Your browser is old and dusty. Try Google Chrome!

Details for slr2000

ORF slr2000
Accession NP_441208.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -124 -138 3.8345 0.159
NP_440795.1_7 Forward -131 -124 14.6904 0.0123
NP_440795.1_7 Reverse -124 -131 14.6904 0.0123
NP_441418.1_6 Reverse -123 -142 -21.4367 0.149
NP_441418.1_6 Forward -132 -113 -29.1065 0.216
NP_441418.1_6 Reverse -207 -226 -30.1882 0.262
NP_442291.1_5 Forward -133 -117 -3.38305 0.239
NP_441453.1_4 Reverse -123 -131 16.539 0.00633
NP_441453.1_4 Forward -132 -124 16.539 0.00633
NP_441453.1_7 Reverse -319 -326 13.4121 0.23
NP_441453.1_7 Forward -310 -303 12.9205 0.23
NP_441623.1_1 Reverse -303 -321 7.09898 0.139
NP_441623.1_1 Reverse -302 -320 -3.81576 0.269
NP_441960.1_4 Forward -368 -352 11.0709 0.279
NP_442151.1_6 Reverse -123 -137 17.3058 0.0111
NP_442151.1_6 Forward -132 -118 7.17775 0.206
NP_441818.1_1 Forward -131 -120 9.59626 0.232
NP_441818.1_9 Reverse -9 -28 -3.83545 0.232
NP_440226.1_1 Forward -132 -113 9.3409 0.0734
NP_442173.1_1 Forward -131 -123 15.4574 0.00633
NP_442173.1_1 Reverse -124 -132 15.4574 0.00633
NP_442752.1_4 Forward -132 -125 13.8055 0.0199
NP_442752.1_4 Reverse -123 -130 13.8055 0.0199
NP_443027.1_4 Reverse -121 -131 16.2046 0.0437
NP_443027.1_4 Forward -134 -124 15.3197 0.0437
NP_442975.1_10 Forward -136 -122 19.9601 0.00259
NP_442975.1_10 Reverse -119 -133 12.8803 0.0459
NP_440784.1_7 Forward -131 -124 15.9687 0.0123
NP_440784.1_7 Reverse -124 -131 15.9687 0.0123
NP_441250.1_3 Reverse -34 -53 1.76941 0.284
NP_442118.1_3 Forward -266 -247 14.2756 0.276
NP_440061.1_9 Reverse -121 -135 11.9953 0.103
NP_441054.1_4 Reverse -113 -131 -2.83245 0.249
NP_441476.1_5 Forward -381 -362 2.75272 0.188
NP_442062.1_8 Reverse -123 -133 10.3048 0.0493
NP_442062.1_8 Forward -132 -122 10.3048 0.0493
NP_442062.1_8 Forward -376 -366 4.99491 0.188
NP_440761.1_4 Reverse -118 -137 -12.8819 0.257
NP_440761.1_4 Forward -137 -118 -12.9802 0.257
NP_440761.1_4 Forward -116 -97 -14.4552 0.263
NP_441859.1_3 Reverse -122 -141 4.42355 0.222
NP_440304.1_4 Reverse -121 -131 19.9412 0.00364
NP_440304.1_4 Forward -134 -124 18.9579 0.00406
NP_442242.1_4 Forward -131 -124 14.3954 0.0124
NP_442242.1_4 Reverse -124 -131 14.3954 0.0124
NP_440044.1_8 Forward -382 -363 2.45773 0.15
NP_441781.1_7 Forward -132 -113 10.8159 0.138
NP_441492.1_7 Forward -211 -192 13.0766 0.177
NP_440916.1_1 Forward -20 -6 7.9644 0.284
NP_439918.1_2 Reverse -70 -89 -3.93378 0.263
NP_441161.1_3 Reverse -117 -135 7.68896 0.289
NP_441200.1_4 Forward -327 -308 5.70265 0.294
NP_441619.1_8 Reverse -117 -131 7.47213 0.277
NP_441208.1_4 Forward -374 -355 20.944 0.207
NP_441208.1_9 Forward -135 -121 16.0275 0.0714
NP_441208.1_9 Reverse -120 -134 7.27608 0.223
NP_441594.1_6 Forward -141 -122 10.0292 0.134
NP_442110.1_7 Reverse -123 -137 10.1277 0.0684
NP_442110.1_7 Forward -132 -118 2.06454 0.222
NP_441491.1_6 Reverse -214 -228 14.8825 0.289
NP_441083.1_5 Forward -132 -122 11.2881 0.0159
NP_441083.1_5 Reverse -123 -133 11.2881 0.0159
NP_442827.1_8 Forward -140 -121 13.6666 0.0402
NP_442827.1_8 Reverse -115 -134 -0.29631 0.224
NP_441149.1_9 Forward -38 -19 3.63691 0.221
NP_441738.1_2 Forward -130 -123 15.28 0.0102
NP_441738.1_2 Reverse -125 -132 15.28 0.0102
NP_441558.1_5 Reverse -121 -140 17.109 0.0231
NP_441558.1_5 Forward -134 -115 13.5691 0.057
NP_441955.1_8 Forward -382 -365 9.38028 0.258
NP_440209.1_1 Reverse -123 -131 18.1123 0.00295
NP_440209.1_1 Forward -132 -124 18.1123 0.00295
NP_441713.1_1 Forward -138 -119 3.93269 0.0568
NP_441713.1_1 Reverse -117 -136 -14.4552 0.259
NP_440178.1_7 Forward -133 -114 -13.1769 0.129
NP_441716.1_1 Reverse -123 -137 13.3726 0.0689
NP_441716.1_1 Forward -132 -118 6.3911 0.198
NP_441327.1_5 Reverse -30 -39 14.356 0.192
