forward -338 -319 -1.47551 0.188
NP_441572.1_7 Reverse -317 -336 -4.03212 0.224
NP_442384.1_10 Reverse -323 -336 20.8655 0.00194
NP_442384.1_10 Forward -332 -319 13.884 0.018
NP_442384.1_10 Forward -96 -83 1.10092 0.268
NP_442384.1_10 Reverse -353 -366 0.707601 0.282
NP_441877.1_7 Reverse -318 -337 4.91521 0.218
NP_441018.1_7 Reverse -319 -338 13.0775 0.142
NP_442790.1_4 Forward -341 -322 -15.5368 0.294
NP_442262.1_10 Forward -331 -324 14.1988 0.0123
NP_442262.1_10 Reverse -324 -331 14.1988 0.0123
NP_442262.1_10 Reverse -393 -400 9.47889 0.187
NP_442262.1_10 Forward -71 -64 8.59391 0.22
NP_441689.1_5 Forward -334 -324 5.78111 0.197
NP_440344.1_10 Reverse -316 -333 7.512 0.0133
NP_440531.1_6 Reverse -315 -334 2.65439 0.152
NP_441060.1_1 Forward -386 -367 13.4473 0.294
NP_442910.1_1 Reverse -316 -335 -2.45882 0.254
NP_440189.1_10 Reverse -213 -232 4.62101 0.279
NP_441965.1_3 Forward -342 -323 6.68596 0.149
NP_441965.1_10 Forward -335 -319 11.1699 0.107
NP_440297.1_9 Forward -331 -321 -0.118297 0.282
NP_440297.1_9 Reverse -324 -334 -0.118297 0.282
NP_441592.1_4 Forward -338 -319 0.982764 0.225
NP_441592.1_4 Reverse -323 -342 -1.08219 0.247
NP_440999.1_9 Reverse -319 -333 10.0294 0.0558
NP_440999.1_9 Forward -336 -322 1.08123 0.171
NP_440888.1_2 Reverse -323 -337 16.0269 0.00832
NP_442147.1_7 Forward -350 -331 11.1109 0.235
NP_440491.1_1 Reverse -320 -339 6.42973 0.296
NP_442948.1_2 Forward -333 -314 5.01433 0.256
NP_442033.1_10 Reverse -321 -340 -8.85033 0.207
NP_440575.1_1 Reverse -212 -231 0.490334 0.29
NP_441543.1_2 Forward -331 -322 18.486 0.00236
NP_441543.1_2 Reverse -324 -333 16.9127 0.00359
NP_442845.1_2 Forward -338 -324 9.43936 0.174
NP_442845.1_2 Forward -344 -330 9.04604 0.182
NP_442845.1_2 Reverse -323 -337 6.98109 0.199
NP_442845.1_2 Reverse -317 -331 3.73617 0.279
NP_441178.1_6 Reverse -374 -393 2.35861 0.27
NP_441469.1_8 Reverse -322 -331 16.126 0.00797
NP_441469.1_8 Forward -333 -324 6.48957 0.227
NP_443064.1_6 Reverse -323 -333 12.5669 0.0796
NP_443064.1_6 Reverse -87 -97 8.30077 0.3
NP_442578.1_7 Forward -331 -324 14.5921 0.026
NP_442578.1_7 Reverse -324 -331 14.5921 0.026
NP_441462.1_2 Forward -332 -322 11.5831 0.00406
NP_441462.1_2 Reverse -323 -333 11.5831 0.00406
NP_441462.1_5 Forward -242 -223 8.55425 0.213
NP_441621.1_7 Reverse -321 -335 -3.24533 0.188
NP_441621.1_7 Forward -334 -320 -3.34366 0.188
NP_442736.1_3 Reverse -264 -283 14.6508 0.246
NP_443062.1_1 Reverse -323 -341 14.2013 0.051
NP_443062.1_1 Forward -332 -314 8.05839 0.16
NP_443062.1_6 Reverse -315 -334 8.65258 0.14
NP_440939.1_5 Forward -239 -223 10.4816 0.273
NP_442204.1_1 Forward -336 -325 11.5634 0.0565
NP_440544.1_5 Forward -29 -22 13.8024 0.28
NP_440516.1_2 Reverse -317 -335 11.8189 0.0708
