Your browser is old and dusty. Try Google Chrome!

Details for slr1984

ORF slr1984
Accession NP_441548.1
Symbol nbp1,rps1b
Category Ribosomal proteins: synthesis and modification
Definition nucleic acid-binding protein, 30S ribosomal protein S1 homolog
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -292 -278 4.52282 0.147
NP_440795.1_7 Forward -292 -285 14.6904 0.0123
NP_440795.1_7 Reverse -285 -292 14.6904 0.0123
NP_441418.1_6 Reverse -317 -336 -30.0898 0.256
NP_442291.1_5 Forward -294 -278 3.20513 0.114
NP_442291.1_5 Reverse -283 -299 1.73016 0.14
NP_441453.1_4 Reverse -284 -292 16.539 0.00633
NP_441453.1_4 Forward -293 -285 16.539 0.00633
NP_441453.1_7 Reverse -258 -265 12.1338 0.295
NP_442877.1_3 Forward -343 -324 10.3234 0.257
NP_442151.1_6 Reverse -284 -298 15.6342 0.0221
NP_442151.1_6 Forward -293 -279 11.7993 0.091
NP_442151.1_6 Reverse -224 -238 10.9143 0.113
NP_441818.1_1 Reverse -285 -296 18.8393 0.00301
NP_441818.1_1 Forward -292 -281 9.59626 0.232
NP_440226.1_1 Reverse -284 -303 16.7157 0.0213
NP_441630.1_3 Forward -323 -304 0.786102 0.265
NP_442655.1_10 Reverse -314 -333 -0.787193 0.178
NP_443002.1_5 Forward -244 -226 9.6548 0.285
NP_442173.1_1 Forward -292 -284 15.4574 0.00633
NP_442173.1_1 Reverse -285 -293 15.4574 0.00633
NP_442173.1_3 Forward -102 -92 15.6147 0.287
NP_442752.1_4 Forward -293 -286 13.8055 0.0199
NP_442752.1_4 Reverse -284 -291 13.8055 0.0199
NP_442752.1_4 Reverse -330 -337 5.34899 0.221
NP_443027.1_4 Reverse -282 -292 16.2046 0.0437
NP_443027.1_4 Forward -295 -285 14.0414 0.0452
NP_441745.1_3 Forward -247 -228 13.3716 0.282
NP_441812.1_3 Forward -294 -280 20.8458 0.00667
NP_442975.1_10 Reverse -280 -294 21.3367 0.00107
NP_442975.1_10 Forward -297 -283 13.1753 0.0459
NP_440784.1_7 Forward -292 -285 15.9687 0.0123
NP_440784.1_7 Reverse -285 -292 15.9687 0.0123
NP_442909.1_7 Reverse -337 -351 10.0287 0.14
NP_442861.1_4 Reverse -111 -130 -1.08295 0.297
NP_440061.1_9 Forward -334 -320 5.1122 0.294
NP_440110.1_8 Reverse -225 -244 12.3892 0.0878
NP_442062.1_6 Reverse -274 -292 14.7688 0.269
NP_442062.1_8 Reverse -284 -294 17.3846 0.00193
NP_442062.1_8 Forward -293 -283 10.3048 0.0493
NP_441900.1_2 Forward -243 -225 0.411736 0.258
NP_440304.1_4 Reverse -282 -292 19.9412 0.00364
NP_440304.1_4 Forward -295 -285 10.8948 0.051
NP_442242.1_4 Forward -292 -285 14.3954 0.0124
NP_442242.1_4 Reverse -285 -292 14.3954 0.0124
NP_440044.1_8 Forward -292 -273 4.03102 0.121
NP_441619.1_8 Reverse -278 -292 6.58715 0.295
NP_441208.1_9 Forward -296 -282 4.81781 0.285
NP_441594.1_6 Reverse -247 -266 2.45773 0.251
NP_441594.1_6 Reverse -275 -294 0.982764 0.276
NP_440518.1_3 Forward -60 -41 7.96345 0.295
NP_442110.1_7 Forward -293 -279 10.6193 0.0644
NP_442110.1_7 Forward -328 -314 2.5562 0.222
NP_442110.1_7 Reverse -284 -298 0.294584 0.264
NP_442367.1_1 Forward -322 -303 -13.7669 0.286
NP_442726.1_7 Forward -240 -222 1.19912 0.252
NP_441083.1_5 Reverse -284 -294 20.3345 0.00053
NP_441083.1_5 Forward -293 -283 11.2881 0.0159
NP_442827.1_8 Forward -301 -282 9.04509 0.0741
NP_442827.1_8 Reverse -276 -295 -0.984623 0.238
NP_441738.1_2 Forward -291 -284 15.28 0.0102
NP_441738.1_2 Reverse -286 -293 15.28 0.0102
NP_440209.1_1 Reverse -284 -292 18.1123 0.00295
NP_440209.1_1 Forward -293 -285 18.1123 0.00295
NP_442889.1_8 Reverse -281 -295 17.4035 0.0176
NP_440056.1_9 Reverse -37 -56 13.1894 0.295
NP_441713.1_1 Reverse -59 -78 -15.1435 0.26
NP_441770.1_5 Reverse -276 -295 18.7807 0.0473
NP_440178.1_7 Reverse -283 -302 3.6377 0.0199
NP_440178.1_7 Forward -294 -275 -13.7669 0.143
NP_442601.1_5 Reverse -317 -336 18.289 0.123
NP_441716.1_1 Reverse -284 -298 13.4709 0.0689
NP_442111.1_4 Forward -304 -290 3.63784 0.236
NP_442111.1_4 Forward -294 -280 1.96621 0.292
NP_440906.1_5 Forward -292 -285 15.8704 0.0124
NP_440906.1_5 Reverse -285 -292 15.8704 0.0124
NP_440747.1_10 Forward -296 -284 7.51213 0.00286
NP_440747.1_10 Reverse -281 -293 -1.92764 0.0192
NP_441130.1_10 Forward -295 -281 6.78443 0.177
NP_442973.1_5 Reverse -275 -294 15.1424 0.117
NP_441486.1_1 Forward -296 -282 12.586 0.0112
NP_441486.1_1 Reverse -281 -295 11.996 0.0136
NP_440944.1_2 Reverse -369 -388 5.50599 0.194
NP_442634.1_2 Reverse -247 -266 14.6508 0.115
NP_442634.1_4 Forward -295 -281 -1.96703 0.149