NP_442111.1_3 Reverse -30 -43 14.672 0.226
NP_442111.1_4 Reverse -122 -136 17.2075 0.0109
NP_442111.1_4 Forward -133 -119 6.88276 0.11
NP_440906.1_5 Forward -131 -124 15.8704 0.0124
NP_440906.1_5 Reverse -124 -131 15.8704 0.0124
NP_441924.1_5 Reverse -70 -89 9.43923 0.258
NP_440747.1_10 Reverse -120 -132 -1.92764 0.0192
NP_440747.1_10 Forward -135 -123 -1.92764 0.0192
NP_441130.1_10 Reverse -121 -135 9.73436 0.12
NP_441486.1_1 Reverse -120 -134 -3.147 0.176
NP_441486.1_1 Forward -135 -121 -4.7203 0.205
NP_442145.1_3 Reverse -199 -218 11.5042 0.23
NP_440944.1_2 Forward -388 -369 0.58944 0.256
NP_442634.1_4 Forward -134 -120 14.9459 0.015
NP_442634.1_4 Reverse -121 -135 5.89945 0.051
NP_440403.1_4 Reverse -285 -304 -9.14533 0.269
NP_442848.1_1 Forward -138 -124 -1.77037 0.263
NP_442848.1_1 Reverse -117 -131 -4.13031 0.282
NP_442848.1_4 Reverse -74 -88 5.60446 0.288
NP_442848.1_5 Forward -334 -316 -3.02911 0.29
NP_443018.1_3 Forward -131 -124 14.8871 0.0123
NP_443018.1_3 Reverse -124 -131 14.8871 0.0123
NP_441316.1_7 Reverse -121 -136 4.89645 0.121
NP_441634.1_8 Reverse -121 -135 3.14618 0.155
NP_440376.1_1 Forward -132 -123 19.4693 0.000692
NP_440376.1_1 Reverse -123 -132 19.4693 0.000692
NP_440376.1_1 Reverse -323 -332 1.76968 0.242
NP_441588.1_4 Forward -130 -120 6.66654 0.185
NP_442687.1_7 Forward -133 -123 9.02648 0.0994
NP_442687.1_7 Reverse -122 -132 9.02648 0.0994
NP_442191.1_4 Forward -125 -111 11.7688 0.244
NP_442958.1_3 Forward -143 -124 -1.08219 0.27
NP_440642.1_10 Forward -38 -24 2.06395 0.284
NP_440642.1_10 Reverse -165 -179 1.5723 0.29
NP_442770.1_10 Forward -156 -142 17.7731 0.176
NP_441422.1_3 Forward -391 -372 14.903 0.256
NP_441422.1_7 Reverse -121 -138 -6.15601 0.248
NP_442296.1_5 Reverse -114 -133 2.94938 0.257
NP_441763.1_10 Reverse -112 -131 5.2102 0.294
NP_442658.1_1 Forward -134 -124 15.9091 0.00966
NP_442658.1_1 Reverse -121 -131 13.0576 0.04
NP_442658.1_1 Forward -334 -324 5.87944 0.246
NP_442205.1_9 Forward -138 -122 10.1866 0.0927
NP_442205.1_9 Reverse -117 -133 7.04003 0.109
NP_441414.1_9 Forward -132 -113 -5.21209 0.171
NP_439968.1_2 Forward -375 -356 11.8967 0.297
NP_441958.1_5 Forward -133 -123 21.2195 0.000805
NP_441958.1_5 Reverse -122 -132 21.2195 0.000805
NP_442836.1_5 Forward -138 -119 19.5673 0.023
NP_440203.1_5 Reverse -126 -136 11.8776 0.171
NP_439905.1_1 Reverse -124 -137 8.08242 0.238
NP_439990.1_5 Forward -137 -124 10.934 0.128
NP_439990.1_5 Reverse -118 -131 6.80412 0.221
NP_442911.1_2 Forward -142 -123 4.916 0.0361
NP_442911.1_2 Reverse -113 -132 -1.18052 0.082
NP_442911.1_2 Reverse -313 -332 -5.60541 0.163
NP_440153.1_5 Reverse -124 -138 14.0609 0.0551
NP_440153.1_5 Forward -131 -117 1.96621 0.241
NP_440993.1_2 Reverse -118 -134 10.0883 0.106
NP_440993.1_2 Forward -137 -121 3.20513 0.262
NP_440993.1_3 Forward -142 -123 4.62021 0.161
NP_441099.1_5 Reverse -113 -132 -1.18052 0.105
NP_441099.1_5 Forward -142 -123 -8.94866 0.209
NP_442002.1_9 Forward -333 -326 12.2322 0.185
NP_440809.1_2 Reverse -343 -362 -2.55715 0.275
NP_440809.1_9 Forward -141 -123 2.96908 0.118
NP_440809.1_9 Reverse -114 -132 -6.76569 0.225
NP_441294.1_7 Reverse -119 -133 12.8982 0.08
NP_441294.1_7 Forward -136 -122 11.2664 0.15
NP_441646.1_1 Forward -139 -120 1.67108 0.23
NP_442438.1_10 Forward -137 -123 2.06454 0.188
NP_442438.1_10 Reverse -118 -132 1.86788 0.188
NP_441000.1_6 Forward -133 -119 -4.4253 0.243
NP_440605.1_4 Forward -142 -123 18.813 0.0577
NP_440147.1_4 Reverse -121 -134 12.5073 0.0326
NP_440147.1_4 Forward -134 -121 3.06754 0.196
NP_440147.1_4 Forward -285 -272 1.9859 0.213
NP_441550.1_8 Forward -134 -124 17.4824 0.00754
NP_441550.1_8 Reverse -121 -131 13.0576 0.0273
NP_441550.1_8 Forward -385 -375 5.68278 0.236
NP_441916.1_7 Forward -132 -122 18.9579 0.00144
