Your browser is old and dusty. Try Google Chrome!

Details for slr1999

ORF slr1999
Accession NP_441207.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -238 -224 1.08123 0.195
NP_441061.1_2 Reverse -207 -221 -0.492064 0.231
NP_441061.1_2 Forward -214 -200 -0.787057 0.239
NP_440795.1_7 Forward -214 -207 14.6904 0.0123
NP_440795.1_7 Reverse -207 -214 14.6904 0.0123
NP_440795.1_7 Forward -194 -187 6.43063 0.265
NP_441418.1_6 Reverse -206 -225 -18.7818 0.0837
NP_441418.1_6 Forward -215 -196 -20.3551 0.111
NP_442291.1_5 Forward -216 -200 9.39998 0.0521
NP_442291.1_5 Reverse -205 -221 -0.728113 0.189
NP_441453.1_4 Reverse -206 -214 16.539 0.00633
NP_441453.1_4 Forward -215 -207 16.539 0.00633
NP_441818.1_1 Forward -214 -203 15.4961 0.0264
NP_441818.1_9 Forward -350 -331 -10.7186 0.298
NP_440226.1_1 Forward -215 -196 18.289 0.0157
NP_440226.1_1 Reverse -206 -225 3.14605 0.237
NP_440150.1_2 Forward -72 -53 10.7167 0.201
NP_442744.1_9 Forward -221 -207 16.4227 0.266
NP_442744.1_10 Reverse -316 -335 12.7825 0.27
NP_442173.1_1 Forward -214 -206 15.4574 0.00633
NP_442173.1_1 Reverse -207 -215 15.4574 0.00633
NP_442752.1_4 Forward -215 -208 13.8055 0.0199
NP_442752.1_4 Reverse -206 -213 13.8055 0.0199
NP_443027.1_4 Reverse -204 -214 11.0914 0.107
NP_443027.1_4 Forward -217 -207 5.87989 0.294
NP_442975.1_10 Forward -219 -205 19.0751 0.00482
NP_440784.1_7 Forward -214 -207 15.9687 0.0123
NP_440784.1_7 Reverse -207 -214 15.9687 0.0123
NP_442861.1_4 Forward -154 -135 9.24175 0.162
NP_440061.1_9 Forward -217 -203 17.5018 0.0146
NP_442405.1_3 Forward -246 -234 16.6563 0.288
NP_442074.1_1 Forward -49 -30 17.8957 0.282
NP_440878.1_9 Forward -225 -206 -3.63879 0.299
NP_442062.1_8 Reverse -206 -216 19.4496 0.000558
NP_442062.1_8 Forward -215 -205 17.3846 0.00193
NP_440761.1_4 Reverse -219 -238 -14.0619 0.257
NP_442974.1_5 Forward -68 -49 4.32602 0.294
NP_441859.1_3 Forward -216 -197 9.7334 0.125
NP_441859.1_3 Forward -62 -43 8.75009 0.136
NP_441859.1_3 Forward -28 -9 2.9486 0.253
NP_440304.1_4 Forward -385 -375 5.28991 0.218
NP_440304.1_4 Forward -217 -207 1.84832 0.299
NP_440304.1_4 Reverse -204 -214 1.84832 0.299
NP_442242.1_4 Forward -214 -207 14.3954 0.0124
NP_442242.1_4 Reverse -207 -214 14.3954 0.0124
NP_441781.1_7 Reverse -206 -225 -3.3438 0.296
NP_440916.1_1 Reverse -352 -366 9.34103 0.236
NP_440893.1_3 Reverse -249 -268 5.30853 0.262
NP_441208.1_9 Forward -338 -324 6.78443 0.229
NP_440132.1_1 Reverse -54 -72 12.2122 0.195
NP_442726.1_1 Forward -220 -201 10.1275 0.233
NP_440856.1_4 Reverse -199 -218 5.80098 0.0814
NP_441083.1_5 Forward -215 -205 20.3345 0.00053
NP_441083.1_5 Reverse -206 -216 11.3864 0.0159
NP_442115.2_6 Reverse -334 -353 25.6629 0.0021
NP_441434.1_7 Reverse -208 -222 1.76955 0.295
NP_441738.1_2 Forward -213 -206 15.28 0.0102
NP_441738.1_2 Reverse -208 -215 15.28 0.0102
NP_441558.1_5 Reverse -366 -385 5.99764 0.232
NP_441558.1_5 Reverse -204 -223 4.81767 0.269
NP_440209.1_1 Reverse -206 -214 18.1123 0.00295
NP_440209.1_1 Forward -215 -207 18.1123 0.00295
NP_442889.1_8 Forward -218 -204 11.7987 0.0733
NP_442889.1_8 Reverse -203 -217 3.8339 0.273
NP_442398.1_4 Forward -361 -342 9.83173 0.214
NP_441713.1_1 Reverse -368 -387 -7.86702 0.139
NP_441713.1_1 Forward -396 -377 -16.0285 0.275
NP_441713.1_3 Reverse -52 -71 11.3075 0.16
NP_440178.1_7 Reverse -275 -294 -21.1417 0.213
NP_440178.1_7 Forward -114 -95 -22.3217 0.261
NP_442706.1_10 Reverse -252 -270 14.2771 0.232
NP_441716.1_1 Forward -215 -201 8.55439 0.138
NP_441716.1_1 Reverse -323 -337 4.32615 0.256
NP_442111.1_4 Reverse -205 -219 9.2427 0.0619
NP_442111.1_4 Reverse -121 -135 1.76955 0.294
NP_441163.1_1 Forward -223 -206 5.64298 0.271
NP_440906.1_5 Forward -214 -207 15.8704 0.0124
NP_440906.1_5 Reverse -207 -214 15.8704 0.0124
NP_440747.1_10 Reverse -203 -215 16.7552 0.0019
NP_440747.1_10 Forward -218 -206 5.34885 0.0141
NP_440747.1_10 Reverse -371 -383 -11.4657 0.122
NP_440747.1_10 Forward -262 -250 -12.1541 0.227
NP_441486.1_1 Reverse -203 -217 5.1128 0.0391
