Your browser is old and dusty. Try Google Chrome!

Details for slr1980

ORF slr1980
Accession NP_441537.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -9 -16 10.8555 0.132
NP_441418.1_3 Reverse -264 -283 10.8379 0.272
NP_440815.1_2 Reverse -121 -135 12.9786 0.254
NP_442291.1_5 Forward -322 -306 -4.66135 0.281
NP_441453.1_4 Forward -321 -313 6.80426 0.121
NP_441453.1_4 Reverse -302 -310 4.83764 0.237
NP_442151.1_6 Reverse -312 -326 6.48943 0.233
NP_442655.1_10 Reverse -365 -384 -19.2734 0.282
NP_442173.1_1 Reverse -313 -321 5.72262 0.203
NP_442752.1_4 Forward -321 -314 13.8055 0.0199
NP_442752.1_4 Forward -349 -342 5.84064 0.166
NP_443027.1_4 Forward -121 -111 9.12481 0.177
NP_442975.1_10 Forward -315 -301 2.8506 0.269
NP_440784.1_7 Forward -320 -313 6.23397 0.241
NP_440784.1_7 Reverse -313 -320 6.13563 0.241
NP_442909.1_7 Reverse -3 -17 11.602 0.131
NP_439979.1_7 Reverse -335 -352 14.1002 0.267
NP_440878.1_9 Reverse -329 -348 -1.96717 0.258
NP_442062.1_8 Forward -321 -311 6.96153 0.112
NP_442062.1_8 Reverse -308 -318 3.02829 0.289
NP_440839.1_5 Reverse -110 -129 19.6656 0.128
NP_442242.1_4 Reverse -313 -320 10.8555 0.127
NP_440307.1_2 Reverse -345 -364 2.16274 0.262
NP_441594.1_6 Reverse -359 -378 2.94938 0.239
NP_441083.1_5 Reverse -312 -322 9.7148 0.0231
NP_441083.1_5 Forward -321 -311 0.0783647 0.245
NP_441083.1_5 Forward -311 -301 -0.511621 0.269
NP_441738.1_2 Reverse -314 -321 15.28 0.0102
NP_441738.1_2 Reverse -342 -349 8.20023 0.181
NP_441738.1_2 Forward -84 -77 6.52862 0.261
NP_441738.1_2 Reverse -101 -108 6.23363 0.264
NP_441558.1_5 Reverse -310 -329 4.42435 0.281
NP_440209.1_1 Reverse -312 -320 11.9175 0.0184
NP_440209.1_1 Forward -321 -313 8.57422 0.0425
NP_442889.1_8 Forward -206 -192 4.03056 0.27
NP_440178.1_7 Reverse -311 -330 -22.8133 0.279
NP_442570.1_3 Forward -221 -202 -5.31042 0.242
NP_441716.1_1 Reverse -302 -316 9.04604 0.127
NP_441716.1_1 Forward -321 -307 7.47274 0.169
NP_441716.1_1 Reverse -368 -382 5.30946 0.236
NP_441163.1_1 Reverse -16 -33 9.67453 0.225
NP_440906.1_5 Forward -320 -313 6.23397 0.234
NP_440906.1_5 Reverse -313 -320 6.13563 0.241
NP_440906.1_9 Forward -211 -192 12.88 0.296
NP_440747.1_10 Forward -324 -312 -4.48425 0.101
NP_440747.1_10 Reverse -299 -311 -12.0557 0.199
NP_440747.1_10 Forward -352 -340 -12.1541 0.227
NP_440747.1_10 Reverse -309 -321 -12.2524 0.254
NP_441486.1_1 Forward -324 -310 -2.75368 0.175
NP_442634.1_4 Reverse -361 -375 2.06454 0.147
NP_440470.1_5 Reverse -161 -180 5.68135 0.294
NP_443018.1_3 Forward -320 -313 12.6255 0.0471
NP_443018.1_3 Reverse -313 -320 5.25066 0.214
NP_440376.1_1 Reverse -194 -203 2.94966 0.213
NP_440376.1_1 Forward -321 -312 0.0980582 0.285
NP_440376.1_1 Reverse -312 -321 -0.196935 0.285
NP_441588.1_4 Reverse -314 -324 18.1713 0.0143
NP_441588.1_4 Forward -315 -305 5.38824 0.272
NP_442687.1_7 Reverse -311 -321 5.97822 0.179
NP_442687.1_7 Forward -312 -302 4.3066 0.255
NP_442658.1_1 Reverse -22 -32 6.56775 0.224
NP_441414.1_9 Reverse -312 -331 -2.16383 0.111
NP_441487.1_9 Reverse -196 -215 -2.45882 0.293
NP_439919.1_1 Forward -93 -76 17.6393 0.183
NP_441958.1_5 Reverse -311 -321 0.865012 0.12