NP_442634.1_4 Reverse -282 -296 -2.26202 0.149
NP_441014.1_5 Forward -388 -370 8.96727 0.291
NP_441014.1_8 Forward -328 -309 -7.37537 0.278
NP_441014.1_10 Reverse -283 -302 1.57197 0.227
NP_442848.1_1 Forward -299 -285 7.17775 0.0791
NP_442848.1_1 Reverse -278 -292 -3.44199 0.267
NP_442848.1_4 Reverse -268 -282 8.16106 0.282
NP_443018.1_3 Forward -292 -285 14.8871 0.0123
NP_443018.1_3 Reverse -285 -292 14.8871 0.0123
NP_441634.1_8 Forward -295 -281 2.06454 0.173
NP_441634.1_8 Reverse -321 -335 1.96621 0.175
NP_441634.1_8 Forward -317 -303 1.96621 0.175
NP_441634.1_9 Reverse -307 -326 16.0265 0.161
NP_440376.1_1 Forward -293 -284 19.4693 0.000692
NP_440376.1_1 Reverse -284 -293 19.4693 0.000692
NP_440376.1_1 Reverse -83 -92 1.57302 0.246
NP_440376.1_1 Reverse -374 -383 0.983037 0.258
NP_441857.1_5 Reverse -146 -164 2.0841 0.277
NP_441588.1_4 Reverse -286 -296 8.63316 0.14
NP_441588.1_4 Forward -291 -281 6.66654 0.185
NP_442687.1_7 Reverse -283 -293 9.02648 0.0994
NP_442687.1_7 Forward -294 -284 8.92815 0.0994
NP_441846.1_1 Reverse -109 -128 10.6192 0.15
NP_441846.1_10 Reverse -311 -330 -20.945 0.256
NP_440642.1_10 Reverse -120 -134 5.21053 0.241
NP_441763.1_10 Forward -130 -111 5.99684 0.279
NP_440360.1_10 Forward -330 -316 5.01447 0.227
NP_442658.1_1 Reverse -282 -292 13.0576 0.04
NP_442658.1_1 Forward -295 -285 6.76441 0.214
NP_442782.1_2 Forward -293 -279 2.06454 0.278
NP_442205.1_9 Reverse -278 -294 16.2831 0.0259
NP_442205.1_9 Forward -299 -283 -3.38305 0.282
NP_440656.1_8 Reverse -273 -292 -5.80207 0.229
NP_441414.1_9 Reverse -284 -303 -10.1286 0.277
NP_441487.1_6 Forward -172 -153 0.687771 0.254
NP_441958.1_5 Reverse -283 -293 21.2195 0.000805
NP_441958.1_5 Forward -294 -284 12.2714 0.00183
NP_442836.1_5 Forward -299 -280 9.24257 0.134
NP_441097.1_2 Reverse -233 -250 16.4601 0.11
NP_439990.1_5 Forward -298 -285 9.95071 0.128
NP_440153.1_5 Forward -292 -278 1.57289 0.248
NP_442236.1_7 Reverse -139 -158 9.53756 0.253
NP_440993.1_4 Forward -155 -138 6.82368 0.241
NP_442853.1_5 Reverse -124 -143 7.07848 0.281
NP_441099.1_5 Forward -303 -284 -11.4069 0.28
NP_441294.1_7 Reverse -280 -294 14.914 0.033
NP_441294.1_7 Forward -297 -283 10.7864 0.171
NP_442438.1_10 Forward -344 -330 9.2427 0.0676
NP_442438.1_10 Reverse -279 -293 1.57289 0.191
NP_442438.1_10 Forward -298 -284 -0.393733 0.259
NP_441000.1_6 Reverse -283 -297 -4.62196 0.248
NP_441000.1_6 Forward -294 -280 -4.81863 0.252
NP_442771.1_1 Forward -295 -277 -6.66736 0.168
NP_440147.1_4 Reverse -282 -295 3.65753 0.183
NP_440147.1_4 Forward -295 -282 1.49425 0.226
NP_441550.1_8 Reverse -282 -292 13.0576 0.0273
NP_441550.1_8 Forward -295 -285 12.3692 0.0336
NP_441331.1_1 Reverse -187 -206 -3.83545 0.255
NP_441916.1_7 Forward -293 -283 18.9579 0.00144
NP_441916.1_7 Reverse -284 -294 10.3048 0.0261
NP_441916.1_10 Reverse -276 -295 5.30933 0.213
NP_440206.1_4 Forward -325 -306 12.3883 0.163
NP_440465.1_4 Forward -294 -275 9.93088 0.283
NP_441041.1_4 Reverse -284 -303 -0.688862 0.0969
NP_441041.1_7 Reverse -281 -293 9.65268 0.108
NP_441725.1_4 Forward -57 -43 2.5556 0.284
NP_441725.1_5 Reverse -285 -295 11.2881 0.0247
NP_441725.1_5 Forward -292 -282 11.1898 0.0247
NP_439966.1_7 Forward -295 -285 15.8108 0.0124
NP_439966.1_7 Reverse -282 -292 14.8275 0.0177
NP_442941.1_3 Forward -292 -282 19.9412 0.00262
NP_442941.1_3 Reverse -285 -295 19.9412 0.00262
NP_440289.1_2 Reverse -281 -294 13.3923 0.0132
NP_440289.1_2 Forward -296 -283 6.50913 0.0591
NP_441514.1_6 Reverse -239 -246 12.8221 0.252
NP_442281.1_1 Reverse -279 -293 15.9285 0.00992
NP_442281.1_1 Forward -298 -284 9.14375 0.0736
NP_440437.1_1 Reverse -278 -297 1.76941 0.143
NP_440437.1_1 Forward -338 -319 -2.16383 0.212
NP_442500.1_9 Forward -145 -126 17.994 0.189
NP_440498.1_1 Reverse -275 -293 -1.45582 0.225
NP_442982.1_5 Reverse -274 -293 5.11266 0.164
NP_441644.1_6 Forward -293 -283 19.0557 0.000803
NP_441644.1_6 Reverse -284 -294 17.3841 0.00127
NP_441644.1_6 Reverse -342 -352 8.3377 0.103
NP_441644.1_6 Forward -383 -373 4.30615 0.242
NP_440253.1_2 Reverse -284 -302 3.16574 0.122
NP_440929.1_8 Forward -293 -284 19.2726 0.000701
NP_440929.1_8 Reverse -284 -293 19.2726 0.000701
NP_440780.1_1 Forward -54 -35 7.49569 0.274
NP_442933.1_10 Forward -293 -284 17.601 0.00325