NP_441486.1_1 Forward -218 -204 4.91614 0.0399
NP_442634.1_4 Forward -194 -180 0.491246 0.149
NP_441197.1_8 Reverse -345 -364 20.2556 0.055
NP_441695.1_4 Reverse -376 -394 11.1305 0.243
NP_441014.1_10 Forward -352 -333 0.883656 0.236
NP_443018.1_3 Forward -214 -207 14.8871 0.0123
NP_443018.1_3 Reverse -207 -214 14.8871 0.0123
NP_441634.1_8 Reverse -204 -218 6.58777 0.114
NP_441634.1_8 Forward -290 -276 2.85119 0.16
NP_440376.1_1 Forward -215 -206 19.4693 0.000692
NP_440376.1_1 Reverse -206 -215 19.4693 0.000692
NP_440376.1_1 Forward -383 -374 5.60459 0.125
NP_441588.1_4 Reverse -208 -218 14.238 0.0773
NP_441588.1_4 Forward -213 -203 6.46988 0.193
NP_442687.1_7 Forward -216 -206 15.8113 0.0125
NP_442687.1_7 Reverse -205 -215 8.92815 0.0994
NP_442485.1_3 Forward -76 -57 -3.04881 0.272
NP_440642.1_8 Forward -213 -194 15.8516 0.138
NP_440042.1_2 Forward -225 -206 -2.65548 0.261
NP_440533.1_6 Reverse -258 -277 12.2908 0.238
NP_442296.1_9 Reverse -207 -226 -1.08219 0.197
NP_442658.1_1 Forward -217 -207 15.9091 0.00966
NP_442658.1_1 Reverse -204 -214 7.94438 0.199
NP_442658.1_1 Forward -63 -53 4.99446 0.288
NP_440141.1_4 Reverse -247 -266 -6.49039 0.296
NP_440141.1_8 Reverse -65 -84 11.7008 0.196
NP_441855.2_4 Forward -223 -204 20.8991 0.0116
NP_442782.1_2 Forward -238 -224 -0.000409212 0.297
NP_442205.1_9 Forward -389 -373 -3.8747 0.297
NP_442953.1_3 Reverse -288 -307 9.63507 0.218
NP_441414.1_9 Forward -215 -196 -0.39387 0.0903
NP_441414.1_9 Reverse -206 -225 -1.96717 0.108
NP_440800.1_2 Reverse -192 -211 15.3287 0.199
NP_442937.1_5 Reverse -201 -220 13.6675 0.0879
NP_442937.1_5 Forward -220 -201 11.0125 0.148
NP_441958.1_5 Forward -216 -206 12.2714 0.00183
NP_441958.1_5 Reverse -205 -215 12.2714 0.00183
NP_439905.1_1 Forward -376 -363 12.9006 0.178
NP_439905.1_1 Reverse -53 -66 12.2123 0.204
NP_440984.1_7 Reverse -201 -215 7.86607 0.161
NP_440984.1_7 Forward -220 -206 7.86607 0.161
NP_440984.1_7 Reverse -363 -377 5.89945 0.235
NP_442911.1_2 Reverse -196 -215 7.27595 0.0256
NP_442911.1_2 Forward -225 -206 -10.6203 0.284
NP_440153.1_5 Reverse -207 -221 0.491246 0.299
NP_443055.1_6 Reverse -198 -216 6.90155 0.164
NP_443055.1_6 Forward -223 -205 -1.9482 0.285
NP_441099.1_5 Forward -225 -206 -11.6036 0.287
NP_442002.1_9 Forward -216 -209 10.7572 0.185
NP_441294.1_7 Forward -219 -205 11.5544 0.137
NP_441294.1_7 Forward -387 -373 9.73057 0.229
NP_441294.1_7 Reverse -182 -196 8.96266 0.269
NP_441294.1_9 Forward -163 -144 20.5824 0.236
NP_441646.1_1 Reverse -373 -392 7.07928 0.164
NP_441000.1_6 Forward -216 -202 4.52282 0.0953
NP_441000.1_6 Reverse -205 -219 -3.73699 0.225
NP_440605.1_4 Reverse -196 -215 16.5802 0.115
NP_440484.1_3 Reverse -204 -218 11.8976 0.242
NP_440147.1_4 Forward -217 -204 20.2755 0.00228
NP_440147.1_4 Reverse -204 -217 7.49244 0.0678
NP_440147.1_4 Reverse -50 -63 3.65753 0.183
NP_441175.1_7 Reverse -73 -92 5.60432 0.276
NP_441550.1_8 Reverse -204 -214 15.1225 0.0132
NP_441550.1_8 Forward -217 -207 8.3377 0.124
NP_441916.1_7 Reverse -206 -216 18.4663 0.00144
NP_441916.1_7 Forward -215 -205 10.3048 0.0261
NP_441916.1_10 Forward -391 -372 5.211 0.214
NP_440206.1_4 Reverse -370 -389 -1.47628 0.291
NP_440465.1_9 Reverse -95 -113 4.6407 0.186
NP_441041.1_4 Forward -383 -364 -13.3736 0.285
NP_441041.1_7 Forward -218 -206 9.55551 0.109
NP_442396.1_5 Forward -219 -206 9.95071 0.128
NP_442004.1_6 Reverse -375 -389 2.45787 0.264
NP_441725.1_4 Forward -83 -69 5.60385 0.278
NP_441725.1_4 Reverse -201 -215 2.35894 0.287
NP_441725.1_5 Forward -214 -204 2.04498 0.115
NP_441725.1_5 Reverse -207 -217 2.04498 0.115
NP_439966.1_7 Reverse -204 -214 15.3192 0.0152
NP_439966.1_7 Forward -217 -207 9.91099 0.0968
NP_439966.1_9 Forward -217 -208 0.884706 0.253
NP_442941.1_3 Forward -214 -204 19.2529 0.00262
NP_442941.1_3 Reverse -207 -217 2.63497 0.14
NP_440289.1_2 Forward -218 -205 3.06754 0.0811
NP_440289.1_2 Reverse -203 -216 -3.61896 0.267
NP_440983.1_5 Reverse -330 -349 -1.96717 0.231
NP_441076.1_8 Forward -361 -348 17.8172 0.246