NP_441916.1_7 Reverse -123 -133 18.9579 0.00144
NP_441916.1_10 Reverse -115 -134 1.67108 0.262
NP_441041.1_4 Forward -132 -113 5.211 0.0531
NP_441041.1_7 Reverse -120 -132 9.65268 0.108
NP_441041.1_7 Forward -135 -123 8.97244 0.125
NP_441547.1_2 Reverse -112 -130 3.85406 0.264
NP_442004.1_6 Reverse -123 -137 7.07942 0.165
NP_441725.1_5 Forward -131 -121 11.1898 0.0247
NP_441725.1_5 Reverse -124 -134 8.92815 0.0553
NP_439966.1_7 Reverse -121 -131 14.8275 0.0177
NP_439966.1_7 Forward -134 -124 13.8442 0.0234
NP_439966.1_9 Forward -134 -125 0.983037 0.253
NP_442941.1_3 Forward -131 -121 19.9412 0.00262
NP_442941.1_3 Reverse -124 -134 10.9931 0.0116
NP_440289.1_2 Reverse -120 -133 6.60746 0.0591
NP_440289.1_2 Forward -135 -122 -4.50394 0.288
NP_441334.1_2 Reverse -18 -31 19.7838 0.268
NP_441334.1_7 Reverse -121 -140 -19.6667 0.275
NP_440437.1_1 Reverse -117 -136 7.47261 0.0647
NP_441457.1_7 Forward -134 -115 5.50599 0.186
NP_440498.1_1 Reverse -114 -132 0.904127 0.212
NP_440375.1_6 Forward -95 -76 11.4058 0.239
NP_441644.1_6 Forward -132 -122 19.0557 0.000803
NP_441644.1_6 Reverse -123 -133 19.0557 0.000803
NP_441644.1_6 Reverse -374 -384 4.40448 0.239
NP_440587.1_6 Forward -35 -16 14.3558 0.115
NP_442215.1_2 Forward -134 -118 -6.92296 0.281
NP_442029.1_6 Reverse -15 -34 3.53937 0.282
NP_440929.1_8 Forward -132 -123 19.2726 0.000701
NP_440929.1_8 Reverse -123 -132 19.2726 0.000701
NP_442933.1_10 Forward -132 -123 17.601 0.00325
NP_442933.1_10 Reverse -123 -132 17.601 0.00325
NP_440430.1_5 Forward -50 -31 11.3075 0.262
NP_441751.2_8 Forward -131 -117 23.304 0.00466
NP_441751.2_8 Reverse -124 -138 5.21113 0.0448
NP_442554.1_8 Reverse -124 -134 19.1546 0.00369
NP_442554.1_8 Forward -131 -121 16.9913 0.0065
NP_442554.1_8 Forward -382 -372 2.33998 0.274
NP_441762.1_7 Reverse -122 -134 2.69391 0.0676
NP_441762.1_7 Forward -133 -121 -6.84419 0.284
NP_442142.1_4 Reverse -120 -133 14.1783 0.0311
NP_442142.1_4 Forward -135 -122 4.34528 0.223
NP_442292.1_1 Forward -131 -122 17.5026 0.00435
NP_442292.1_1 Reverse -124 -133 17.5026 0.00435
NP_442292.1_5 Forward -136 -117 -0.688862 0.257
NP_443009.1_5 Reverse -122 -133 15.7911 0.0107
NP_443009.1_5 Forward -133 -122 15.7911 0.0107
NP_443009.1_5 Forward -333 -322 7.72798 0.122
NP_441715.1_4 Forward -131 -121 14.238 0.0295
NP_441715.1_4 Reverse -124 -134 7.25653 0.108
NP_441715.1_4 Reverse -285 -295 4.60159 0.261
NP_440015.1_9 Forward -132 -114 3.95239 0.164
NP_442076.1_5 Forward -389 -370 24.8772 0.0126
NP_440183.1_1 Forward -131 -112 6.39097 0.278
NP_441198.1_8 Forward -134 -124 15.4199 0.0427
NP_441198.1_8 Reverse -121 -131 13.2713 0.108
NP_440464.1_10 Forward -382 -372 13.1036 0.169
NP_441468.1_1 Forward -131 -124 15.8704 0.0124
NP_441468.1_1 Reverse -124 -131 15.8704 0.0124
NP_441673.1_1 Forward -132 -123 20.8459 0.000698
NP_441673.1_1 Reverse -123 -132 20.8459 0.000698
NP_441876.1_9 Forward -314 -304 12.3692 0.267
NP_441826.1_2 Forward -138 -124 5.30946 0.0977
NP_441826.1_2 Reverse -117 -131 5.1128 0.0978
NP_442868.1_6 Forward -134 -124 8.63316 0.0555
NP_442868.1_6 Reverse -121 -131 1.06167 0.205
NP_442427.1_3 Forward -137 -119 13.2938 0.0961
NP_442427.1_3 Reverse -374 -392 0.117479 0.275
NP_442808.1_1 Reverse -122 -132 8.73102 0.0481
NP_442808.1_1 Forward -133 -123 8.73102 0.0481
NP_442775.1_1 Forward -65 -46 11.1109 0.288
NP_442775.1_6 Reverse -43 -62 12.2908 0.277
NP_442542.1_2 Forward -305 -292 5.32916 0.272
NP_442542.1_2 Forward -134 -121 4.54251 0.3
NP_442050.1_5 Reverse -121 -131 18.0724 0.00365
NP_442050.1_5 Forward -134 -124 17.1874 0.00812
NP_442050.1_5 Reverse -101 -111 7.64939 0.243
NP_442342.1_9 Forward -134 -118 6.05672 0.227
NP_441878.1_6 Forward -133 -123 10.5014 0.0176
NP_441878.1_6 Reverse -122 -132 10.5014 0.0176