NP_440516.1_8 Forward -332 -323 16.9127 0.00442
NP_440516.1_8 Reverse -323 -332 16.9127 0.00442
NP_442428.1_5 Forward -331 -324 15.8704 0.0124
NP_442428.1_5 Reverse -324 -331 15.8704 0.0124
NP_441443.1_1 Reverse -18 -37 -1.08219 0.239
NP_440603.1_9 Reverse -324 -343 4.52268 0.278
NP_440673.1_3 Forward -330 -323 12.4288 0.0426
NP_440673.1_3 Reverse -325 -332 12.4288 0.0426
NP_440673.1_3 Forward -8 -1 8.29892 0.221
NP_441052.1_2 Reverse -323 -333 19.9412 0.00106
NP_441052.1_2 Forward -332 -322 10.5014 0.0285
NP_442219.1_9 Reverse -324 -333 17.7976 0.00718
NP_442219.1_9 Forward -331 -322 8.35786 0.0681
NP_440436.1_4 Forward -331 -322 18.1905 0.00233
NP_440436.1_4 Reverse -324 -333 17.2072 0.00233
NP_442864.1_2 Reverse -324 -343 14.4541 0.224
NP_440314.1_9 Reverse -324 -343 -0.295539 0.106
NP_440648.1_3 Reverse -63 -81 19.4887 0.144
NP_442907.1_9 Reverse -88 -107 0.392778 0.207
NP_441719.1_4 Forward -331 -324 16.3621 0.0124
NP_441719.1_4 Reverse -324 -331 16.3621 0.0124
NP_441733.1_9 Reverse -349 -363 19.2725 0.193
NP_441733.1_10 Forward -335 -322 7.39411 0.153
NP_441004.1_1 Forward -338 -319 -11.8986 0.243
NP_442366.1_3 Reverse -322 -340 5.32902 0.0878
NP_442366.1_5 Reverse -320 -330 11.9759 0.148
NP_442873.1_3 Reverse -313 -332 5.70185 0.248
NP_442694.1_4 Forward -385 -376 11.7011 0.277
NP_442206.1_10 Forward -332 -317 12.7629 0.0802
NP_442206.1_10 Forward -179 -164 0.668214 0.25
NP_442854.1_6 Reverse -323 -342 14.7491 0.143
NP_440328.1_4 Forward -338 -319 8.25926 0.114
NP_441228.1_8 Reverse -318 -337 9.0459 0.278
NP_443054.1_2 Forward -334 -320 9.04604 0.102
NP_441851.1_10 Reverse -322 -332 16.008 0.00552
NP_441851.1_10 Forward -333 -323 15.8113 0.00552
NP_441851.1_10 Reverse -86 -96 4.0116 0.291
NP_442814.1_6 Reverse -318 -337 13.6675 0.253
NP_441542.1_4 Reverse -371 -385 3.14618 0.291
NP_441501.1_9 Reverse -231 -250 15.0432 0.253
NP_442856.1_7 Forward -341 -322 8.06259 0.106
NP_441668.1_4 Forward -342 -323 -0.000545616 0.248
NP_442515.1_1 Forward -333 -319 -2.55701 0.277
NP_440593.1_3 Forward -149 -130 0.196116 0.196
NP_441982.1_6 Forward -379 -370 14.3952 0.274
NP_440165.1_5 Reverse -322 -341 -7.96535 0.286
NP_442709.1_3 Forward -339 -320 7.07928 0.137
NP_440940.1_2 Reverse -376 -395 16.7157 0.221
NP_441349.1_10 Forward -342 -323 1.57275 0.0827
NP_441409.1_6 Reverse -317 -336 -5.31042 0.102
NP_442314.1_6 Reverse -326 -345 13.0775 0.184
NP_442843.1_1 Forward -305 -286 8.94757 0.116
NP_442843.1_1 Forward -392 -373 -9.63698 0.267
NP_439960.1_10 Forward -339 -321 5.32902 0.152
NP_441124.1_5 Forward -378 -368 10.6209 0.286
NP_442450.1_5 Reverse -321 -331 7.55152 0.13
NP_440588.1_2 Forward -341 -322 -1.57384 0.155
NP_440588.1_2 Reverse -314 -333 -2.55715 0.167