NP_441958.1_5 Forward -322 -312 -6.31315 0.28
NP_442486.1_5 Forward -372 -353 15.0441 0.262
NP_440203.1_5 Forward -375 -365 10.501 0.224
NP_439990.1_5 Forward -326 -313 13.0973 0.103
NP_440153.1_8 Reverse -122 -135 -2.63565 0.246
NP_441941.1_7 Forward -35 -16 18.0924 0.0569
NP_440388.1_7 Forward -254 -235 0.786102 0.251
NP_440809.1_9 Forward -386 -368 17.9154 0.0632
NP_442431.1_10 Reverse -201 -219 1.29745 0.256
NP_441398.1_5 Forward -126 -107 9.63589 0.258
NP_441000.1_6 Reverse -7 -21 2.5562 0.136
NP_440147.1_1 Forward -323 -304 1.67108 0.297
NP_440147.1_4 Forward -323 -310 0.60927 0.249
NP_441550.1_8 Forward -323 -313 5.38779 0.252
NP_441550.1_8 Reverse -310 -320 5.28945 0.255
NP_440206.1_4 Reverse -358 -377 14.6499 0.107
NP_441725.1_5 Reverse -303 -313 0.176696 0.206
NP_441725.1_5 Forward -320 -310 0.0783647 0.215
NP_439966.1_7 Reverse -310 -320 7.0594 0.157
NP_439966.1_9 Forward -35 -26 4.42462 0.253
NP_442941.1_3 Reverse -9 -19 4.10993 0.14
NP_442941.1_3 Reverse -313 -323 1.25834 0.15
NP_442941.1_3 Forward -310 -300 0.373358 0.212
NP_440289.1_2 Reverse -309 -322 2.2809 0.1
NP_440289.1_2 Forward -314 -301 0.117615 0.175
NP_440289.1_2 Forward -324 -311 -3.61896 0.267
NP_440983.1_5 Reverse -110 -129 -9.047 0.3
NP_441678.1_9 Forward -360 -341 7.27595 0.17
NP_442281.1_1 Reverse -358 -372 3.34225 0.235
NP_441334.1_7 Forward -379 -360 -20.4534 0.276
NP_440177.1_1 Forward -220 -202 20.472 0.0322
NP_442256.1_2 Reverse -310 -328 -7.06068 0.214
NP_440437.1_1 Reverse -306 -325 -5.50708 0.286
NP_441644.1_6 Forward -221 -211 5.97777 0.172
NP_441644.1_6 Reverse -312 -322 5.78111 0.176
NP_443049.1_6 Forward -322 -312 16.5205 0.102
NP_442029.1_1 Forward -35 -16 -16.8151 0.272
NP_442029.1_1 Forward -323 -304 -20.1584 0.297
NP_442933.1_10 Reverse -312 -321 6.48957 0.119
NP_442933.1_10 Reverse -308 -317 6.09625 0.14
NP_442933.1_10 Forward -317 -308 5.70292 0.165
NP_441751.2_8 Reverse -313 -327 0.196253 0.122
NP_442554.1_8 Reverse -313 -323 5.48657 0.146
NP_442970.1_1 Reverse -163 -177 9.94278 0.269
NP_441762.1_7 Forward -18 -6 -4.09092 0.153
NP_442292.1_1 Reverse -313 -322 8.65285 0.0335
NP_441715.1_4 Reverse -9 -19 5.87989 0.172
NP_440183.1_9 Forward -211 -192 -13.8652 0.26
NP_440464.1_10 Reverse -313 -323 11.8623 0.275
NP_441468.1_1 Forward -320 -313 6.13563 0.209
NP_441468.1_1 Reverse -313 -320 6.0373 0.223
NP_441673.1_1 Forward -321 -312 1.37636 0.114
NP_441673.1_1 Reverse -312 -321 1.1797 0.163
NP_441731.1_3 Forward -215 -196 -4.13045 0.284
NP_441339.1_2 Reverse -310 -329 10.3242 0.188
NP_441826.1_2 Reverse -362 -376 2.06454 0.136
NP_441826.1_2 Reverse -296 -310 -4.62196 0.298
NP_442868.1_6 Reverse -310 -320 8.4365 0.057
NP_442868.1_6 Forward -323 -313 0.0783647 0.248
NP_442719.1_2 Reverse -228 -246 2.28001 0.162
NP_441056.1_1 Forward -383 -364 -5.31042 0.257
NP_442227.1_2 Reverse -333 -352 0.392778 0.252
NP_442427.1_3 Reverse -363 -381 9.85225 0.16
NP_442808.1_1 Reverse -311 -321 7.84605 0.0668
NP_440145.1_3 Forward -331 -312 -2.45882 0.17
NP_442542.1_2 Forward -313 -300 6.31247 0.232
NP_442113.1_10 Reverse -138 -157 -8.65367 0.282
NP_442050.1_5 Reverse -310 -320 8.63269 0.223