NP_441878.1_6 Forward -304 -294 -7.49312 0.231
NP_441036.1_8 Forward -133 -123 15.713 0.00724
NP_441036.1_8 Reverse -122 -132 15.713 0.00724
NP_441557.1_5 Forward -132 -123 19.9609 0.000699
NP_441557.1_5 Reverse -123 -132 19.9609 0.000699
NP_442066.2_4 Reverse -123 -142 -8.45701 0.294
NP_442066.2_9 Forward -201 -188 10.934 0.154
NP_441433.1_8 Forward -125 -106 6.09597 0.174
NP_442579.1_6 Forward -170 -151 11.4058 0.144
NP_440738.1_10 Forward -362 -343 15.5357 0.201
NP_441308.1_8 Reverse -121 -131 13.353 0.218
NP_441308.1_8 Forward -134 -124 12.4681 0.218
NP_442183.1_1 Reverse -123 -137 8.45605 0.115
NP_440979.1_3 Forward -131 -113 10.5406 0.245
NP_441574.1_1 Reverse -219 -238 -6.88371 0.281
NP_441549.1_9 Forward -136 -118 -4.70074 0.198
NP_442347.1_2 Forward -131 -122 3.34298 0.284
NP_442347.1_2 Reverse -124 -133 3.34298 0.284
NP_442645.1_2 Forward -98 -79 -11.7019 0.144
NP_442645.1_2 Reverse -115 -134 -16.5201 0.235
NP_441037.1_4 Forward -134 -124 16.5761 0.0168
NP_441037.1_4 Reverse -121 -131 7.31769 0.237
NP_441633.1_3 Reverse -121 -134 -3.52063 0.177
NP_440136.1_2 Forward -131 -124 15.9687 0.0123
NP_440136.1_2 Reverse -124 -131 15.9687 0.0123
NP_442590.1_10 Forward -132 -113 6.68596 0.239
NP_442998.1_5 Forward -334 -324 7.25653 0.298
NP_442998.1_10 Forward -130 -123 15.5754 0.0102
NP_442998.1_10 Reverse -125 -132 15.5754 0.0102
NP_440899.1_8 Forward -51 -32 2.3594 0.131
NP_440899.1_8 Forward -213 -194 -9.83364 0.269
NP_440299.1_1 Forward -136 -123 10.3434 0.0573
NP_441799.1_1 Reverse -119 -133 13.4703 0.032
NP_441799.1_1 Forward -136 -122 9.6354 0.0879
NP_441007.1_10 Forward -137 -124 3.85419 0.182
NP_441743.1_2 Forward -255 -236 18.6815 0.155
NP_440256.1_1 Reverse -120 -139 -1.7705 0.107
NP_441559.1_8 Forward -137 -123 10.7177 0.0574
NP_441559.1_8 Reverse -118 -132 -0.295402 0.175
NP_441559.1_8 Reverse -319 -333 -3.44199 0.203
NP_440915.1_6 Forward -136 -122 14.6509 0.0183
NP_440915.1_6 Reverse -119 -133 10.816 0.0301
NP_440915.1_6 Forward -274 -260 -3.34366 0.293
NP_440997.1_3 Reverse -117 -136 25.5655 0.00382
NP_442785.1_7 Forward -313 -299 9.04604 0.276
NP_442866.1_1 Forward -388 -369 -9.53865 0.294
NP_440748.1_5 Reverse -370 -389 -0.295539 0.258
NP_440695.1_6 Forward -293 -279 11.0901 0.265
NP_441939.1_3 Reverse -124 -143 15.1424 0.0624
NP_441199.1_6 Forward -136 -117 7.17762 0.12
NP_441494.1_6 Forward -137 -124 8.9674 0.227
NP_442993.1_1 Forward -132 -116 9.49831 0.0186
NP_442993.1_1 Reverse -123 -139 -9.38124 0.185
NP_440677.1_1 Forward -141 -122 8.65258 0.204
NP_442386.1_9 Forward -133 -124 6.39082 0.219
NP_442386.1_9 Reverse -122 -131 6.39082 0.219
NP_441340.1_5 Forward -131 -124 15.6737 0.0124
NP_441340.1_5 Reverse -124 -131 15.6737 0.0124
NP_441947.1_10 Reverse -121 -139 -1.16082 0.295
NP_441297.1_8 Forward -220 -202 11.1298 0.238
NP_439976.1_4 Forward -210 -191 12.3883 0.278
NP_442240.1_2 Reverse -124 -143 -15.7335 0.222
NP_442714.1_5 Forward -384 -365 -0.39387 0.273
NP_442714.1_5 Reverse -55 -74 -1.08219 0.3
NP_441027.1_1 Forward -45 -31 11.1104 0.277
NP_441027.1_1 Forward -95 -81 10.422 0.291
NP_440586.1_8 Forward -131 -124 13.2151 0.026
NP_440586.1_8 Reverse -124 -131 13.2151 0.026
NP_442251.1_6 Forward -131 -124 15.2804 0.0124
NP_442251.1_6 Reverse -124 -131 15.2804 0.0124
NP_442251.1_6 Reverse -275 -282 6.43063 0.298
NP_441262.1_3 Reverse -123 -130 14.7888 0.0223
NP_441262.1_3 Forward -132 -125 14.7888 0.0223
NP_443051.1_1 Reverse -122 -131 19.5676 0.00335
NP_443051.1_1 Forward -133 -124 19.5676 0.00335
NP_439937.1_9 Reverse -122 -139 3.08639 0.0798
NP_440439.1_1 Forward -135 -122 19.4888 0.0105
NP_440439.1_1 Reverse -120 -133 8.77074 0.0497
NP_440372.1_2 Forward -131 -124 16.3621 0.0124
NP_440372.1_2 Reverse -124 -131 16.3621 0.0124