NP_442281.1_1 Forward -220 -206 12.782 0.034
NP_442281.1_1 Reverse -201 -215 8.84875 0.075
NP_440177.1_9 Reverse -198 -217 14.1591 0.217
NP_442256.1_2 Forward -217 -199 -9.91228 0.299
NP_440479.1_9 Reverse -371 -389 12.0155 0.297
NP_442012.1_1 Forward -119 -100 1.0811 0.224
NP_441556.1_4 Reverse -333 -352 11.3548 0.248
NP_441644.1_6 Forward -215 -205 17.3841 0.00127
NP_441644.1_6 Reverse -206 -216 10.1076 0.0628
NP_441644.1_6 Forward -377 -367 6.17443 0.165
NP_441795.1_4 Reverse -293 -306 18.4827 0.211
NP_442177.1_5 Forward -204 -190 9.2427 0.24
NP_442029.1_10 Reverse -45 -64 11.6025 0.187
NP_442247.1_8 Reverse -204 -218 9.63603 0.247
NP_440253.1_2 Forward -215 -197 21.7503 0.00347
NP_440929.1_8 Forward -215 -206 19.2726 0.000701
NP_440929.1_8 Reverse -206 -215 19.2726 0.000701
NP_442933.1_10 Forward -215 -206 17.601 0.00325
NP_442933.1_10 Reverse -206 -215 17.601 0.00325
NP_441751.2_8 Forward -214 -200 -2.95034 0.134
NP_442926.1_3 Forward -72 -53 3.44104 0.281
NP_442926.1_3 Reverse -54 -73 2.26107 0.295
NP_442554.1_8 Forward -214 -204 16.2046 0.0065
NP_442554.1_8 Reverse -207 -217 13.2547 0.0187
NP_442554.1_8 Forward -376 -366 2.24165 0.276
NP_441762.1_7 Reverse -205 -217 10.1671 0.0142
NP_441762.1_7 Forward -216 -204 2.39892 0.0676
NP_442142.1_4 Reverse -203 -216 6.80355 0.154
NP_442142.1_4 Forward -74 -61 4.73861 0.212
NP_442142.1_4 Forward -218 -205 4.64028 0.214
NP_442292.1_1 Forward -214 -205 18.486 0.00229
NP_442292.1_1 Reverse -207 -216 9.63616 0.0183
NP_442476.1_6 Forward -214 -200 0.0979218 0.274
NP_442381.1_8 Forward -218 -199 3.6377 0.0717
NP_441711.1_4 Reverse -197 -216 5.50599 0.173
NP_443009.1_5 Reverse -205 -216 18.3477 0.00265
NP_441715.1_4 Forward -214 -204 17.3846 0.0106
NP_441715.1_4 Reverse -207 -217 9.41981 0.097
NP_440464.1_3 Reverse -361 -380 7.07928 0.25
NP_441468.1_1 Forward -214 -207 15.8704 0.0124
NP_441468.1_1 Reverse -207 -214 15.8704 0.0124
NP_441020.2_6 Forward -217 -200 8.00365 0.212
NP_441673.1_1 Forward -215 -206 20.8459 0.000698
NP_441673.1_1 Reverse -206 -215 20.8459 0.000698
NP_441673.1_1 Reverse -374 -383 -7.86675 0.187
NP_441673.1_1 Forward -383 -374 -7.96508 0.206
NP_441016.2_6 Reverse -314 -333 5.60352 0.282
NP_441330.1_1 Reverse -201 -220 -2.65548 0.0791
NP_441764.1_8 Forward -251 -241 15.2346 0.284
NP_442868.1_6 Reverse -204 -214 19.2529 0.00563
NP_442868.1_6 Forward -217 -207 0.865012 0.205
NP_441612.1_2 Forward -215 -205 8.54929 0.21
NP_441911.1_7 Forward -49 -30 -0.0996487 0.0319
NP_442808.1_1 Forward -216 -206 18.4657 0.00201
NP_442808.1_1 Reverse -205 -215 8.63269 0.0481
NP_442808.1_1 Forward -286 -276 5.09279 0.173
NP_440145.1_3 Reverse -364 -383 -4.13045 0.221
NP_442718.1_2 Reverse -62 -81 -2.55715 0.277
NP_442542.1_2 Forward -217 -204 9.36073 0.135
NP_442542.1_9 Reverse -361 -375 6.29216 0.243
NP_442050.1_5 Reverse -204 -214 14.3359 0.0206
NP_442903.1_2 Forward -298 -279 6.2543 0.18
NP_442739.1_2 Reverse -231 -250 10.3654 0.285
NP_440558.1_2 Forward -392 -373 1.57275 0.178
NP_440558.1_2 Forward -65 -46 -3.3438 0.234
NP_441518.1_3 Reverse -196 -215 -12.3902 0.263
NP_441878.1_6 Forward -216 -206 10.4031 0.0176
NP_441878.1_6 Reverse -205 -215 10.4031 0.0176
NP_441878.1_6 Forward -390 -380 -7.68978 0.255
NP_441036.1_8 Forward -216 -206 17.7779 0.000554
NP_441036.1_8 Reverse -205 -215 8.33817 0.174
NP_441557.1_5 Forward -215 -206 19.9609 0.000699
NP_441557.1_5 Reverse -206 -215 19.9609 0.000699
NP_441557.1_8 Reverse -381 -391 11.1893 0.26
NP_442066.2_9 Reverse -202 -215 10.639 0.154
NP_442419.1_2 Reverse -201 -220 -4.52377 0.29
NP_441308.1_8 Reverse -144 -154 8.23984 0.269
NP_442830.1_1 Forward -340 -321 15.8307 0.224
NP_442183.1_1 Reverse -206 -220 11.111 0.0757
NP_442183.1_1 Forward -215 -201 8.25939 0.119
NP_441819.1_5 Reverse -82 -101 14.7531 0.195
NP_441574.1_1 Forward -389 -370 7.37428 0.11
NP_441549.1_9 Reverse -370 -388 -9.51896 0.252
NP_442347.1_2 Forward -214 -205 12.4878 0.056
NP_442347.1_2 Reverse -207 -216 11.1111 0.056