NP_442933.1_10 Reverse -284 -293 17.601 0.00325
NP_441751.2_8 Forward -292 -278 13.9626 0.0133
NP_441751.2_8 Reverse -285 -299 3.93283 0.0596
NP_442554.1_8 Forward -292 -282 16.9913 0.0065
NP_442554.1_8 Reverse -285 -295 15.9097 0.00747
NP_441762.1_7 Reverse -283 -295 -6.74586 0.284
NP_441762.1_7 Forward -294 -282 -6.94252 0.284
NP_442142.1_4 Forward -296 -283 14.7683 0.0302
NP_442142.1_4 Reverse -281 -294 13.5883 0.0348
NP_442142.1_4 Forward -329 -316 5.42692 0.192
NP_442292.1_1 Reverse -285 -294 18.486 0.00229
NP_442292.1_1 Forward -292 -283 17.5026 0.00435
NP_440895.1_6 Forward -357 -344 9.65572 0.22
NP_443009.1_5 Forward -294 -283 14.5128 0.02
NP_443009.1_5 Reverse -283 -294 10.1862 0.0792
NP_443009.1_5 Reverse -329 -340 4.8764 0.226
NP_443009.1_5 Forward -93 -82 4.18809 0.259
NP_441715.1_4 Reverse -285 -295 14.828 0.0268
NP_441715.1_4 Forward -292 -282 14.238 0.0295
NP_440015.1_9 Reverse -284 -302 13.4905 0.0636
NP_441198.1_8 Reverse -282 -292 13.2713 0.108
NP_441468.1_1 Forward -292 -285 15.8704 0.0124
NP_441468.1_1 Reverse -285 -292 15.8704 0.0124
NP_441015.1_10 Reverse -318 -337 -8.45701 0.273
NP_441015.1_10 Reverse -307 -326 -10.6203 0.286
NP_441673.1_1 Forward -293 -284 20.8459 0.000698
NP_441673.1_1 Reverse -284 -293 20.8459 0.000698
NP_441731.1_9 Reverse -226 -243 10.9536 0.277
NP_441956.1_1 Forward -317 -298 17.2626 0.225
NP_441876.1_9 Reverse -338 -348 11.7793 0.273
NP_441826.1_2 Forward -299 -285 4.22782 0.104
NP_441826.1_2 Reverse -278 -292 -2.55701 0.273
NP_441826.1_5 Reverse -314 -333 12.9791 0.117
NP_441379.1_2 Forward -44 -25 7.47261 0.263
NP_442868.1_6 Forward -295 -285 9.91146 0.038
NP_442868.1_6 Reverse -282 -292 1.06167 0.205
NP_442719.1_2 Forward -72 -54 -1.6532 0.175
NP_441056.1_1 Reverse -284 -303 -9.24366 0.295
NP_441612.1_2 Reverse -284 -294 8.54929 0.21
NP_442227.1_2 Forward -330 -311 -0.197208 0.253
NP_442227.1_2 Forward -333 -314 -1.96717 0.269
NP_442227.1_2 Reverse -335 -354 -3.83545 0.298
NP_442227.1_2 Forward -340 -321 -3.93378 0.3
NP_442427.1_3 Reverse -279 -297 2.57575 0.183
NP_442808.1_1 Reverse -283 -293 8.73102 0.0481
NP_442808.1_1 Forward -294 -284 8.63269 0.0481
NP_442808.1_1 Forward -333 -323 5.97777 0.134
NP_442808.1_1 Reverse -305 -315 5.78111 0.141
NP_440918.1_9 Forward -41 -22 18.4112 0.105
NP_440145.1_3 Reverse -274 -293 -0.39387 0.14
NP_440145.1_3 Forward -303 -284 -3.04881 0.185
NP_442542.1_9 Reverse -277 -291 4.71887 0.289
NP_442113.1_10 Forward -339 -320 2.65439 0.169
NP_442050.1_5 Reverse -282 -292 18.0724 0.00365
NP_442050.1_5 Forward -295 -285 16.4991 0.00812
NP_442789.1_4 Reverse -225 -244 -0.885524 0.209
NP_441518.1_3 Forward -303 -284 -14.4552 0.276
NP_441878.1_6 Reverse -283 -293 10.5014 0.0176
NP_441878.1_6 Forward -294 -284 10.4031 0.0176
NP_441878.1_6 Forward -259 -249 -0.0199663 0.163
NP_441878.1_6 Reverse -322 -332 -7.0998 0.204
NP_441878.1_6 Reverse -82 -92 -7.88644 0.278
NP_441036.1_8 Reverse -283 -293 15.713 0.00724
NP_441036.1_8 Forward -294 -284 8.33817 0.174
NP_441557.1_5 Forward -293 -284 19.9609 0.000699
NP_441557.1_5 Reverse -284 -293 19.9609 0.000699
NP_441445.1_1 Forward -302 -283 -0.295539 0.289
NP_441590.1_1 Forward -240 -221 10.2259 0.256
NP_442267.1_4 Reverse -93 -112 -0.000545616 0.287
NP_442419.1_2 Forward -320 -301 0.884433 0.238
NP_441308.1_8 Reverse -282 -292 13.353 0.218
NP_442183.1_1 Forward -293 -279 16.3225 0.0151
NP_442183.1_1 Reverse -284 -298 7.37441 0.143
NP_442183.1_9 Reverse -320 -330 9.12481 0.296
NP_441407.1_5 Reverse -274 -293 5.11266 0.222
NP_441549.1_9 Forward -297 -279 -6.1757 0.198
NP_441549.1_9 Forward -387 -369 -9.71562 0.258
NP_442170.1_5 Forward -293 -274 10.0292 0.0569
NP_442347.1_2 Reverse -285 -294 12.4878 0.056
NP_442347.1_2 Forward -292 -283 3.34298 0.284
NP_442965.1_2 Forward -173 -154 -8.26035 0.278
NP_441037.1_4 Reverse -282 -292 7.31769 0.237
NP_441633.1_3 Forward -295 -282 -6.17557 0.238
NP_440136.1_2 Forward -292 -285 15.9687 0.0123
NP_440136.1_2 Reverse -285 -292 15.9687 0.0123
NP_442998.1_10 Forward -291 -284 15.5754 0.0102
NP_442998.1_10 Reverse -286 -293 15.5754 0.0102
NP_440299.1_1 Forward -297 -284 4.44361 0.207
NP_441799.1_1 Reverse -280 -294 11.2087 0.0606
NP_441799.1_1 Forward -297 -283 11.012 0.0629
NP_442802.1_6 Forward -352 -333 -1.57384 0.204