NP_440819.1_5 Forward -172 -164 8.08256 0.185
NP_439977.1_5 Reverse -117 -136 -0.688862 0.233
NP_441572.1_7 Forward -138 -119 -3.73712 0.219
NP_441572.1_7 Reverse -117 -136 -5.70374 0.269
NP_440267.1_2 Reverse -118 -132 8.75042 0.162
NP_442384.1_10 Reverse -123 -136 10.934 0.0399
NP_442384.1_10 Forward -132 -119 7.09911 0.0875
NP_442262.1_10 Forward -131 -124 14.1988 0.0123
NP_442262.1_10 Reverse -124 -131 14.1988 0.0123
NP_441689.1_5 Reverse -121 -131 17.8758 0.0158
NP_441689.1_5 Forward -134 -124 8.43603 0.132
NP_440344.1_10 Forward -139 -122 -7.43431 0.117
NP_440562.1_3 Reverse -124 -141 4.46374 0.196
NP_442529.1_4 Reverse -114 -133 7.37428 0.289
NP_440297.1_9 Forward -131 -121 9.22315 0.0917
NP_440297.1_9 Reverse -124 -134 -0.314959 0.282
NP_441896.1_3 Forward -141 -122 2.45773 0.194
NP_441896.1_3 Reverse -358 -377 -2.55715 0.284
NP_440894.1_2 Forward -206 -187 3.14605 0.172
NP_440999.1_9 Forward -136 -122 9.43936 0.0639
NP_440888.1_2 Reverse -123 -137 17.9935 0.00283
NP_440888.1_2 Forward -132 -118 16.4202 0.00685
NP_442948.1_2 Reverse -122 -141 6.39097 0.24
NP_440237.1_5 Reverse -142 -156 13.077 0.197
NP_442277.1_4 Forward -141 -122 23.598 0.00711
NP_442033.1_10 Reverse -121 -140 -14.3569 0.298
NP_441543.1_2 Forward -131 -122 15.9293 0.00518
NP_441543.1_2 Reverse -124 -133 15.9293 0.00518
NP_442845.1_2 Reverse -117 -131 13.6676 0.0934
NP_442845.1_2 Forward -138 -124 12.7826 0.104
NP_442710.1_7 Reverse -242 -261 -2.8978 0.252
NP_441469.1_4 Reverse -357 -376 11.9958 0.249
NP_441469.1_8 Forward -133 -124 6.5879 0.227
NP_441469.1_8 Reverse -122 -131 6.5879 0.227
NP_443064.1_6 Forward -132 -122 10.8217 0.13
NP_443064.1_6 Reverse -123 -133 10.8217 0.13
NP_442578.1_7 Forward -131 -124 14.5921 0.026
NP_442578.1_7 Reverse -124 -131 14.5921 0.026
NP_440710.1_1 Forward -326 -308 -6.76569 0.228
NP_440220.1_4 Reverse -372 -391 -1.47628 0.264
NP_441462.1_2 Forward -132 -122 20.2362 0.000805
NP_441462.1_2 Reverse -123 -133 20.2362 0.000805
NP_441462.1_5 Reverse -21 -40 1.67108 0.291
NP_441621.1_7 Reverse -121 -135 -5.11362 0.248
NP_441621.1_7 Forward -134 -120 -5.21195 0.248
NP_443062.1_1 Forward -132 -114 18.8817 0.022
NP_443062.1_1 Forward -383 -365 4.35311 0.264
NP_443062.1_6 Reverse -115 -134 5.211 0.209
NP_440519.1_8 Reverse -9 -25 10.3833 0.199
NP_442204.1_1 Forward -136 -125 10.1868 0.0736
NP_442204.1_1 Reverse -119 -130 0.157002 0.283
NP_440516.1_8 Forward -132 -123 16.9127 0.00442
NP_440516.1_8 Reverse -123 -132 16.9127 0.00442
NP_442428.1_4 Forward -133 -114 10.9142 0.131
NP_442428.1_5 Forward -131 -124 15.8704 0.0124
NP_442428.1_5 Reverse -124 -131 15.8704 0.0124
NP_442120.1_10 Forward -132 -113 -8.45701 0.237
NP_440673.1_3 Forward -130 -123 12.4288 0.0426
NP_440673.1_3 Reverse -125 -132 12.4288 0.0426
NP_440673.1_3 Reverse -263 -270 9.08556 0.202
NP_440673.1_7 Reverse -263 -282 0.491109 0.267
NP_440865.1_9 Reverse -117 -136 -0.295539 0.154
NP_441052.1_2 Forward -132 -122 10.4031 0.0285
NP_441052.1_2 Reverse -123 -133 10.4031 0.0285
NP_442219.1_9 Forward -131 -122 8.25953 0.0681
NP_442219.1_9 Reverse -124 -133 8.25953 0.0681
NP_440436.1_4 Forward -131 -122 9.24241 0.0871
NP_440436.1_4 Reverse -124 -133 9.24241 0.0871
NP_441884.1_9 Reverse -120 -139 -21.9284 0.272
NP_441884.1_9 Reverse -306 -325 -23.01 0.284
NP_441336.1_3 Forward -139 -125 17.7975 0.214
NP_440314.1_9 Reverse -275 -294 -7.76869 0.243
NP_441719.1_4 Forward -131 -124 16.3621 0.0124
NP_441719.1_4 Reverse -124 -131 16.3621 0.0124
NP_441004.1_1 Forward -350 -331 -16.8151 0.287
NP_442366.1_3 Reverse -366 -384 2.57575 0.127
NP_442366.1_3 Forward -133 -115 -4.70074 0.275
NP_441115.1_4 Reverse -122 -140 22.8311 0.000811
NP_441115.1_4 Forward -133 -115 14.5713 0.0532
NP_443054.1_2 Reverse -121 -135 2.65453 0.242