NP_442645.1_2 Reverse -198 -217 -12.0953 0.144
NP_441037.1_4 Forward -217 -207 14.7245 0.028
NP_441037.1_4 Forward -391 -381 7.02532 0.237
NP_441633.1_3 Reverse -204 -217 10.8357 0.0286
NP_441633.1_3 Forward -217 -204 3.46087 0.0699
NP_440136.1_2 Forward -214 -207 15.9687 0.0123
NP_440136.1_2 Reverse -207 -214 15.9687 0.0123
NP_442468.1_2 Forward -92 -73 12.2908 0.144
NP_442998.1_5 Reverse -70 -80 8.4365 0.263
NP_442998.1_10 Forward -213 -206 15.5754 0.0102
NP_442998.1_10 Reverse -208 -215 15.5754 0.0102
NP_442998.1_10 Forward -355 -348 7.21728 0.144
NP_440299.1_1 Reverse -202 -215 11.0318 0.0529
NP_440299.1_1 Forward -219 -206 10.9334 0.0529
NP_441799.1_1 Reverse -202 -216 13.8636 0.0293
NP_441799.1_1 Forward -219 -205 12.2903 0.0441
NP_440256.1_1 Reverse -49 -68 1.0811 0.0789
NP_440256.1_1 Reverse -203 -222 0.196116 0.0858
NP_440256.1_1 Forward -218 -199 -5.70374 0.189
NP_440915.1_6 Reverse -202 -216 0.786239 0.153
NP_442866.1_1 Forward -389 -370 -6.29373 0.254
NP_441464.1_8 Reverse -206 -220 3.93283 0.283
NP_441199.1_3 Reverse -109 -127 -1.25915 0.27
NP_442993.1_1 Reverse -206 -222 -7.41462 0.146
NP_440677.1_1 Forward -329 -310 7.27595 0.241
NP_442386.1_9 Forward -216 -207 15.7322 0.0144
NP_442386.1_9 Reverse -205 -214 13.8639 0.0289
NP_442386.1_9 Forward -62 -53 6.09583 0.23
NP_441340.1_5 Forward -214 -207 15.6737 0.0124
NP_441340.1_5 Reverse -207 -214 15.6737 0.0124
NP_440168.1_9 Reverse -204 -223 -2.36049 0.28
NP_440327.1_6 Reverse -195 -214 6.4893 0.239
NP_440161.1_3 Reverse -204 -223 7.57094 0.295
NP_440586.1_8 Forward -214 -207 13.2151 0.026
NP_440586.1_8 Reverse -207 -214 13.2151 0.026
NP_440586.1_8 Forward -287 -280 7.02027 0.279
NP_440586.1_8 Forward -376 -369 5.8403 0.283
NP_442251.1_6 Forward -214 -207 15.2804 0.0124
NP_442251.1_6 Reverse -207 -214 15.2804 0.0124
NP_440192.1_4 Reverse -59 -78 12.0171 0.193
NP_440684.1_9 Forward -221 -207 21.6324 0.00406
NP_441262.1_3 Reverse -206 -213 14.7888 0.0223
NP_441262.1_3 Forward -215 -208 14.7888 0.0223
NP_440027.1_3 Forward -71 -53 5.42659 0.244
NP_443051.1_1 Reverse -205 -214 10.4228 0.00754
NP_443051.1_1 Forward -216 -207 10.4228 0.00754
NP_439937.1_8 Forward -391 -372 -3.54046 0.27
NP_439937.1_9 Forward -63 -46 -13.5315 0.287
NP_439937.1_9 Reverse -60 -77 -13.7281 0.287
NP_439937.1_9 Reverse -379 -396 -15.7931 0.287
NP_439937.1_9 Forward -72 -55 -15.7931 0.287
NP_440408.1_7 Forward -389 -370 11.8975 0.212
NP_440626.1_1 Reverse -207 -226 18.9765 0.0643
NP_440439.1_1 Reverse -203 -216 1.88757 0.139
NP_440439.1_1 Forward -64 -51 0.60927 0.182
NP_440372.1_2 Forward -214 -207 16.3621 0.0124
NP_440372.1_2 Reverse -207 -214 16.3621 0.0124
NP_441181.1_6 Reverse -207 -225 7.09898 0.219
NP_441789.1_9 Forward -170 -151 13.3725 0.191
NP_441803.1_2 Reverse -53 -72 13.3725 0.0506
NP_442384.1_10 Forward -215 -202 12.2123 0.0296
NP_442384.1_10 Reverse -206 -219 7.09911 0.0875
NP_442790.1_4 Forward -224 -205 -3.93378 0.13
NP_442790.1_4 Reverse -197 -216 -9.24366 0.182
NP_442262.1_10 Forward -214 -207 14.1988 0.0123
NP_442262.1_10 Reverse -207 -214 14.1988 0.0123
NP_441689.1_5 Reverse -204 -214 5.78111 0.197
NP_440344.1_10 Forward -222 -205 -1.53445 0.0547
NP_440344.1_10 Reverse -199 -216 -10.9742 0.197
NP_440282.1_10 Reverse -358 -377 -9.34199 0.277
NP_440531.1_6 Reverse -360 -379 -1.08219 0.227
NP_440189.1_10 Forward -226 -207 5.01433 0.279
NP_441335.1_8 Forward -85 -66 6.58763 0.281
NP_440297.1_9 Forward -214 -204 -0.118297 0.282
NP_440297.1_9 Reverse -207 -217 -0.118297 0.282
NP_441103.1_9 Forward -108 -98 14.0521 0.234
NP_440888.1_2 Forward -215 -201 15.1419 0.0122
NP_440888.1_2 Reverse -206 -220 7.17714 0.205
NP_440600.1_4 Forward -223 -205 0.609134 0.138
NP_440600.1_4 Reverse -198 -216 -1.65248 0.174
NP_440052.1_5 Forward -226 -207 0.392778 0.175
NP_441748.1_3 Reverse -57 -76 19.7641 0.0846
NP_442077.1_9 Reverse -77 -96 -6.39206 0.289
NP_442077.1_9 Reverse -234 -253 -6.58872 0.29
NP_441543.1_2 Reverse -207 -216 18.486 0.00236
NP_441543.1_2 Forward -214 -205 16.9127 0.00359