NP_440943.1_5 Forward -40 -26 17.3058 0.218
NP_441570.1_1 Forward -362 -344 -10.2073 0.163
NP_441570.1_1 Reverse -323 -341 -10.6006 0.174
NP_441570.1_1 Forward -332 -314 -14.6322 0.226
NP_441570.1_1 Forward -338 -320 -16.7954 0.254
NP_440078.1_10 Reverse -323 -342 10.0292 0.186
NP_441078.1_4 Forward -332 -323 19.6659 0.0007
NP_441078.1_4 Reverse -323 -332 19.6659 0.0007
NP_442729.1_5 Forward -394 -384 12.9597 0.235
NP_441663.1_8 Forward -338 -319 1.86774 0.209
NP_441663.1_8 Reverse -317 -336 -3.63879 0.294
NP_442348.1_2 Forward -386 -377 7.76787 0.28
NP_440707.1_9 Forward -392 -373 3.6377 0.267
NP_442443.1_1 Forward -104 -85 -4.13045 0.268
NP_440526.1_3 Reverse -324 -335 8.02298 0.126
NP_441432.1_8 Forward -333 -324 16.8143 0.00595
NP_441432.1_8 Reverse -322 -331 8.25953 0.0755
NP_442320.1_8 Forward -338 -324 -2.26202 0.0871
NP_442320.1_8 Reverse -317 -331 -2.65535 0.0926
NP_442344.1_7 Forward -331 -312 -7.17871 0.18
NP_442344.1_7 Forward -95 -76 -9.73531 0.266
NP_441732.1_2 Reverse -319 -335 -7.80794 0.0935
NP_441732.1_2 Forward -336 -320 -15.9694 0.164
NP_440760.1_1 Reverse -323 -342 5.30933 0.0131
NP_440760.1_1 Forward -332 -313 -21.535 0.238
NP_442797.1_7 Forward -238 -220 1.88744 0.248
NP_440131.1_4 Forward -339 -320 3.73603 0.275
NP_442489.1_7 Forward -332 -323 20.1576 0.000695
NP_442489.1_7 Reverse -323 -332 20.1576 0.000695
NP_442079.1_7 Forward -331 -312 1.86774 0.24
NP_440559.1_1 Reverse -324 -333 17.4043 0.00658
NP_440559.1_1 Forward -331 -322 8.75118 0.0586
NP_441659.2_8 Reverse -323 -333 18.1713 0.00133
NP_441659.2_8 Forward -332 -322 11.9764 0.0147
NP_441040.1_2 Forward -353 -334 -14.9469 0.286
NP_441040.1_5 Reverse -318 -337 9.14423 0.226
NP_442008.1_2 Reverse -320 -339 7.66927 0.207
NP_440708.1_6 Forward -26 -7 2.16274 0.179
NP_441800.1_3 Forward -337 -319 5.32902 0.286
NP_442346.1_5 Forward -333 -323 16.6963 0.00248
NP_442346.1_5 Reverse -322 -332 9.02648 0.118
NP_440545.1_3 Forward -336 -319 4.56207 0.0691
NP_440545.1_3 Reverse -319 -336 -2.22277 0.181
NP_440545.1_3 Forward -342 -325 -4.77938 0.232
NP_440831.1_3 Forward -341 -322 12.6001 0.139
NP_440486.1_6 Forward -345 -326 8.45592 0.242
NP_441126.1_8 Forward -341 -328 7.29578 0.291
NP_441653.1_2 Forward -343 -324 2.37001 0.294
NP_440010.1_4 Forward -342 -323 0.785326 0.243
NP_442137.1_1 Reverse -282 -301 6.29264 0.26
NP_442603.1_7 Reverse -323 -337 10.717 0.125
NP_441888.1_7 Forward -337 -323 3.8345 0.225
NP_441888.1_7 Reverse -318 -332 3.44117 0.225
NP_441948.1_4 Forward -195 -177 -3.81576 0.207
NP_441833.1_4 Forward -331 -324 15.9687 0.0124
NP_441833.1_4 Reverse -324 -331 15.9687 0.0124
NP_441329.1_3 Forward -380 -370 14.5211 0.253
NP_442060.1_9 Forward -358 -339 7.07928 0.271