NP_442430.1_10 Forward -142 -123 15.7316 0.113
NP_441851.1_10 Forward -133 -123 8.53483 0.114
NP_441851.1_10 Reverse -122 -132 8.53483 0.114
NP_442515.1_1 Forward -178 -164 -1.5737 0.257
NP_442515.1_1 Reverse -122 -136 -4.03198 0.298
NP_441396.1_5 Reverse -354 -363 7.27622 0.29
NP_441349.1_10 Reverse -113 -132 -2.75381 0.125
NP_441349.1_10 Forward -142 -123 -8.45701 0.275
NP_441409.1_6 Forward -138 -119 -1.47551 0.0765
NP_440474.1_8 Forward -131 -117 15.6336 0.0566
NP_440474.1_8 Reverse -124 -138 7.27547 0.207
NP_440431.1_3 Reverse -273 -292 -11.8003 0.291
NP_442450.1_5 Reverse -121 -131 9.41981 0.115
NP_440588.1_2 Forward -141 -122 -1.7705 0.157
NP_441570.1_1 Forward -132 -114 -6.66736 0.0813
NP_441078.1_4 Forward -132 -123 19.6659 0.0007
NP_441078.1_4 Reverse -123 -132 19.6659 0.0007
NP_442348.1_2 Forward -217 -208 11.7994 0.225
NP_440526.1_3 Reverse -124 -135 2.31981 0.267
NP_440526.1_3 Forward -131 -120 1.82816 0.267
NP_441432.1_8 Reverse -122 -131 16.8143 0.00595
NP_441432.1_8 Forward -133 -124 16.8143 0.00595
NP_443024.1_3 Reverse -365 -375 13.2547 0.289
NP_441732.1_2 Reverse -119 -135 3.00846 0.0141
NP_441732.1_2 Forward -136 -120 -6.62797 0.0495
NP_442447.1_1 Reverse -25 -44 6.29264 0.258
NP_440313.1_5 Forward -327 -309 13.9813 0.214
NP_440313.1_6 Reverse -63 -82 18.9773 0.157
NP_440760.1_1 Reverse -123 -142 -21.9284 0.246
NP_442274.1_8 Forward -92 -74 12.9971 0.297
NP_440199.1_10 Reverse -120 -130 14.238 0.0861
NP_441057.1_4 Reverse -293 -311 -2.24246 0.272
NP_441072.1_2 Reverse -112 -131 5.80098 0.296
NP_440713.1_4 Forward -142 -123 9.73422 0.14
NP_440713.1_4 Reverse -113 -132 7.7676 0.174
NP_442489.1_7 Forward -132 -123 20.1576 0.000695
NP_442489.1_7 Reverse -123 -132 20.1576 0.000695
NP_440559.1_1 Reverse -124 -133 8.65285 0.0586
NP_440559.1_1 Forward -131 -122 8.65285 0.0586
NP_441659.2_8 Forward -132 -122 20.9245 0.000805
NP_441659.2_8 Reverse -123 -133 20.9245 0.000805
NP_441968.1_1 Forward -172 -164 14.1787 0.286
NP_442776.1_6 Forward -134 -115 7.37428 0.285
NP_442346.1_5 Forward -133 -123 16.303 0.00248
NP_442346.1_5 Reverse -122 -132 16.303 0.00248
NP_440545.1_3 Forward -136 -119 14.7885 0.0141
NP_440545.1_3 Reverse -119 -136 10.8552 0.0296
NP_442851.1_2 Reverse -327 -346 11.0125 0.135
NP_440459.1_2 Reverse -114 -131 8.29864 0.266
NP_440010.1_10 Forward -323 -304 7.86593 0.225
NP_442603.1_7 Reverse -123 -137 11.7987 0.112
NP_440449.1_6 Forward -140 -122 16.3287 0.0851
NP_441833.1_4 Forward -131 -124 15.9687 0.0124
NP_441833.1_4 Reverse -124 -131 15.9687 0.0124
NP_441895.1_10 Reverse -191 -210 -27.6315 0.282
NP_442162.1_9 Forward -131 -124 16.2637 0.0124
NP_442162.1_9 Reverse -124 -131 16.2637 0.0124
NP_440671.1_4 Reverse -117 -131 14.6509 0.0573
NP_442404.1_9 Reverse -126 -140 12.2903 0.263
NP_442140.1_3 Reverse -124 -134 7.94484 0.124
NP_442723.1_1 Forward -40 -21 1.27698 0.298
NP_440875.1_9 Reverse -125 -135 14.5042 0.0411
NP_440875.1_9 Forward -130 -120 7.59334 0.255
NP_441813.1_5 Reverse -121 -131 15.9097 0.01
NP_441813.1_5 Forward -134 -124 8.73149 0.0367
NP_440594.1_8 Reverse -124 -137 9.95012 0.173
NP_440590.1_4 Reverse -124 -137 14.9656 0.0106
NP_440590.1_4 Forward -131 -118 -3.81562 0.255
NP_440567.1_1 Reverse -124 -138 8.65272 0.0554
NP_440567.1_1 Forward -131 -117 6.88276 0.08
NP_442497.1_10 Forward -131 -122 17.601 0.00813
NP_442497.1_10 Reverse -124 -133 17.601 0.00813
NP_440821.1_4 Reverse -121 -131 11.0914 0.0146
NP_440821.1_4 Forward -134 -124 10.7964 0.0146
NP_441239.1_9 Forward -134 -122 14.887 0.0247
NP_441239.1_9 Reverse -121 -133 12.1337 0.0494
NP_440156.1_4 Forward -319 -309 8.63269 0.281
NP_441727.1_3 Reverse -161 -180 14.0608 0.116
NP_441892.1_1 Forward -141 -124 1.41547 0.152
NP_442138.1_5 Forward -171 -152 10.6192 0.276
NP_440546.1_4 Reverse -123 -133 13.5365 0.0459