NP_442845.1_2 Forward -390 -376 14.0609 0.0872
NP_442845.1_2 Forward -221 -207 3.53951 0.287
NP_441469.1_8 Forward -216 -207 16.126 0.00797
NP_441469.1_8 Reverse -205 -214 6.48957 0.227
NP_443064.1_6 Forward -215 -205 12.5669 0.0796
NP_443064.1_6 Reverse -260 -270 9.3673 0.226
NP_442578.1_7 Forward -214 -207 14.5921 0.026
NP_442578.1_7 Reverse -207 -214 14.5921 0.026
NP_440071.1_6 Forward -394 -380 13.417 0.278
NP_441462.1_2 Forward -215 -205 11.5831 0.00406
NP_441462.1_2 Reverse -206 -216 11.5831 0.00406
NP_443062.1_1 Reverse -206 -224 5.32818 0.231
NP_443062.1_1 Reverse -251 -269 3.37804 0.3
NP_441410.1_3 Reverse -137 -156 6.09597 0.23
NP_440519.1_8 Reverse -56 -72 6.25339 0.21
NP_442204.1_9 Reverse -27 -45 16.7429 0.235
NP_442537.1_3 Reverse -359 -378 12.5858 0.253
NP_440516.1_8 Forward -215 -206 16.9127 0.00442
NP_440516.1_8 Reverse -206 -215 16.9127 0.00442
NP_441033.1_2 Forward -225 -206 -8.65367 0.293
NP_442428.1_5 Forward -214 -207 15.8704 0.0124
NP_442428.1_5 Reverse -207 -214 15.8704 0.0124
NP_442120.1_10 Forward -389 -370 1.27776 0.156
NP_441867.1_2 Reverse -259 -278 -7.37537 0.189
NP_441867.1_2 Reverse -64 -83 -14.5535 0.288
NP_440673.1_3 Forward -213 -206 12.4288 0.0426
NP_440673.1_3 Reverse -208 -215 12.4288 0.0426
NP_440673.1_3 Reverse -252 -259 6.23397 0.283
NP_440865.1_9 Reverse -140 -159 2.3594 0.116
NP_441052.1_2 Forward -215 -205 19.9412 0.00106
NP_441052.1_2 Reverse -206 -216 10.5014 0.0285
NP_441052.1_2 Reverse -186 -196 3.22496 0.182
NP_442219.1_9 Forward -214 -205 17.7976 0.00718
NP_442219.1_9 Reverse -207 -216 8.35786 0.0681
NP_440436.1_4 Reverse -207 -216 18.1905 0.00233
NP_440436.1_4 Forward -214 -205 17.2072 0.00233
NP_441884.1_9 Forward -218 -199 -23.895 0.284
NP_441336.1_10 Reverse -55 -74 15.3391 0.113
NP_440314.1_9 Forward -214 -195 -10.3253 0.295
NP_441719.1_4 Forward -214 -207 16.3621 0.0124
NP_441719.1_4 Reverse -207 -214 16.3621 0.0124
NP_441733.1_10 Reverse -203 -216 7.09911 0.156
NP_441363.1_4 Reverse -325 -344 7.96426 0.277
NP_442813.1_4 Forward -351 -332 -9.14533 0.299
NP_442366.1_3 Reverse -205 -223 -0.374176 0.19
NP_442366.1_3 Forward -216 -198 -4.70074 0.275
NP_442366.1_5 Forward -218 -208 13.3526 0.0775
NP_439949.1_7 Forward -117 -103 10.226 0.293
NP_441115.1_4 Forward -289 -271 8.17984 0.257
NP_442694.1_9 Forward -100 -81 11.7992 0.207
NP_442206.1_1 Forward -114 -95 -7.96535 0.219
NP_440288.1_3 Reverse -265 -284 10.7175 0.15
NP_443054.1_2 Reverse -204 -218 9.04604 0.102
NP_441851.1_5 Reverse -93 -112 10.0292 0.23
NP_441851.1_10 Forward -216 -206 16.008 0.00552
NP_441851.1_10 Reverse -205 -215 15.8113 0.00552
NP_441851.1_10 Forward -390 -380 11.9764 0.0583
NP_441851.1_10 Reverse -374 -384 4.20827 0.282
NP_442622.1_8 Reverse -206 -224 -9.12563 0.143
NP_441668.1_4 Reverse -196 -215 -0.0988766 0.248
NP_441668.1_4 Forward -225 -206 -2.55715 0.291
NP_442515.1_1 Forward -216 -202 10.3243 0.0533
NP_442515.1_1 Reverse -205 -219 5.40779 0.107
NP_442515.1_1 Forward -260 -246 -1.27871 0.251
NP_441396.1_5 Forward -121 -112 15.9293 0.205
NP_441396.1_5 Forward -396 -387 7.47288 0.252
NP_441982.1_6 Forward -97 -88 13.8222 0.274
NP_440463.1_8 Reverse -373 -392 7.49989 0.264
NP_440165.1_5 Forward -216 -197 -8.16202 0.292
NP_441349.1_10 Forward -269 -250 -8.16202 0.269
NP_441349.1_10 Forward -225 -206 -9.34199 0.289
NP_442024.1_4 Forward -392 -373 9.63589 0.258
NP_440389.1_2 Reverse -206 -225 13.1758 0.262
NP_440389.1_5 Reverse -67 -86 16.4644 0.189
NP_440432.1_9 Forward -214 -199 7.74804 0.0427
NP_440432.1_9 Reverse -207 -222 0.471552 0.159
NP_442843.1_1 Reverse -207 -226 -0.39387 0.186
NP_442843.1_1 Reverse -53 -72 -2.65548 0.209
NP_440474.1_8 Reverse -207 -221 9.24208 0.165
NP_440431.1_3 Forward -104 -85 -10.9153 0.28
NP_440431.1_5 Forward -64 -45 10.4225 0.195
NP_442450.1_5 Forward -217 -207 7.55152 0.13
NP_440588.1_2 Forward -341 -322 -5.31042 0.247
NP_440588.1_2 Forward -224 -205 -6.58872 0.285
NP_441570.1_1 Reverse -206 -224 -14.9272 0.227
NP_441570.1_1 Forward -215 -197 -17.8771 0.295