NP_442162.1_9 Forward -331 -324 16.2637 0.0124
NP_442162.1_9 Reverse -324 -331 16.2637 0.0124
NP_440671.1_4 Forward -338 -324 12.586 0.105
NP_440224.1_4 Reverse -68 -87 2.75272 0.225
NP_442140.1_3 Forward -331 -321 16.2046 0.0255
NP_442140.1_3 Reverse -324 -334 10.3048 0.0902
NP_441671.1_1 Reverse -327 -346 1.17943 0.263
NP_441671.1_10 Forward -195 -176 7.96426 0.205
NP_440875.1_9 Reverse -331 -341 9.3454 0.233
NP_440875.1_9 Forward -330 -320 9.15072 0.233
NP_440875.1_9 Reverse -325 -335 8.37203 0.233
NP_441813.1_5 Forward -334 -324 18.1713 0.00743
NP_441813.1_5 Reverse -321 -331 9.91146 0.021
NP_442254.1_6 Forward -86 -67 15.8307 0.133
NP_439901.1_5 Forward -181 -162 5.11266 0.273
NP_440590.1_4 Reverse -324 -337 12.8023 0.013
NP_440590.1_4 Forward -331 -318 -5.19226 0.277
NP_440567.1_1 Forward -331 -317 13.8643 0.0196
NP_440567.1_1 Reverse -324 -338 6.88276 0.08
NP_442497.1_10 Forward -331 -322 10.4228 0.0087
NP_442497.1_10 Reverse -324 -333 10.4228 0.0087
NP_440821.1_4 Reverse -321 -331 10.2065 0.0163
NP_440821.1_4 Forward -334 -324 9.41981 0.0286
NP_441239.1_9 Reverse -321 -333 12.3303 0.0477
NP_441239.1_9 Forward -334 -322 7.80712 0.148
NP_441239.1_9 Reverse -382 -394 4.8572 0.239
NP_441239.1_9 Forward -340 -328 4.46387 0.253
NP_441951.1_9 Reverse -328 -347 -0.4922 0.279
NP_441892.1_1 Reverse -383 -400 -2.12444 0.218
NP_440665.1_1 Reverse -311 -330 -14.9469 0.264
NP_440604.1_6 Forward -362 -343 1.47442 0.159
NP_442193.1_1 Forward -114 -96 8.27895 0.272
NP_442643.1_1 Forward -368 -349 -6.09707 0.231
NP_441526.1_6 Forward -244 -225 4.42435 0.271
NP_440949.1_7 Forward -331 -312 12.88 0.209
NP_440354.1_7 Forward -399 -381 6.31233 0.284
NP_442138.1_10 Forward -362 -343 -5.50708 0.269
NP_442052.1_8 Forward -79 -69 14.238 0.253
NP_440546.1_4 Forward -332 -322 11.8882 0.0679
NP_440546.1_4 Reverse -323 -333 10.046 0.109
NP_440546.1_6 Forward -305 -286 8.25926 0.26
NP_441509.1_2 Forward -48 -30 6.31233 0.271
NP_440675.1_1 Forward -348 -329 4.42435 0.235
NP_440462.1_6 Forward -334 -324 9.61647 0.0429
NP_440462.1_6 Reverse -321 -331 9.02648 0.0498
NP_440868.1_4 Reverse -319 -331 17.7386 0.0124
NP_440868.1_4 Forward -336 -324 8.00379 0.0602
NP_442499.1_3 Reverse -322 -340 9.65558 0.252
NP_441879.1_6 Forward -129 -110 15.8307 0.202
NP_441868.1_4 Forward -369 -355 16.7159 0.258
NP_442402.1_4 Reverse -212 -231 -0.197979 0.189
NP_442402.1_4 Forward -36 -17 -8.55607 0.283
NP_442460.1_7 Forward -344 -325 -0.197208 0.283
NP_440696.1_3 Forward -348 -330 -4.01242 0.294
NP_442039.1_4 Forward -331 -324 15.1821 0.0124
NP_442039.1_4 Reverse -324 -331 15.1821 0.0124
NP_441811.1_8 Forward -102 -88 10.3243 0.22
NP_440825.1_7 Forward -331 -321 12.4217 0.155
NP_442837.1_3 Forward -331 -324 15.7721 0.0124