NP_440546.1_4 Forward -132 -122 13.5365 0.0459
NP_440462.1_6 Forward -134 -124 19.4496 0.00371
NP_440462.1_6 Reverse -121 -131 16.893 0.00853
NP_442611.1_1 Reverse -118 -137 -0.983855 0.273
NP_440868.1_4 Forward -136 -124 9.97041 0.0405
NP_440868.1_4 Reverse -119 -131 6.23383 0.0878
NP_442402.1_4 Reverse -371 -390 -10.326 0.299
NP_441848.1_7 Forward -43 -24 -4.03287 0.287
NP_441084.1_6 Forward -385 -371 11.1863 0.214
NP_440696.1_6 Reverse -111 -130 4.03102 0.288
NP_442039.1_4 Forward -131 -124 15.1821 0.0124
NP_442039.1_4 Reverse -124 -131 15.1821 0.0124
NP_442039.1_7 Reverse -56 -66 7.05986 0.283
NP_441811.1_8 Forward -138 -124 9.83269 0.225
NP_442679.1_1 Reverse -194 -213 -4.72043 0.283
NP_441926.1_3 Forward -132 -116 24.5429 0.00176
NP_442837.1_3 Forward -131 -124 15.7721 0.0124
NP_442837.1_3 Reverse -124 -131 15.7721 0.0124
NP_440160.1_2 Forward -333 -314 -2.26216 0.245
NP_442053.1_1 Forward -132 -123 18.3876 0.0007
NP_442053.1_1 Reverse -123 -132 18.3876 0.0007
NP_440505.1_3 Forward -134 -124 15.418 0.0114
NP_440505.1_3 Reverse -121 -131 15.123 0.014
NP_442971.1_3 Forward -331 -312 14.8474 0.167
NP_442532.1_7 Reverse -123 -137 6.29277 0.171
NP_440914.1_1 Forward -132 -122 16.3248 0.00196
NP_440914.1_1 Reverse -123 -133 16.3248 0.00196
NP_441011.1_8 Forward -131 -122 16.6177 0.00602
NP_441011.1_8 Reverse -124 -133 16.6177 0.00602
NP_442533.1_6 Forward -132 -123 17.2076 0.00137
NP_442533.1_6 Reverse -123 -132 17.2076 0.00137
NP_442533.1_6 Reverse -374 -383 8.65285 0.0727
NP_443016.1_1 Forward -317 -298 -5.80207 0.251
NP_441482.1_7 Forward -138 -124 -10.1285 0.209
NP_441482.1_7 Reverse -117 -131 -10.8168 0.216
NP_439944.1_9 Reverse -124 -134 17.7779 0.00341
NP_439944.1_9 Forward -131 -121 17.6796 0.00347
NP_441028.1_6 Forward -38 -28 7.35439 0.229
NP_441028.1_6 Forward -211 -201 5.19112 0.265
NP_440116.1_8 Forward -131 -112 -4.42544 0.171
NP_441527.1_4 Forward -166 -147 -5.20473 0.197
NP_441527.1_4 Forward -169 -150 -10.1703 0.266
NP_441527.1_4 Forward -176 -157 -10.5523 0.272
NP_440115.1_6 Forward -135 -125 16.008 0.0325
NP_440007.1_9 Reverse -119 -133 9.83269 0.166
NP_441106.1_1 Reverse -122 -131 18.486 0.0028
NP_441106.1_1 Forward -133 -124 18.486 0.0028
NP_439903.1_6 Reverse -120 -139 7.17681 0.163
NP_442306.1_10 Reverse -118 -137 -20.2567 0.202
NP_441286.1_1 Reverse -122 -134 5.25052 0.0259
NP_441286.1_1 Forward -133 -121 4.95553 0.027
NP_440670.1_8 Forward -132 -123 18.3876 0.000699
NP_440670.1_8 Reverse -123 -132 18.3876 0.000699
NP_440886.1_7 Forward -133 -123 8.04271 0.0805
NP_440886.1_7 Reverse -122 -132 8.04271 0.0805
NP_442072.1_9 Forward -133 -115 6.70565 0.0115
NP_442072.1_9 Reverse -122 -140 -3.42244 0.0355
NP_440907.2_8 Reverse -124 -134 19.1541 0.00362
NP_440907.2_8 Forward -131 -121 9.51767 0.103
NP_439967.1_3 Reverse -105 -123 14.6541 0.271
NP_441463.1_3 Reverse -113 -132 -3.24547 0.171
NP_441463.1_6 Reverse -121 -135 7.86544 0.25
NP_441626.1_2 Forward -131 -124 15.7721 0.0124
NP_441626.1_2 Reverse -124 -131 15.7721 0.0124
NP_442615.1_1 Forward -141 -123 5.42735 0.0386
NP_442615.1_1 Reverse -114 -132 -1.75081 0.132
NP_440387.1_1 Reverse -123 -139 9.20332 0.0281
NP_440387.1_1 Forward -132 -116 8.515 0.0282
NP_440387.1_1 Forward -376 -360 -4.26803 0.181
NP_441431.1_2 Forward -135 -121 7.17714 0.247
NP_441488.1_7 Forward -138 -119 7.66927 0.124
NP_441836.1_2 Forward -389 -370 -4.72043 0.262
NP_440082.1_5 Forward -259 -240 15.2287 0.256
NP_440814.1_4 Reverse -114 -133 -3.54046 0.152
NP_440114.1_10 Forward -132 -118 16.2242 0.0194
NP_440114.1_10 Reverse -123 -137 6.48943 0.269
NP_440766.1_4 Forward -136 -122 6.78443 0.0973
NP_439910.1_2 Reverse -115 -132 -2.41943 0.0305
NP_440457.1_1 Reverse -119 -131 9.67541 0.092
NP_440457.1_1 Forward -136 -124 7.31547 0.105