NP_441007.1_10 Reverse -279 -292 4.73917 0.182
NP_441007.1_10 Reverse -318 -331 0.0192843 0.254
NP_440256.1_1 Forward -296 -277 3.83436 0.049
NP_440256.1_1 Reverse -281 -300 -1.27885 0.102
NP_440256.1_1 Forward -318 -299 -6.29373 0.207
NP_441118.1_2 Reverse -56 -75 11.2092 0.237
NP_441559.1_8 Forward -103 -89 -1.18038 0.181
NP_441559.1_8 Forward -57 -43 -5.90027 0.271
NP_441559.1_8 Forward -244 -230 -6.39192 0.277
NP_440915.1_6 Forward -297 -283 4.03116 0.1
NP_441296.1_9 Forward -249 -236 10.3434 0.266
NP_442452.1_3 Forward -109 -90 0.0977854 0.298
NP_441464.1_8 Forward -92 -78 11.8976 0.178
NP_441464.1_8 Forward -233 -219 4.22782 0.28
NP_440306.1_5 Forward -133 -114 5.80098 0.121
NP_439985.1_1 Reverse -369 -388 9.63589 0.191
NP_442993.1_1 Forward -293 -277 27.1979 0.00239
NP_442993.1_1 Reverse -284 -300 11.1699 0.0146
NP_442993.1_1 Reverse -83 -99 -14.1995 0.297
NP_442386.1_9 Forward -294 -285 13.8639 0.0289
NP_442386.1_9 Reverse -283 -292 6.39082 0.219
NP_441750.1_1 Reverse -308 -327 -5.9004 0.221
NP_441340.1_5 Forward -292 -285 15.6737 0.0124
NP_441340.1_5 Reverse -285 -292 15.6737 0.0124
NP_442791.1_5 Reverse -305 -324 -11.1119 0.287
NP_441952.1_9 Reverse -2 -21 17.0038 0.231
NP_440327.1_6 Forward -362 -343 7.66927 0.228
NP_442240.1_2 Reverse -254 -273 -20.3551 0.295
NP_440586.1_8 Forward -292 -285 13.2151 0.026
NP_440586.1_8 Reverse -285 -292 13.2151 0.026
NP_440586.1_8 Forward -143 -136 7.1186 0.272
NP_440586.1_8 Reverse -343 -350 5.8403 0.283
NP_440586.1_9 Forward -85 -66 6.58763 0.283
NP_442251.1_6 Forward -292 -285 15.2804 0.0124
NP_442251.1_6 Reverse -285 -292 15.2804 0.0124
NP_440684.1_9 Reverse -278 -292 7.37441 0.266
NP_441262.1_3 Reverse -284 -291 14.7888 0.0223
NP_441262.1_3 Forward -293 -286 14.7888 0.0223
NP_440027.1_3 Forward -272 -254 7.3932 0.211
NP_440027.1_8 Forward -296 -277 4.32522 0.291
NP_443051.1_1 Reverse -283 -292 19.5676 0.00335
NP_443051.1_1 Forward -294 -285 10.4228 0.00754
NP_440439.1_1 Reverse -281 -294 1.88757 0.139
NP_440439.1_1 Forward -296 -283 -0.177378 0.209
NP_442239.1_8 Reverse -313 -332 6.78429 0.263
NP_439943.1_7 Reverse -285 -304 1.86774 0.299
NP_440372.1_2 Forward -292 -285 16.3621 0.0124
NP_440372.1_2 Reverse -285 -292 16.3621 0.0124
NP_441181.1_4 Forward -93 -74 16.5182 0.271
NP_441789.1_9 Reverse -56 -75 11.9958 0.191
NP_440316.1_10 Reverse -322 -332 7.74818 0.246
NP_440139.1_1 Reverse -278 -297 3.63691 0.201
NP_441572.1_7 Forward -104 -85 -4.6221 0.24
NP_440267.1_2 Reverse -279 -293 9.83206 0.156
NP_442384.1_10 Forward -339 -326 2.87088 0.21
NP_442384.1_10 Reverse -284 -297 1.10092 0.268
NP_442035.1_8 Reverse -339 -353 13.8643 0.237
NP_442262.1_10 Forward -292 -285 14.1988 0.0123
NP_442262.1_10 Reverse -285 -292 14.1988 0.0123
NP_441689.1_5 Reverse -282 -292 17.8758 0.0158
NP_441689.1_5 Forward -295 -285 15.3192 0.0403
NP_440163.1_10 Forward -296 -286 11.3864 0.169
NP_440344.1_10 Reverse -277 -294 -5.95935 0.111
NP_440344.1_10 Reverse -299 -316 -10.3842 0.178
NP_440189.1_2 Reverse -276 -295 5.99764 0.25
NP_442065.1_7 Reverse -304 -322 2.96908 0.215
NP_440297.1_9 Reverse -285 -295 9.32148 0.0917
NP_440297.1_9 Forward -292 -282 9.22315 0.0917
NP_440297.1_9 Reverse -84 -94 -0.41329 0.283
NP_442280.1_10 Forward -382 -364 9.54524 0.232
NP_441592.1_4 Forward -293 -274 4.12936 0.158
NP_441896.1_3 Forward -208 -189 -1.7705 0.268
NP_440990.1_10 Reverse -318 -337 17.0107 0.261
NP_440937.1_5 Reverse -128 -147 9.14423 0.275
NP_440888.1_2 Reverse -284 -298 16.4202 0.00685
NP_440888.1_2 Forward -293 -279 14.4536 0.0176
NP_440792.1_8 Forward -315 -296 13.6675 0.285
NP_442033.1_10 Reverse -282 -301 -13.3736 0.287
NP_441543.1_2 Reverse -285 -294 16.9127 0.00359
NP_441543.1_2 Forward -292 -283 15.9293 0.00518
NP_442845.1_2 Reverse -278 -292 14.8476 0.0774
NP_442845.1_2 Forward -299 -285 3.34284 0.294
NP_441834.1_10 Forward -292 -273 4.42435 0.26
NP_441178.1_6 Forward -324 -305 2.45694 0.27
NP_441469.1_8 Forward -93 -84 10.1278 0.227
NP_441469.1_8 Reverse -283 -292 6.5879 0.227
NP_441469.1_8 Forward -294 -285 6.48957 0.227
NP_441548.1_1 Forward -350 -331 17.8957 0.0684
NP_441548.1_4 Forward -114 -95 22.418 0.032
NP_441548.1_8 Forward -92 -74 21.4553 0.0274
NP_441548.1_10 Forward -224 -205 23.3039 0.0563
NP_442315.1_1 Reverse -315 -333 3.95239 0.285