NP_441078.1_4 Forward -215 -206 19.6659 0.0007
NP_441078.1_4 Reverse -206 -215 19.6659 0.0007
NP_440539.1_9 Forward -82 -63 -6.58872 0.286
NP_441663.1_8 Forward -266 -247 -1.67217 0.246
NP_441663.1_8 Reverse -335 -354 -1.96717 0.257
NP_442443.1_1 Reverse -66 -85 -5.60541 0.282
NP_440526.1_3 Reverse -381 -392 1.43483 0.267
NP_440526.1_3 Forward -214 -203 1.04151 0.267
NP_441432.1_8 Reverse -205 -214 16.8143 0.00595
NP_441432.1_8 Forward -216 -207 8.25953 0.0755
NP_441432.1_8 Forward -384 -375 5.50626 0.151
NP_441333.1_2 Forward -306 -293 17.6323 0.189
NP_442320.1_8 Forward -221 -207 5.01447 0.0442
NP_442320.1_8 Reverse -200 -214 3.63784 0.0578
NP_441732.1_2 Forward -219 -203 -16.5594 0.174
NP_441732.1_2 Reverse -179 -195 -17.641 0.281
NP_440629.1_4 Forward -73 -54 13.6675 0.217
NP_440760.1_1 Reverse -206 -225 -5.21209 0.0493
NP_440760.1_1 Forward -215 -196 -21.24 0.233
NP_441805.1_6 Reverse -57 -76 7.96426 0.288
NP_442727.1_1 Forward -346 -332 11.5043 0.293
NP_440713.1_4 Reverse -370 -389 2.16274 0.27
NP_442489.1_7 Forward -215 -206 20.1576 0.000695
NP_442489.1_7 Reverse -206 -215 20.1576 0.000695
NP_442489.1_7 Reverse -374 -383 -1.27858 0.185
NP_442079.1_7 Forward -214 -195 -0.295539 0.29
NP_440559.1_1 Forward -214 -205 17.4043 0.00658
NP_440559.1_1 Reverse -207 -216 8.75118 0.0586
NP_441659.2_8 Forward -215 -205 18.1713 0.00133
NP_441659.2_8 Reverse -206 -216 11.9764 0.0147
NP_440786.1_10 Reverse -344 -363 18.879 0.22
NP_441022.1_1 Reverse -302 -311 11.6421 0.274
NP_440315.1_6 Reverse -328 -344 1.73016 0.249
NP_442346.1_5 Reverse -205 -215 16.6963 0.00248
NP_442346.1_5 Forward -216 -206 9.02648 0.118
NP_442346.1_10 Forward -116 -97 -2.16383 0.294
NP_440352.1_5 Reverse -92 -111 12.2664 0.229
NP_440352.1_5 Forward -260 -241 11.0983 0.267
NP_440545.1_3 Forward -393 -376 5.44704 0.0616
NP_440545.1_3 Reverse -376 -393 -5.1727 0.242
NP_441653.1_2 Reverse -195 -214 2.27338 0.295
NP_442551.1_4 Forward -116 -101 -1.88839 0.25
NP_442603.1_7 Forward -215 -201 7.86545 0.193
NP_441888.1_7 Forward -220 -206 2.85119 0.225
NP_441888.1_7 Reverse -201 -215 2.85119 0.225
NP_441948.1_4 Forward -222 -204 -2.53746 0.169
NP_441948.1_4 Reverse -199 -217 -2.93078 0.179
NP_442732.1_3 Reverse -241 -251 16.8925 0.212
NP_441833.1_4 Forward -214 -207 15.9687 0.0124
NP_441833.1_4 Reverse -207 -214 15.9687 0.0124
NP_441329.1_6 Forward -302 -283 3.10306 0.217
NP_441112.1_6 Forward -100 -81 -4.32711 0.296
NP_441112.1_8 Reverse -84 -103 3.83436 0.232
NP_442162.1_9 Forward -214 -207 16.2637 0.0124
NP_442162.1_9 Reverse -207 -214 16.2637 0.0124
NP_440671.1_4 Reverse -368 -382 8.94771 0.188
NP_442199.1_5 Reverse -198 -217 11.7008 0.0558
NP_442199.1_5 Forward -296 -277 -4.13045 0.219
NP_442199.1_7 Forward -98 -79 3.44025 0.245
NP_442140.1_3 Reverse -207 -217 16.2046 0.0255
NP_442140.1_3 Forward -214 -204 10.3048 0.0902
NP_442140.1_3 Reverse -369 -379 3.71661 0.283
NP_441609.1_1 Reverse -74 -93 -2.0655 0.278
NP_440875.1_2 Forward -382 -363 11.0125 0.137
NP_440875.1_9 Reverse -253 -263 7.98268 0.251
NP_440875.1_9 Reverse -281 -291 7.88535 0.255
NP_441813.1_5 Reverse -204 -214 18.1713 0.00743
NP_441813.1_5 Forward -217 -207 9.91146 0.021
NP_440594.1_6 Reverse -377 -396 13.175 0.169
NP_440590.1_4 Forward -214 -201 2.57589 0.0845
NP_440590.1_4 Reverse -207 -220 1.39592 0.125
NP_440567.1_1 Reverse -207 -221 3.8345 0.135
NP_442497.1_10 Forward -214 -205 10.4228 0.0087
NP_442497.1_10 Reverse -207 -216 10.4228 0.0087
NP_440821.1_4 Forward -217 -207 10.2065 0.0163
NP_440821.1_4 Reverse -204 -214 9.41981 0.0286
NP_441239.1_9 Forward -217 -205 12.3303 0.0477
NP_441239.1_9 Forward -63 -51 9.97041 0.0912
NP_441239.1_9 Reverse -204 -216 7.80712 0.148
NP_441892.1_1 Forward -224 -207 -5.56602 0.283
NP_442044.1_1 Reverse -375 -394 -6.49039 0.206
NP_442044.1_1 Forward -238 -219 -12.8819 0.273
NP_442193.1_1 Forward -351 -333 8.86894 0.26
NP_442270.1_6 Reverse -205 -223 14.7688 0.291
NP_440900.1_4 Reverse -54 -73 18.0925 0.271
NP_442216.1_4 Reverse -107 -115 8.1805 0.255