NP_442837.1_3 Reverse -324 -331 15.7721 0.0124
NP_440160.1_2 Forward -300 -281 -1.27885 0.235
NP_442053.1_1 Forward -332 -323 18.3876 0.0007
NP_442053.1_1 Reverse -323 -332 18.3876 0.0007
NP_440505.1_3 Forward -334 -324 18.3679 0.00213
NP_440505.1_3 Reverse -321 -331 6.76487 0.169
NP_440914.1_1 Reverse -323 -333 17.5935 0.000537
NP_440914.1_1 Forward -332 -322 8.6151 0.186
NP_441011.1_8 Forward -331 -322 16.9127 0.00602
NP_441011.1_8 Reverse -324 -333 8.25953 0.144
NP_441011.1_8 Forward -400 -391 6.48957 0.191
NP_442533.1_1 Forward -245 -226 -5.60541 0.155
NP_442533.1_6 Forward -332 -323 17.2076 0.00137
NP_442533.1_6 Reverse -323 -332 17.2076 0.00137
NP_442533.1_6 Reverse -329 -338 4.0313 0.194
NP_442533.1_6 Forward -179 -170 1.47469 0.298
NP_442541.1_10 Reverse -358 -372 1.08065 0.292
NP_442322.1_4 Reverse -224 -241 1.90642 0.21
NP_442322.1_4 Reverse -223 -240 -2.42012 0.231
NP_442322.1_4 Reverse -162 -179 -6.35334 0.275
NP_442229.1_1 Forward -334 -320 8.45543 0.184
NP_441482.1_7 Forward -338 -324 8.84938 0.0162
NP_441482.1_7 Reverse -317 -331 -10.8168 0.216
NP_439944.1_9 Reverse -324 -334 10.5014 0.0887
NP_442269.1_10 Forward -350 -331 3.34271 0.252
NP_441028.1_6 Reverse -109 -119 4.7978 0.277
NP_440116.1_5 Reverse -320 -337 3.87375 0.223
NP_441527.1_4 Reverse -14 -33 -5.49121 0.202
NP_440115.1_6 Forward -335 -325 16.008 0.0325
NP_441347.1_5 Forward -338 -324 9.04542 0.278
NP_441602.1_3 Forward -337 -318 -5.01543 0.277
NP_441972.1_5 Reverse -2 -21 1.76941 0.127
NP_441106.1_1 Reverse -322 -331 18.191 0.0028
NP_441106.1_1 Forward -333 -324 9.63616 0.0311
NP_439903.1_6 Forward -75 -56 6.68515 0.167
NP_439903.1_6 Reverse -102 -121 5.60352 0.178
NP_441286.1_1 Forward -333 -321 6.03717 0.0258
NP_441286.1_1 Reverse -322 -334 3.38223 0.0467
NP_440670.1_8 Forward -332 -323 18.3876 0.000699
NP_440670.1_8 Reverse -323 -332 18.3876 0.000699
NP_439955.1_10 Reverse -331 -350 12.1917 0.258
NP_440886.1_7 Reverse -322 -332 17.7774 0.0011
NP_440886.1_7 Forward -333 -323 7.94438 0.0805
NP_440886.1_7 Reverse -383 -393 5.48612 0.181
NP_442614.1_2 Reverse -87 -101 8.94771 0.242
NP_442614.1_2 Reverse -323 -337 8.06273 0.255
NP_442072.1_9 Reverse -322 -340 -22.2037 0.225
NP_440907.2_8 Forward -331 -321 14.2375 0.0312
NP_442264.1_5 Reverse -68 -82 18.7808 0.222
NP_441021.1_1 Reverse -324 -343 -5.31042 0.177
NP_441021.1_1 Forward -21 -2 -12.0953 0.279
NP_441463.1_3 Reverse -313 -332 0.491109 0.131
NP_441463.1_3 Forward -20 -1 -8.45701 0.27
NP_442842.1_10 Reverse -243 -262 -0.214107 0.28
NP_441626.1_2 Forward -331 -324 15.7721 0.0124
NP_441626.1_2 Reverse -324 -331 15.7721 0.0124
NP_442365.1_7 Reverse -325 -344 -3.73712 0.222
NP_440107.1_5 Reverse -322 -341 -2.36049 0.178