NP_443064.1_6 Reverse -284 -294 12.5669 0.0796
NP_443064.1_6 Forward -293 -283 10.8217 0.13
NP_442578.1_7 Forward -292 -285 14.5921 0.026
NP_442578.1_7 Reverse -285 -292 14.5921 0.026
NP_442578.1_7 Forward -133 -126 6.72562 0.18
NP_441462.1_2 Forward -293 -283 20.2362 0.000805
NP_441462.1_2 Reverse -284 -294 11.5831 0.00406
NP_441929.1_3 Forward -273 -254 5.50599 0.266
NP_443062.1_1 Reverse -284 -302 8.15589 0.159
NP_441601.1_4 Forward -333 -314 -5.21209 0.293
NP_441410.1_3 Reverse -275 -294 4.81767 0.261
NP_442204.1_1 Forward -102 -91 7.82682 0.112
NP_442204.1_1 Reverse -280 -291 0.157002 0.283
NP_442204.1_5 Reverse -274 -293 3.93269 0.18
NP_440454.1_2 Forward -128 -114 10.1338 0.291
NP_440516.1_2 Forward -268 -250 1.29745 0.201
NP_440516.1_8 Forward -293 -284 16.9127 0.00442
NP_440516.1_8 Reverse -284 -293 16.9127 0.00442
NP_440516.1_8 Forward -351 -342 -0.196935 0.185
NP_441785.1_1 Reverse -284 -298 11.9627 0.278
NP_442428.1_5 Forward -292 -285 15.8704 0.0124
NP_442428.1_5 Reverse -285 -292 15.8704 0.0124
NP_441867.1_2 Reverse -247 -266 -12.3902 0.253
NP_440673.1_3 Forward -291 -284 12.4288 0.0426
NP_440673.1_3 Reverse -286 -293 12.4288 0.0426
NP_440865.1_9 Reverse -278 -297 -6.78538 0.232
NP_441052.1_2 Reverse -284 -294 19.9412 0.00106
NP_441052.1_2 Forward -293 -283 10.4031 0.0285
NP_441052.1_2 Reverse -336 -346 3.71661 0.175
NP_442219.1_9 Reverse -285 -294 17.7976 0.00718
NP_442219.1_9 Forward -292 -283 8.25953 0.0681
NP_440436.1_4 Reverse -285 -294 17.2072 0.00233
NP_440436.1_4 Forward -292 -283 9.24241 0.0871
NP_440436.1_4 Forward -338 -329 6.48915 0.157
NP_440689.1_1 Forward -255 -237 11.6222 0.297
NP_442907.1_2 Reverse -285 -303 8.86894 0.259
NP_441719.1_2 Reverse -114 -128 13.925 0.278
NP_441719.1_4 Forward -292 -285 16.3621 0.0124
NP_441719.1_4 Reverse -285 -292 16.3621 0.0124
NP_441004.1_1 Reverse -272 -291 -12.1936 0.245
NP_441577.1_10 Forward -297 -278 10.4225 0.198
NP_442366.1_3 Forward -294 -276 9.95058 0.0529
NP_442366.1_5 Forward -236 -226 10.796 0.233
NP_440328.1_4 Reverse -129 -148 -1.27885 0.299
NP_443054.1_2 Reverse -282 -296 3.04785 0.24
NP_443054.1_2 Forward -295 -281 2.94952 0.24
NP_441851.1_10 Forward -294 -284 15.8113 0.00552
NP_441851.1_10 Reverse -283 -293 8.53483 0.114
NP_442622.1_8 Forward -332 -314 -18.4671 0.222
NP_442622.1_8 Reverse -306 -324 -18.5654 0.23
NP_442515.1_1 Forward -294 -280 2.65453 0.131
NP_442515.1_1 Reverse -283 -297 0.786239 0.18
NP_441396.1_5 Forward -208 -199 8.35786 0.224
NP_441046.1_2 Reverse -369 -388 6.19431 0.221
NP_442689.1_8 Reverse -112 -129 -6.35267 0.281
NP_441349.1_10 Forward -303 -284 13.1758 0.0192
NP_441349.1_10 Reverse -274 -293 10.9142 0.0232
NP_441349.1_10 Reverse -326 -345 -6.1954 0.223
NP_441409.1_6 Forward -299 -280 1.76941 0.0586
NP_441409.1_6 Reverse -278 -297 -7.27704 0.146
NP_442843.1_1 Forward -221 -202 -10.227 0.277
NP_442843.1_1 Reverse -364 -383 -10.3253 0.277
NP_439960.1_10 Forward -105 -87 -2.83245 0.258
NP_440474.1_8 Forward -292 -278 16.9119 0.0468
NP_440431.1_3 Forward -391 -372 -8.35868 0.232
NP_442450.1_5 Reverse -282 -292 9.41981 0.115
NP_442450.1_5 Forward -295 -285 9.32148 0.115
NP_442450.1_5 Forward -94 -84 4.99491 0.271
NP_440588.1_2 Reverse -275 -294 2.3594 0.121
NP_440195.1_4 Forward -143 -124 4.12936 0.297
NP_442006.1_2 Reverse -317 -334 -13.5308 0.197
NP_441570.1_1 Reverse -284 -302 11.0322 0.00838
NP_441570.1_1 Forward -293 -275 -9.42063 0.137
NP_441078.1_4 Forward -293 -284 19.6659 0.0007
NP_441078.1_4 Reverse -284 -293 19.6659 0.0007
NP_442348.1_2 Reverse -263 -272 13.4711 0.191
NP_442443.1_1 Reverse -315 -334 0.687771 0.215
NP_441094.1_6 Reverse -277 -294 17.0493 0.136
NP_440526.1_3 Reverse -285 -296 10.1862 0.0646
NP_440526.1_3 Forward -292 -281 1.82816 0.267
NP_441432.1_8 Reverse -283 -292 16.8143 0.00595
NP_441432.1_8 Forward -294 -285 16.8143 0.00595
NP_441333.1_1 Reverse -112 -122 11.5899 0.241
NP_442320.1_8 Reverse -278 -292 6.09611 0.0304
NP_442320.1_8 Forward -299 -285 4.71948 0.0472
NP_442344.1_7 Forward -292 -273 -5.11376 0.168
NP_441732.1_2 Reverse -280 -296 -7.11963 0.0695
NP_441030.1_6 Forward -385 -366 11.4074 0.283
NP_442003.1_4 Reverse -285 -304 11.3075 0.277
NP_442815.1_3 Forward -295 -276 18.1907 0.0625
NP_442797.1_1 Forward -86 -67 -4.6221 0.286