NP_440354.1_7 Reverse -200 -218 8.96727 0.231
NP_442138.1_10 Forward -215 -196 3.24438 0.115
NP_442052.1_8 Forward -267 -257 11.9764 0.297
NP_440546.1_4 Reverse -206 -216 11.8882 0.0679
NP_440546.1_4 Forward -215 -205 10.046 0.109
NP_440462.1_6 Reverse -204 -214 9.61647 0.0429
NP_440462.1_6 Forward -217 -207 9.02648 0.0498
NP_440868.1_4 Forward -219 -207 8.39711 0.0602
NP_440868.1_4 Reverse -202 -214 7.70879 0.0648
NP_441204.1_1 Reverse -197 -216 6.19431 0.268
NP_440341.1_7 Forward -89 -75 12.3893 0.203
NP_441084.1_6 Reverse -366 -380 9.24716 0.29
NP_440653.1_10 Reverse -135 -154 4.22769 0.252
NP_440696.1_6 Reverse -363 -382 8.35759 0.231
NP_442039.1_4 Forward -214 -207 15.1821 0.0124
NP_442039.1_4 Reverse -207 -214 15.1821 0.0124
NP_442039.1_7 Reverse -55 -65 15.418 0.211
NP_440825.1_7 Reverse -207 -217 12.4217 0.155
NP_442696.1_6 Forward -74 -55 -4.13045 0.159
NP_442837.1_3 Forward -214 -207 15.7721 0.0124
NP_442837.1_3 Reverse -207 -214 15.7721 0.0124
NP_440160.1_2 Forward -389 -370 -6.68705 0.283
NP_442053.1_1 Forward -215 -206 18.3876 0.0007
NP_442053.1_1 Reverse -206 -215 18.3876 0.0007
NP_442053.1_1 Forward -155 -146 7.17789 0.104
NP_440505.1_3 Reverse -204 -214 18.3679 0.00213
NP_440505.1_3 Forward -217 -207 6.76487 0.169
NP_441252.1_6 Reverse -78 -85 14.3954 0.168
NP_442532.1_7 Forward -389 -375 4.62115 0.171
NP_442532.1_7 Reverse -206 -220 3.63784 0.192
NP_442009.1_9 Forward -82 -63 11.7992 0.226
NP_440914.1_1 Forward -215 -205 17.5935 0.000537
NP_440914.1_1 Reverse -206 -216 8.6151 0.186
NP_441011.1_8 Reverse -207 -216 16.9127 0.00602
NP_441011.1_8 Forward -214 -205 8.25953 0.144
NP_442533.1_6 Forward -215 -206 17.2076 0.00137
NP_442533.1_6 Reverse -206 -215 17.2076 0.00137
NP_442533.1_6 Forward -61 -52 2.65466 0.246
NP_442229.1_1 Forward -63 -49 4.91554 0.296
NP_442535.1_2 Reverse -75 -94 10.2259 0.194
NP_441482.1_7 Reverse -200 -214 -4.7203 0.156
NP_439944.1_9 Forward -214 -204 10.5014 0.0887
NP_441028.1_6 Reverse -383 -393 6.27276 0.23
NP_441527.1_4 Forward -259 -240 -5.96867 0.212
NP_441527.1_7 Reverse -245 -264 9.34008 0.282
NP_440115.1_6 Reverse -203 -213 6.76487 0.167
NP_441170.1_4 Forward -204 -186 5.72234 0.22
NP_441106.1_1 Forward -216 -207 18.191 0.0028
NP_441106.1_1 Reverse -205 -214 9.63616 0.0311
NP_442249.1_10 Reverse -223 -242 9.43923 0.286
NP_001035870.1_3 Reverse -195 -214 4.32602 0.163
NP_442306.1_10 Reverse -201 -220 -19.3717 0.197
NP_441286.1_1 Reverse -205 -217 6.03717 0.0258
NP_441286.1_1 Forward -216 -204 3.38223 0.0467
NP_440670.1_8 Forward -215 -206 18.3876 0.000699
NP_440670.1_8 Reverse -206 -215 18.3876 0.000699
NP_440886.1_7 Forward -216 -206 17.7774 0.0011
NP_440886.1_7 Reverse -205 -215 7.94438 0.0805
NP_442614.1_2 Forward -390 -376 8.75105 0.248
NP_441069.1_6 Forward -380 -367 21.3571 0.188
NP_440223.1_6 Reverse -210 -227 12.4285 0.249
NP_440907.2_8 Reverse -207 -217 14.2375 0.0312
NP_442264.1_2 Reverse -246 -263 7.70866 0.231
NP_441021.1_1 Forward -214 -195 -10.522 0.24
NP_440841.1_4 Forward -217 -198 -6.49039 0.215
NP_441463.1_3 Reverse -196 -215 2.45773 0.117
NP_441463.1_3 Forward -72 -53 -5.40875 0.226
NP_441463.1_3 Forward -225 -206 -6.58872 0.246
NP_442842.1_10 Forward -356 -337 0.756665 0.257
NP_441626.1_2 Forward -214 -207 15.7721 0.0124
NP_441626.1_2 Reverse -207 -214 15.7721 0.0124
NP_441460.1_2 Forward -145 -132 13.49 0.289
NP_442794.1_1 Reverse -202 -214 7.4138 0.138
NP_442615.1_1 Reverse -197 -215 -0.7675 0.121
NP_442615.1_1 Forward -224 -206 -2.14413 0.139
NP_440387.1_1 Reverse -206 -222 8.61333 0.0282
NP_440387.1_1 Reverse -374 -390 4.18844 0.0455
NP_440387.1_1 Forward -215 -199 -1.3181 0.142
NP_441431.1_2 Forward -64 -50 6.78381 0.261
NP_441836.1_2 Reverse -244 -263 5.40766 0.124
NP_441993.1_1 Reverse -276 -295 0.874656 0.29
NP_440114.1_10 Reverse -206 -220 11.406 0.115
NP_440114.1_10 Reverse -52 -66 8.65272 0.198
NP_440114.1_10 Forward -215 -201 6.3911 0.273
NP_441237.1_9 Forward -259 -249 9.7148 0.272
NP_440457.1_1 Reverse -202 -214 -0.649339 0.271