NP_442794.1_1 Forward -336 -324 20.0002 0.00523
NP_442794.1_1 Reverse -319 -331 2.59558 0.287
NP_442615.1_1 Reverse -314 -332 -1.55415 0.13
NP_442615.1_1 Forward -341 -323 -7.45401 0.291
NP_441962.1_4 Forward -337 -318 10.4225 0.0495
NP_440387.1_1 Reverse -323 -339 13.9232 0.00763
NP_440387.1_1 Forward -332 -316 4.77842 0.0388
NP_441431.1_2 Forward -335 -321 11.1104 0.146
NP_441431.1_2 Reverse -320 -334 7.66879 0.237
NP_441488.1_8 Forward -337 -323 10.0287 0.146
NP_441521.1_2 Reverse -224 -241 14.9844 0.296
NP_441836.1_1 Forward -343 -324 19.4862 0.0288
NP_441836.1_2 Reverse -317 -336 -0.000545616 0.209
NP_441993.1_1 Reverse -323 -342 4.38312 0.221
NP_442084.1_6 Forward -129 -111 8.7706 0.221
NP_442224.1_1 Reverse -321 -340 -3.04881 0.233
NP_441174.1_2 Forward -335 -321 13.7659 0.186
NP_442437.1_8 Forward -21 -2 3.04771 0.295
NP_440492.1_9 Reverse -22 -36 9.79232 0.294
NP_441510.2_7 Reverse -342 -356 13.4703 0.28
NP_441272.1_7 Forward -108 -98 15.0247 0.2
NP_440766.1_4 Forward -336 -322 8.75105 0.0871
NP_439988.1_7 Reverse -322 -336 11.7987 0.292
NP_441237.1_9 Forward -400 -390 12.1731 0.133
NP_442743.1_5 Forward -337 -318 2.55606 0.295
NP_439910.1_2 Reverse -315 -332 -21.9873 0.202
NP_440457.1_1 Forward -336 -324 7.61046 0.101
NP_442940.1_2 Reverse -220 -239 0.687771 0.296
NP_440798.1_6 Forward -400 -387 6.70579 0.14
NP_440798.1_6 Forward -331 -318 3.26421 0.151
NP_440801.1_8 Reverse -322 -341 -1.86883 0.283
NP_440142.1_7 Reverse -324 -343 10.0292 0.206
NP_440473.1_1 Forward -335 -316 12.7035 0.213
NP_442509.1_9 Forward -332 -322 16.2041 0.00739
NP_442509.1_9 Forward -188 -178 9.321 0.192
NP_442509.1_9 Forward -248 -238 8.3377 0.192
NP_442509.1_9 Reverse -323 -333 8.14104 0.192
NP_442509.1_9 Reverse -377 -387 6.96107 0.244
NP_441489.1_3 Forward -382 -368 16.2452 0.172
NP_440554.1_4 Reverse -324 -334 8.92815 0.0646
NP_440554.1_4 Forward -331 -321 7.35486 0.103
NP_442862.1_3 Forward -383 -366 7.70866 0.253
NP_442737.1_5 Forward -333 -314 11.3277 0.293
NP_441885.1_5 Reverse -323 -333 20.9245 0.000538
NP_441885.1_5 Forward -332 -322 11.4848 0.00668
NP_440478.1_10 Reverse -321 -335 17.7975 0.107
NP_442341.1_7 Forward -333 -319 14.0609 0.0326
NP_442341.1_7 Reverse -322 -336 9.2427 0.0751
NP_442341.1_9 Reverse -321 -335 9.34041 0.155
NP_442341.1_9 Forward -334 -320 4.52221 0.299
NP_441756.1_5 Reverse -173 -192 1.96607 0.213
NP_441756.1_5 Reverse -319 -338 1.37609 0.217
NP_441173.1_9 Reverse -32 -40 12.9004 0.206
NP_443000.1_7 Forward -334 -324 19.9412 0.00223
NP_443000.1_7 Reverse -321 -331 1.94665 0.226
NP_443000.1_7 Reverse -351 -361 1.65166 0.235
NP_440507.2_3 Forward -341 -322 7.07848 0.29
NP_440275.1_3 Forward -334 -324 15.123 0.0182
NP_440275.1_3 Reverse -321 -331 8.33817 0.0602