NP_442797.1_7 Forward -242 -224 -0.374176 0.282
NP_440199.1_10 Forward -296 -286 16.7946 0.0381
NP_440199.1_10 Reverse -281 -291 14.238 0.0861
NP_440913.1_1 Reverse -261 -279 6.01734 0.231
NP_442489.1_2 Forward -304 -285 1.27776 0.293
NP_442489.1_7 Forward -293 -284 20.1576 0.000695
NP_442489.1_7 Reverse -284 -293 20.1576 0.000695
NP_441830.1_2 Reverse -308 -327 2.94938 0.224
NP_440559.1_1 Reverse -285 -294 17.4043 0.00658
NP_440559.1_1 Forward -292 -283 8.65285 0.0586
NP_441659.2_8 Forward -293 -283 20.9245 0.000805
NP_441659.2_8 Reverse -284 -294 18.1713 0.00133
NP_441659.2_8 Forward -233 -223 2.83163 0.187
NP_441659.2_8 Reverse -342 -352 0.0783647 0.277
NP_442913.1_10 Reverse -74 -93 8.65258 0.0464
NP_442913.1_10 Forward -302 -283 -1.37718 0.17
NP_441040.1_5 Reverse -273 -292 5.70265 0.229
NP_439956.1_7 Forward -219 -200 1.86774 0.28
NP_442346.1_5 Forward -294 -284 16.6963 0.00248
NP_442346.1_5 Reverse -283 -293 16.303 0.00248
NP_442346.1_5 Forward -234 -224 8.33817 0.14
NP_440545.1_3 Reverse -79 -96 -5.1727 0.242
NP_440010.1_3 Reverse -314 -333 -4.6221 0.25
NP_440010.1_4 Forward -319 -300 2.55527 0.222
NP_441833.1_4 Forward -292 -285 15.9687 0.0124
NP_441833.1_4 Reverse -285 -292 15.9687 0.0124
NP_442799.1_8 Forward -351 -332 12.1797 0.172
NP_440912.1_3 Reverse -109 -128 7.96345 0.287
NP_441112.1_6 Forward -282 -263 4.03102 0.213
NP_441112.1_6 Reverse -274 -293 2.85105 0.241
NP_442162.1_9 Forward -292 -285 16.2637 0.0124
NP_442162.1_9 Reverse -285 -292 16.2637 0.0124
NP_442055.1_8 Forward -295 -276 12.88 0.254
NP_440671.1_4 Reverse -278 -292 16.2242 0.0318
NP_440671.1_4 Forward -299 -285 13.4709 0.0806
NP_440772.1_8 Forward -342 -323 9.24257 0.253
NP_442140.1_3 Reverse -343 -353 4.89658 0.238
NP_442140.1_3 Reverse -285 -295 4.40493 0.243
NP_441671.1_10 Reverse -273 -292 4.81767 0.219
NP_440875.1_9 Forward -291 -281 7.59334 0.255
NP_441813.1_5 Reverse -282 -292 15.9097 0.01
NP_441813.1_5 Forward -295 -285 15.9097 0.01
NP_440590.1_4 Reverse -285 -298 4.54251 0.0601
NP_440590.1_4 Forward -292 -279 -5.78224 0.289
NP_440567.1_1 Forward -292 -278 6.3911 0.0837
NP_442497.1_10 Forward -292 -283 17.601 0.00813
NP_442497.1_10 Reverse -285 -294 10.4228 0.0087
NP_440821.1_4 Forward -295 -285 18.2696 0.00448
NP_440821.1_4 Reverse -282 -292 11.0914 0.0146
NP_440227.1_2 Forward -392 -376 10.9733 0.28
NP_441239.1_9 Reverse -282 -294 12.1337 0.0494
NP_441239.1_9 Forward -323 -311 7.90546 0.147
NP_441239.1_9 Forward -295 -283 4.36554 0.253
NP_441892.1_1 Forward -302 -285 -1.33779 0.203
NP_441892.1_1 Reverse -275 -292 -5.76269 0.288
NP_442193.1_8 Reverse -333 -352 17.0099 0.211
NP_442270.1_9 Reverse -273 -292 -10.0303 0.249
NP_440219.1_1 Reverse -109 -128 13.4144 0.254
NP_442643.1_1 Reverse -83 -102 -10.9153 0.231
NP_441017.1_6 Reverse -280 -294 12.192 0.224
NP_442629.1_3 Reverse -315 -334 -0.295539 0.294
NP_441874.1_1 Reverse -274 -288 9.5377 0.277
NP_440833.1_6 Forward -381 -367 7.57046 0.278
NP_442216.1_4 Forward -248 -240 17.6202 0.23
NP_440546.1_4 Forward -293 -283 13.5365 0.0459
NP_440546.1_4 Reverse -284 -294 10.046 0.109
NP_440546.1_6 Reverse -364 -383 10.4225 0.247
NP_441230.1_6 Forward -322 -303 12.9791 0.212
NP_440024.1_8 Reverse -109 -128 16.6165 0.233
NP_440462.1_6 Reverse -282 -292 16.893 0.00853
NP_440462.1_6 Forward -295 -285 7.74818 0.0699
NP_440868.1_4 Forward -297 -285 5.93884 0.0879
NP_440868.1_4 Reverse -280 -292 5.93884 0.0879
NP_441084.1_6 Reverse -282 -296 10.7985 0.228
NP_440696.1_3 Reverse -79 -97 2.18243 0.217
NP_442039.1_4 Forward -292 -285 15.1821 0.0124
NP_442039.1_4 Reverse -285 -292 15.1821 0.0124
NP_442039.1_7 Forward -349 -339 9.91146 0.257
NP_442273.1_10 Forward -138 -120 8.57394 0.224
NP_441926.1_3 Forward -293 -277 24.7396 0.00176
NP_441926.1_3 Reverse -284 -300 6.15506 0.17
NP_442837.1_3 Forward -292 -285 15.7721 0.0124
NP_442837.1_3 Reverse -285 -292 15.7721 0.0124
NP_442053.1_1 Forward -293 -284 18.3876 0.0007
NP_442053.1_1 Reverse -284 -293 18.3876 0.0007
NP_440505.1_3 Forward -295 -285 16.303 0.00696
NP_440505.1_3 Reverse -282 -292 15.123 0.014
NP_440505.1_3 Reverse -261 -271 11.5831 0.0735
NP_440505.1_3 Forward -317 -307 4.40493 0.292
NP_441252.1_6 Reverse -378 -385 14.3954 0.168
NP_441203.1_1 Forward -327 -308 -19.5684 0.297