NP_440798.1_6 Reverse -207 -220 4.54251 0.145
NP_440801.1_8 Reverse -205 -224 1.17943 0.246
NP_440801.1_8 Reverse -64 -83 -2.16383 0.294
NP_442297.1_3 Reverse -200 -219 7.76679 0.289
NP_442297.1_4 Forward -219 -200 11.9461 0.294
NP_442509.1_9 Reverse -206 -216 16.2041 0.00739
NP_442509.1_9 Reverse -326 -336 10.6976 0.163
NP_442509.1_9 Forward -215 -205 8.14104 0.192
NP_441489.1_3 Forward -307 -293 7.74647 0.249
NP_442514.1_10 Reverse -362 -381 5.40766 0.276
NP_440554.1_4 Forward -214 -204 8.92815 0.0646
NP_440554.1_4 Reverse -207 -217 7.35486 0.103
NP_442862.1_3 Forward -310 -293 4.16874 0.295
NP_441885.1_5 Forward -215 -205 20.9245 0.000538
NP_441885.1_5 Reverse -206 -216 11.4848 0.00668
NP_440478.1_10 Forward -217 -203 18.4858 0.107
NP_442341.1_7 Reverse -205 -219 9.34103 0.0751
NP_442341.1_9 Forward -262 -248 5.70218 0.258
NP_440423.1_6 Forward -223 -204 -12.3902 0.195
NP_443000.1_7 Reverse -204 -214 19.9412 0.00223
NP_443000.1_7 Forward -217 -207 1.94665 0.226
NP_440507.2_3 Reverse -49 -68 8.75009 0.244
NP_440727.1_3 Reverse -27 -46 13.0775 0.283
NP_440275.1_3 Reverse -204 -214 15.123 0.0182
NP_440275.1_3 Forward -217 -207 8.33817 0.0602
NP_440091.1_1 Forward -219 -207 1.41561 0.197
NP_440091.1_1 Reverse -202 -214 -0.452677 0.273
NP_440679.1_4 Reverse -213 -232 10.3242 0.261
NP_440679.1_10 Forward -68 -49 -20.945 0.289
NP_442451.1_2 Forward -69 -50 2.75272 0.143
NP_442686.1_2 Reverse -207 -221 19.2725 0.289
NP_441207.1_7 Forward -302 -288 17.9685 0.179
NP_441207.1_7 Forward -250 -236 7.7064 0.295
NP_440149.1_8 Reverse -206 -225 -4.72043 0.213
NP_440149.1_8 Reverse -52 -71 -6.58872 0.255
NP_441875.1_7 Reverse -79 -89 17.0896 0.227
NP_441105.1_3 Reverse -195 -214 1.76941 0.11
NP_441105.1_3 Reverse -369 -388 -6.58872 0.236
NP_440216.1_1 Forward -215 -201 6.98109 0.0111
NP_440216.1_1 Reverse -206 -220 5.40779 0.0209
NP_440216.1_9 Forward -287 -278 6.5879 0.289
NP_440172.1_1 Forward -215 -205 15.0247 0.00945
NP_440172.1_1 Forward -61 -51 9.61647 0.0586
NP_440172.1_1 Reverse -206 -216 8.73149 0.0586
NP_442015.1_10 Reverse -202 -215 2.77255 0.187
NP_442015.1_10 Forward -219 -206 1.78924 0.204
NP_441045.1_1 Forward -311 -292 13.9625 0.26
NP_441045.1_2 Reverse -81 -100 11.3075 0.234
NP_441226.1_7 Forward -214 -207 14.4934 0.0123
NP_441226.1_7 Reverse -207 -214 14.4934 0.0123
NP_441226.1_7 Forward -238 -231 9.47853 0.147
NP_441111.1_7 Forward -214 -206 18.7023 0.00294
NP_441111.1_7 Reverse -207 -215 18.7023 0.00294
NP_440244.1_1 Forward -391 -372 -0.39387 0.187
NP_440244.1_1 Reverse -253 -272 -3.63879 0.23
NP_441766.1_2 Forward -215 -206 17.5026 0.00297
NP_441766.1_2 Reverse -206 -215 17.5026 0.00297
NP_442417.1_5 Reverse -206 -220 10.6193 0.11
NP_440416.1_9 Reverse -199 -218 -16.5201 0.216
NP_443052.1_9 Forward -72 -53 6.39097 0.138
NP_443052.1_9 Reverse -54 -73 0.294447 0.2
NP_442116.1_6 Forward -310 -293 15.4263 0.133
NP_442154.1_1 Forward -350 -332 -17.6804 0.262
NP_440261.1_5 Forward -214 -201 -12.0754 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACTTTTTAGGGGGGGAAGGCATCCGCCATGGTATGCAGGGAGCCAATATTGCCGTTCCTTTTGTGGCGGATTATCTCCGGGGTCATGTACAAGCTTTTGAAAAATATGAACAGGCCATGAAAGCCCATTTTGCTGAACCCTGGCAACGGACAGAAAAATTAAGCCAACGGGTTTACCTCGAATTCGGCGATCGCCAGATTGATTTGGGGGTGACCTACTTGAGTTACCTCCGCTATGATGACGTGCTGGATCTCCTTTTCCATTACCGATTTGATAGGATCTATGGGGGCATTACTCCCCTGTTGCTCAAAAAAGTTGCCCAATTTAGCCAGCAGTGCCGCCAATGGCTCAGAAAACTCTCACCATGATTAGAGCCAATAAAACCAATTATCCCTAAACG

CDS

ATGAAGGTTAAAGTAATCCTCAAAATCTTAGAACGGGATGGTTGGTACGTAGCTCGAATACGGGGAAGTCATCGGCAATTGAAGCACCCCCACAAGGCAGGTTTGGTAACTGTACTGGGCAAACCCAGTGACGAATTAGCCCCTGGGACACTAGCCAGTATTCTCAAGCAATCTTCTCAAGCAATCAGGTATTACTTTATGAAGTATTTAGTCATCATTGAAACGACAACAACGGGATTTTCCGCCTATTCTCCCGATTTACCAGGATGTGTGGCAACAGGAAAAACGAAGCAAGAAGTTGAACAAAATATGTCGGAGGCGATCGCCTTTCACTTGGAGGGAATGCGTTTAGAAGGATTAACTATCCCAGAGCCAACTTCCTTTTCTGCCTACGTAACAGTTGCGGCTTAA

Protein

MKVKVILKILERDGWYVARIRGSHRQLKHPHKAGLVTVLGKPSDELAPGTLASILKQSSQAIRYYFMKYLVIIETTTTGFSAYSPDLPGCVATGKTKQEVEQNMSEAIAFHLEGMRLEGLTIPEPTSFSAYVTVAA