NP_441902.1_3 Forward -231 -221 15.9942 0.163
NP_442451.1_2 Forward -340 -321 -9.047 0.258
NP_439962.1_4 Forward -340 -321 -8.45701 0.294
NP_440149.1_8 Reverse -323 -342 -7.17871 0.275
NP_441105.1_3 Forward -343 -324 2.85105 0.097
NP_441105.1_3 Forward -21 -2 -1.08219 0.145
NP_440216.1_1 Reverse -323 -337 -0.590395 0.0284
NP_440216.1_1 Forward -332 -318 -2.16369 0.0482
NP_440172.1_1 Reverse -323 -333 15.0247 0.00945
NP_440172.1_1 Forward -332 -322 8.73149 0.0586
NP_442015.1_3 Reverse -337 -356 10.2251 0.296
NP_442015.1_10 Forward -336 -323 21.1604 0.00329
NP_442015.1_10 Reverse -319 -332 10.344 0.0391
NP_441226.1_7 Forward -331 -324 14.4934 0.0123
NP_441226.1_7 Reverse -324 -331 14.4934 0.0123
NP_441111.1_7 Forward -331 -323 18.7023 0.00294
NP_441111.1_7 Reverse -324 -332 18.7023 0.00294
NP_442379.1_10 Forward -339 -322 0.825489 0.223
NP_441766.1_2 Forward -332 -323 17.5026 0.00297
NP_441766.1_2 Reverse -323 -332 17.5026 0.00297
NP_442417.1_5 Forward -332 -318 9.63603 0.128
NP_442417.1_5 Forward -177 -163 5.80112 0.249
NP_440416.1_9 Forward -339 -320 0.58944 0.0513
NP_440416.1_9 Reverse -316 -335 -14.8485 0.18
NP_440416.1_9 Reverse -328 -347 -15.4385 0.191
NP_440591.1_9 Forward -339 -321 6.11567 0.228
NP_440261.1_5 Forward -331 -318 -0.964025 0.0655
NP_440261.1_5 Reverse -324 -337 -2.63565 0.0924
NP_440261.1_5 Forward -400 -387 -11.2888 0.255
NP_440988.1_10 Reverse -327 -341 4.51157 0.259
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCTATCGGGCCGTGGGGGATTTTGTCAAAAACTGGCACGGTCAACGCTTTGGTGTGGTGGGAGGCCCTGGCGATCGCCGAGATAGTGATCTAATTGAACTGGGACAAATTGCGGCCCAGGTATTTGACCGGATCATTGTCAAAGAAGATGATGATAAACGGGGCCGGAGTGGGGGAGAAACAGCGGATTTAATTGTTAAAGGCATTTTGCAGGAGAATCCCGGCGCGGCCTATGAGGTAATTTTGGACGAAACTGTAGCGTTGAATAAGGCTTTAGATCAGGTAGAGGAAAAGGGTTTGGTGGTAGTGTTCCCCGAAAGTGTGAGCAAAGCCATTGAGTTAATTAAAGCCCGTAAACCCATTGGTTAAAGGTTTTCTTCCCCCTTGCTGGAGTCATTGCT

CDS

ATGGACACCACCTACCAAAAAAGTAACCTTGCCTGGGAATTGCAACAGTTAACCCAAAATGGACGGGAATGGCTGGCTTGGCAGACCGATCGCCTGTGGCAGGGAGTGCCGCCGATACCAGGGCTGGACATTCCCAATTGGGAGTGGTGGGAAGAGTTAATTTTCCACGGCTTACTCTGGTTAATTATTGCCTTGGTGATCGCCGCTATTTGGTTTAACCGCAAAACTTGGCAGAGATATTGGCAGAATCTGAGCAACGTTGATCTCAATCCCCATTTTTCGCCCCCAAATCCCGGAGTTAACCATTGGCTCAAAGCTGCTCAGCAGGCCGCCCGCCAAGGAGATTATTACCAAGCCTGCCGATATTTGTACTTGGCCACGTTGCAAATGTTGCAGGAGCAAAGAGGTTTAGAACCGACACCGGGGAGAACTGACCGGGAATATCAACAGTTAACGGAACAATTTCCCCAGGCCGGCGCCTACGACACCATTTTCACCGTCCATCAGGAACTCTGTTTTGGCCAGCAACAGGCTTCCCTAGAGTTATTTGAAGATTGCCAAGGGGCGATCGCATCTTTGGAACGGGCTCCGAAAACAAGGACGGATCAGCGAAAATTTGCTGGGTCTTGA

Protein

MDTTYQKSNLAWELQQLTQNGREWLAWQTDRLWQGVPPIPGLDIPNWEWWEELIFHGLLWLIIALVIAAIWFNRKTWQRYWQNLSNVDLNPHFSPPNPGVNHWLKAAQQAARQGDYYQACRYLYLATLQMLQEQRGLEPTPGRTDREYQQLTEQFPQAGAYDTIFTVHQELCFGQQQASLELFEDCQGAIASLERAPKTRTDQRKFAGS