NP_442532.1_7 Forward -351 -337 2.16287 0.252
NP_440914.1_1 Reverse -284 -294 17.5935 0.000537
NP_440914.1_1 Forward -293 -283 16.3248 0.00196
NP_440914.1_1 Forward -351 -341 9.39583 0.186
NP_440914.1_1 Reverse -306 -316 8.12715 0.207
NP_441011.1_8 Forward -292 -283 16.6177 0.00602
NP_441011.1_8 Reverse -285 -294 8.25953 0.144
NP_442101.1_10 Reverse -276 -295 -13.2752 0.288
NP_442101.1_10 Forward -301 -282 -13.4719 0.293
NP_442533.1_1 Reverse -362 -381 -6.88371 0.182
NP_442533.1_1 Reverse -314 -333 -12.1936 0.236
NP_442533.1_6 Forward -293 -284 17.2076 0.00137
NP_442533.1_6 Reverse -284 -293 17.2076 0.00137
NP_442533.1_6 Forward -92 -83 4.81794 0.172
NP_442533.1_6 Forward -383 -374 2.75299 0.241
NP_442322.1_4 Forward -334 -317 -2.12512 0.228
NP_442229.1_3 Reverse -189 -206 12.3302 0.291
NP_441482.1_7 Reverse -278 -292 -1.37704 0.0683
NP_441482.1_7 Forward -299 -285 -8.94853 0.193
NP_439944.1_9 Reverse -285 -295 19.0562 0.00329
NP_439944.1_9 Forward -292 -282 17.6796 0.00347
NP_441697.1_5 Reverse -6 -25 -0.812105 0.204
NP_441697.1_5 Forward -36 -17 -9.88384 0.278
NP_441028.1_6 Reverse -160 -170 5.09279 0.267
NP_440116.1_8 Reverse -285 -304 -0.000545616 0.103
NP_441527.1_4 Forward -130 -111 -7.974 0.24
NP_441527.1_4 Forward -131 -112 -12.6531 0.292
NP_440115.1_6 Forward -55 -45 9.12481 0.121
NP_440115.1_6 Forward -318 -308 4.99491 0.277
NP_440007.1_9 Reverse -280 -294 2.85119 0.277
NP_440007.1_9 Forward -297 -283 1.47456 0.285
NP_441961.1_4 Reverse -326 -345 3.6377 0.277
NP_441170.1_4 Reverse -216 -234 5.52568 0.225
NP_441972.1_5 Reverse -225 -244 -6.1954 0.229
NP_441106.1_1 Reverse -283 -292 18.486 0.0028
NP_441106.1_1 Forward -294 -285 9.63616 0.0311
NP_439903.1_6 Forward -296 -277 6.09517 0.173
NP_439903.1_6 Reverse -281 -300 2.45694 0.226
NP_439903.1_6 Reverse -15 -34 -1.18128 0.293
NP_441286.1_1 Forward -294 -282 14.3953 0.00424
NP_441286.1_1 Reverse -283 -295 11.937 0.0108
NP_440670.1_8 Forward -293 -284 18.3876 0.000699
NP_440670.1_8 Reverse -284 -293 18.3876 0.000699
NP_440886.1_7 Reverse -283 -293 8.04271 0.0805
NP_440886.1_7 Forward -294 -284 7.94438 0.0805
NP_440886.1_7 Forward -333 -323 7.15773 0.103
NP_442614.1_2 Reverse -284 -298 5.89945 0.296
NP_442382.1_9 Reverse -200 -219 9.14342 0.281
NP_440205.1_3 Reverse -91 -110 5.211 0.282
NP_442072.1_9 Forward -294 -276 -21.712 0.212
NP_442072.1_9 Reverse -322 -340 -22.597 0.246
NP_441753.1_10 Reverse -248 -267 1.0811 0.277
NP_440907.2_8 Forward -292 -282 9.51767 0.103
NP_441021.1_8 Reverse -279 -297 3.75572 0.226
NP_441021.1_8 Reverse -325 -343 1.69077 0.259
NP_441463.1_3 Forward -303 -284 -2.26216 0.152
NP_441463.1_3 Reverse -296 -315 -9.14533 0.277
NP_441463.1_6 Reverse -282 -296 6.8991 0.267
NP_441626.1_2 Forward -292 -285 15.7721 0.0124
NP_441626.1_2 Reverse -285 -292 15.7721 0.0124
NP_442365.1_7 Forward -349 -330 -6.58872 0.298
NP_442238.1_4 Reverse -105 -124 17.109 0.117
NP_442238.1_7 Forward -25 -6 6.1935 0.285
NP_442615.1_1 Reverse -275 -293 12.4089 0.0137
NP_442615.1_1 Forward -302 -284 -7.25734 0.283
NP_440387.1_1 Forward -293 -277 8.515 0.0282
NP_440387.1_1 Reverse -284 -300 -3.67804 0.164
NP_440855.1_5 Forward -295 -276 2.35861 0.295
NP_441488.1_7 Reverse -317 -336 2.65439 0.253
NP_441993.1_1 Reverse -313 -332 4.87041 0.211
NP_441993.1_1 Reverse -278 -297 4.09075 0.225
NP_441993.1_1 Reverse -284 -303 2.8238 0.25
NP_440114.1_10 Forward -293 -279 21.2391 0.00163
NP_440114.1_10 Reverse -284 -298 8.55439 0.2
NP_441720.1_2 Reverse -280 -299 4.71854 0.231
NP_440293.1_10 Reverse -365 -384 -0.787193 0.259
NP_440766.1_4 Reverse -315 -329 4.91614 0.118
NP_440766.1_5 Reverse -378 -390 9.75661 0.275
NP_439910.1_2 Forward -301 -284 -4.18939 0.0692
NP_439910.1_2 Reverse -276 -293 -21.3973 0.183
NP_442867.1_8 Forward -247 -228 6.39097 0.262
NP_440457.1_1 Reverse -319 -331 5.84051 0.135
NP_440457.1_1 Reverse -315 -327 2.89058 0.205
NP_440457.1_1 Reverse -280 -292 0.137309 0.25
NP_440457.1_1 Forward -297 -285 0.0389777 0.25
NP_440798.1_9 Reverse -10 -29 10.1275 0.224
NP_441436.1_8 Reverse -311 -330 9.53756 0.263
NP_442509.1_9 Reverse -284 -294 8.14104 0.192
NP_442509.1_9 Forward -293 -283 8.04271 0.192
NP_441253.1_7 Forward -325 -307 8.18062 0.276
NP_442514.1_5 Reverse -334 -353 -3.44288 0.228