NP_440798.1_6 Reverse -124 -137 1.78924 0.197
NP_442509.1_9 Forward -332 -322 8.3377 0.192
NP_442509.1_9 Reverse -123 -133 8.04271 0.192
NP_442509.1_9 Forward -132 -122 8.04271 0.192
NP_442582.1_3 Forward -155 -141 15.3858 0.186
NP_440554.1_4 Forward -131 -121 16.1063 0.0189
NP_440554.1_4 Reverse -124 -134 15.418 0.0199
NP_442862.1_3 Reverse -313 -330 4.26707 0.29
NP_441845.1_6 Reverse -111 -129 5.72234 0.179
NP_441885.1_5 Forward -132 -122 11.3864 0.00668
NP_441885.1_5 Reverse -123 -133 11.3864 0.00668
NP_442341.1_7 Reverse -122 -136 3.93283 0.208
NP_442341.1_9 Forward -134 -120 8.3571 0.171
NP_440191.1_4 Forward -37 -27 14.0207 0.282
NP_443000.1_7 Reverse -121 -131 17.4829 0.00719
NP_443000.1_7 Forward -134 -124 10.7964 0.0345
NP_441842.1_1 Reverse -125 -138 16.6366 0.0446
NP_440275.1_3 Forward -134 -124 18.6629 0.0082
NP_440275.1_3 Reverse -121 -131 9.12481 0.055
NP_440091.1_1 Reverse -119 -131 10.8554 0.0429
NP_440091.1_1 Forward -136 -124 0.825626 0.227
NP_443010.1_10 Forward -135 -118 17.9423 0.0367
NP_443010.1_10 Reverse -120 -137 2.48089 0.275
NP_442451.1_2 Forward -378 -359 -8.55534 0.251
NP_441105.1_3 Forward -143 -124 14.2574 0.0243
NP_440216.1_1 Forward -132 -118 7.37441 0.00942
NP_440216.1_1 Reverse -123 -137 -1.47537 0.0328
NP_440172.1_1 Forward -132 -122 17.5813 0.00421
NP_440172.1_1 Reverse -123 -133 17.5813 0.00421
NP_440172.1_1 Reverse -374 -384 11.2881 0.0407
NP_442015.1_10 Forward -136 -123 4.93583 0.156
NP_441226.1_7 Forward -131 -124 14.4934 0.0123
NP_441226.1_7 Reverse -124 -131 14.4934 0.0123
NP_441111.1_7 Forward -131 -123 18.7023 0.00294
NP_441111.1_7 Reverse -124 -132 18.7023 0.00294
NP_442379.1_10 Reverse -116 -133 15.1818 0.0453
NP_442379.1_10 Forward -139 -122 -1.73112 0.223
NP_441766.1_2 Forward -132 -123 17.5026 0.00297
NP_441766.1_2 Reverse -123 -132 17.5026 0.00297
NP_440416.1_9 Reverse -316 -335 -13.3736 0.165
NP_442564.1_9 Forward -376 -362 13.5421 0.285
NP_440261.1_5 Reverse -124 -137 4.8375 0.0516
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAGCTCGAATACGGGGAAGTCATCGGCAATTGAAGCACCCCCACAAGGCAGGTTTGGTAACTGTACTGGGCAAACCCAGTGACGAATTAGCCCCTGGGACACTAGCCAGTATTCTCAAGCAATCTTCTCAAGCAATCAGGTATTACTTTATGAAGTATTTAGTCATCATTGAAACGACAACAACGGGATTTTCCGCCTATTCTCCCGATTTACCAGGATGTGTGGCAACAGGAAAAACGAAGCAAGAAGTTGAACAAAATATGTCGGAGGCGATCGCCTTTCACTTGGAGGGAATGCGTTTAGAAGGATTAACTATCCCAGAGCCAACTTCCTTTTCTGCCTACGTAACAGTTGCGGCTTAATTTTCCCCTCTTCACACCAAAATCATTCCCTGTTGTCA

CDS

ATGGCTCAAAAATCTTCGTCGTTTTTTCCCTATTTAATTGCCGGACTTTGCGCCCTGTTGGGGGCCTGTAGCGGCAACCAAGCATTGCAGGATCGTTTTGCCGCCAATCCTTCCCTGGGTAGTTCCCCCAGTCCCACCACCACTGTTTCCCCCACTCCGACCCCAGAAACTACGGAGCCGGATACCCCCACCACACCGGAACCTACCCCCACGGCCACCTTTTCCACTGGCACTTTTAGCGATCTAGACAAAGTAGGCGATCGCCAAAGGGAAGAAATTGAGGATTTAGCTCAACTAGACATTGTGCAAGCCAAAACAAGTCAGGAATTTGCGCCCCAAAGTAACATCAGTCGGGGAGAATTTGCCCGTTGGTTATTTCAGGCCAATAACGTCTTTTTTGCTAACCAGCCCAGTAAACAAATCCGCCCCGCTCCCAGTAACGCCACCCCTCTTTTCACCGACGTTCCCCCCACCCATCCCGACTTTGCTCAAATTCAAGGTTTAGCCGACGCCGGCTTAATCCCCTCTAGCCTCACCAACGACCCCACTGCTAGTCAGTTTCGCCCCGATGCGCCCCTAACCAGGGAAGATTTAGTCCGTTGGAAAGTGCCCCTAGATCAACGCCGAGCCCTGCCCAATGCGAGCCTGGAAAATATCAAAGAAACCTGGGGTTTTCAGGACGCGGCCAAAATCAATCCCAACATTTGGCCCGCCCTAGCCGCCGACTTCCAAAACGGCGATCAAGCCAACCTGAAAAGAGTGTTTGGTTACATCACTATCTTTCAACCCCAGCGTCCCGTAACTAGGGGAGAAGCGGCCTCTGCCCTCTGGTTTTTAGGAGTCCAAACCGACGGCTTAAGTGCGAAAGATGTAATCAATGCTCCCGCATCCCCATCCCCCGGAGTTGAGCCCACTGTTACTCCAGATACTGTTAATCCGGATACTCAAGGTAATTCACCTAATTAA

Protein

MAQKSSSFFPYLIAGLCALLGACSGNQALQDRFAANPSLGSSPSPTTTVSPTPTPETTEPDTPTTPEPTPTATFSTGTFSDLDKVGDRQREEIEDLAQLDIVQAKTSQEFAPQSNISRGEFARWLFQANNVFFANQPSKQIRPAPSNATPLFTDVPPTHPDFAQIQGLADAGLIPSSLTNDPTASQFRPDAPLTREDLVRWKVPLDQRRALPNASLENIKETWGFQDAAKINPNIWPALAADFQNGDQANLKRVFGYITIFQPQRPVTRGEAASALWFLGVQTDGLSAKDVINAPASPSPGVEPTVTPDTVNPDTQGNSPN