NP_440554.1_4 Forward -292 -282 16.1063 0.0189
NP_440554.1_4 Reverse -285 -295 7.05986 0.106
NP_441885.1_5 Reverse -284 -294 20.9245 0.000538
NP_441885.1_5 Forward -293 -283 11.3864 0.00668
NP_440628.1_3 Reverse -381 -395 16.2242 0.256
NP_440478.1_10 Forward -334 -320 11.5043 0.185
NP_442128.1_2 Reverse -124 -142 12.4089 0.149
NP_442341.1_9 Reverse -282 -296 16.4202 0.0364
NP_442341.1_9 Forward -295 -281 4.8172 0.291
NP_441756.1_5 Forward -330 -311 -2.85214 0.283
NP_441173.1_9 Forward -283 -275 14.3753 0.161
NP_441173.1_9 Forward -282 -274 10.2454 0.261
NP_442395.2_2 Forward -320 -301 9.7334 0.278
NP_442395.2_9 Forward -40 -24 14.3165 0.226
NP_440423.1_6 Reverse -276 -295 -15.3402 0.229
NP_443000.1_7 Reverse -282 -292 17.4829 0.00719
NP_443000.1_7 Forward -295 -285 17.0896 0.00865
NP_440507.2_3 Forward -302 -283 7.96345 0.263
NP_440275.1_3 Reverse -282 -292 9.12481 0.055
NP_440275.1_3 Forward -295 -285 8.1415 0.0602
NP_440091.1_1 Forward -297 -285 16.4603 0.0153
NP_440091.1_1 Reverse -280 -292 8.9871 0.0567
NP_441902.1_3 Reverse -378 -388 13.3704 0.23
NP_443010.1_10 Reverse -281 -298 12.7241 0.0838
NP_439962.1_4 Forward -336 -317 -5.31042 0.278
NP_440149.1_8 Reverse -284 -303 -0.0988766 0.144
NP_441105.1_3 Reverse -273 -292 2.0644 0.107
NP_440216.1_1 Forward -293 -279 5.99778 0.0166
NP_440216.1_1 Reverse -284 -298 -1.77037 0.0383
NP_440172.1_1 Forward -293 -283 17.5813 0.00421
NP_440172.1_1 Reverse -284 -294 15.0247 0.00945
NP_442015.1_10 Forward -297 -284 0.60927 0.221
NP_442015.1_10 Reverse -79 -92 -0.472371 0.268
NP_441226.1_7 Forward -292 -285 14.4934 0.0123
NP_441226.1_7 Reverse -285 -292 14.4934 0.0123
NP_441226.1_7 Forward -91 -84 8.59356 0.197
NP_442446.1_5 Forward -291 -272 6.88262 0.19
NP_441111.1_7 Forward -292 -284 18.7023 0.00294
NP_441111.1_7 Reverse -285 -293 18.7023 0.00294
NP_442379.1_10 Reverse -277 -294 -3.69774 0.265
NP_441766.1_2 Forward -293 -284 17.5026 0.00297
NP_441766.1_2 Reverse -284 -293 17.5026 0.00297
NP_440416.1_1 Forward -293 -274 -2.45882 0.116
NP_440416.1_1 Reverse -284 -303 -13.5702 0.281
NP_443052.1_8 Reverse -274 -293 -3.73712 0.106
NP_443052.1_9 Forward -333 -314 1.57275 0.184
NP_443052.1_9 Forward -330 -311 -7.37537 0.297
NP_442552.1_1 Reverse -101 -120 2.94938 0.203
NP_440845.1_1 Reverse -262 -281 -3.63879 0.206
NP_442403.1_8 Reverse -286 -305 -0.787193 0.256
NP_442154.1_1 Reverse -312 -330 -9.12563 0.175
NP_442154.1_1 Reverse -315 -333 -11.6822 0.215
NP_440261.1_5 Reverse -285 -298 -12.4687 0.297
NP_440988.1_2 Forward -330 -312 6.214 0.299
NP_440988.1_10 Reverse -340 -354 8.57771 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCACATTCTAAATTATTGCCCAACACCTTCCCTTCACTCAACTTCACTTGACGATGGGGACAACGATCCTCCACCGCCCGCACCTGGCCATCCTGGTCCCGATAAATGGCGATCGCCTTTTCCCAAAGAACAATTCCCAGTGGTCCCTGACCTAATTCCCCTGCTTGGGCCACCACATACCAATGGTTGAAATTGATTGGGGTAGTACGCAGCATAGACAATACTTGACTATGGGAAGAAAGAGCGCTCATTAGCAAGCCAACAACAGCGGTAAAGGTAAAGCAAAAAACTGATCCTACCCAGGTAAGGGCCGTCCCACACTGGAACTAGCTTGTCACGAAAGTCCCAAGCAATCCTGCTAGAATAAGGCATTCAAAATGATTTTTCAATCTGTTCTCGT

CDS

ATGCCTTCTTCCTCCAACAGTGCAGCCTTTTCCCTCGATGAATTTGCCAAAGCCCTTGACAAACACGACTACCATGCGGAGAAAGGTCAAACCGTCCATGGCAAAATCTGTCAGCACGCTAACGAGGGAGTCTATGTGGATTTTGGCGGTAAATCCCCTGGCTTTGTCCCTGTACAGGAATTAGGTCTACGGCCCCACGCAGAAATTGAGGATAGTTTTCCCCTAGATAGTGCCTGGGATTTCCTCGTCACCAGTGAACAAAATGACGAAGGGCAGGTAAGGCTTTCTCGACGTCAGTTGCAAATCCAGCAATCTTGGGAAAATTTGGCAGAGTTGGAGGAGAGTGGCAAAACCCTCGAAATGGTCGTCACCGGTACCAACAAAGGAGGCGTGGTGGGCGATGTGGAAGGATTGCGGGGTTTCATTCCCCGATCGCACCTTATGCACAAGGACAATATGGACGCTTTGGTGGGGCAAGTGCTCAAAGCCCATATCCTCGAGGCCAACCAGGATAACAATAAATTGGTGTTGACCCAGCGTCGCATCCAACAGGCCGAATCCATGGGCAAAATTGCGGCGGGCAATATCTACGAAGGCAAAGTGGCTAAAATTCAGCCCTATGGCGTGTTTGTGGAAATTGAAGGGGTAACGGGTTTACTCCATGTCAGCCAGGTGAGCGGCACCAGGGTTGATTCCCTCAATACCCTGTTCGCCTTTGGCCAAGCCATCAGTGTCTACGTCCAAGAAATTGACGAGTATAAAAATCGCATTTCCCTTTCCACCCGTATTTTGGAAACCTATCCTGGGGAATTGGTGGAAAAATTTGACGAAATGATGGCCGATGCTCCCAATCGCTTACCTCTGGTACAATCGAAGCAAAATTTGGGCGATAAACAGGAGCAACTGGAAAAAAGTTAA

Protein

MPSSSNSAAFSLDEFAKALDKHDYHAEKGQTVHGKICQHANEGVYVDFGGKSPGFVPVQELGLRPHAEIEDSFPLDSAWDFLVTSEQNDEGQVRLSRRQLQIQQSWENLAELEESGKTLEMVVTGTNKGGVVGDVEGLRGFIPRSHLMHKDNMDALVGQVLKAHILEANQDNNKLVLTQRRIQQAESMGKIAAGNIYEGKVAKIQPYGVFVEIEGVTGLLHVSQVSGTRVDSLNTLFAFGQAISVYVQEIDEYKNRISLSTRILETYPGELVEKFDEMMADAPNRLPLVQSKQNLGDKQEQLEKS