NP_442342.1_9 Reverse -310 -326 2.8118 0.282
NP_442342.1_9 Reverse -108 -124 2.71347 0.283
NP_440342.1_2 Forward -365 -346 9.0459 0.261
NP_440385.1_8 Forward -180 -161 12.2703 0.206
NP_440558.1_2 Reverse -365 -384 -2.36049 0.226
NP_440558.1_2 Forward -24 -5 -4.13045 0.243
NP_441878.1_6 Reverse -311 -321 0.57002 0.14
NP_441878.1_6 Forward -312 -302 -7.00147 0.201
NP_441557.1_5 Forward -321 -312 1.08137 0.0794
NP_441557.1_5 Reverse -312 -321 0.589713 0.134
NP_442347.1_2 Reverse -111 -120 14.0611 0.056
NP_442347.1_2 Reverse -313 -322 12.2911 0.056
NP_442347.1_2 Reverse -341 -350 4.0313 0.284
NP_442347.1_9 Reverse -106 -118 20.0985 0.245
NP_442645.1_2 Forward -329 -310 -22.2233 0.29
NP_442888.1_9 Reverse -139 -158 15.4374 0.193
NP_442594.1_8 Forward -357 -338 2.16274 0.295
NP_440136.1_2 Forward -320 -313 6.23397 0.171
NP_440136.1_2 Reverse -313 -320 6.13563 0.193
NP_440136.1_2 Reverse -9 -16 3.97235 0.288
NP_442998.1_10 Reverse -314 -321 15.5754 0.0102
NP_442998.1_10 Forward -309 -302 10.4622 0.0819
NP_440299.1_1 Reverse -304 -317 6.0169 0.155
NP_440299.1_1 Reverse -230 -243 3.65697 0.237
NP_440256.1_1 Forward -352 -333 -2.75381 0.122
NP_441559.1_8 Reverse -105 -119 -6.98191 0.281
NP_440749.1_4 Reverse -333 -351 14.8663 0.125
NP_441199.1_6 Forward -381 -362 -0.000545616 0.255
NP_441494.1_6 Reverse -363 -376 17.5222 0.0758
NP_442386.1_9 Forward -18 -9 4.52254 0.297
NP_441340.1_5 Forward -320 -313 6.23397 0.132
NP_441340.1_5 Reverse -313 -320 5.84064 0.208
NP_441947.1_10 Forward -379 -361 10.5406 0.15
NP_441952.1_9 Reverse -73 -92 13.2105 0.282
NP_442714.1_7 Reverse -129 -148 2.75272 0.213
NP_442950.1_1 Forward -338 -319 -4.52377 0.244
NP_440586.1_1 Reverse -194 -213 -6.39206 0.299
NP_440586.1_8 Forward -320 -313 14.69 0.026
NP_442251.1_6 Reverse -313 -320 12.0355 0.0627
NP_441262.1_3 Forward -321 -314 14.7888 0.0223
NP_440027.1_3 Forward -213 -195 7.3932 0.211
NP_443051.1_1 Forward -322 -313 0.884706 0.125
NP_443051.1_1 Reverse -311 -320 -1.18024 0.297
NP_439937.1_9 Forward -34 -17 -17.1697 0.294
NP_440439.1_1 Forward -352 -339 -0.275709 0.211
NP_440372.1_2 Forward -320 -313 6.82395 0.0854
NP_440372.1_2 Reverse -313 -320 6.52896 0.188
NP_441789.1_7 Forward -214 -195 -0.29631 0.251
NP_440819.1_5 Reverse -218 -226 7.8859 0.266
NP_442262.1_10 Forward -320 -313 12.9205 0.0422
NP_440531.1_6 Forward -211 -192 -1.47551 0.232
NP_441060.1_3 Reverse -359 -378 12.6841 0.184
NP_440297.1_9 Reverse -303 -313 -0.41329 0.283
NP_442187.1_3 Forward -322 -312 17.2863 0.0619
NP_443036.1_3 Forward -129 -112 13.1169 0.299
NP_440999.1_2 Reverse -123 -142 9.43923 0.278
NP_440888.1_2 Reverse -340 -354 6.78381 0.22
NP_442454.1_2 Forward -99 -80 16.09 0.251
NP_440600.1_4 Reverse -304 -322 -2.53746 0.202
NP_440575.1_1 Reverse -324 -343 -3.54122 0.294
NP_441543.1_2 Forward -310 -301 12.2911 0.0401
NP_441543.1_2 Reverse -313 -322 7.07956 0.131
NP_442845.1_2 Reverse -302 -316 7.37441 0.195
NP_442710.1_7 Forward -180 -161 -4.53167 0.272
NP_441469.1_8 Forward -204 -195 5.01461 0.297
NP_443064.1_6 Reverse -312 -322 8.59164 0.278
NP_442578.1_7 Forward -320 -313 14.6904 0.026
NP_442578.1_7 Reverse -309 -316 5.34899 0.2
NP_440220.1_4 Reverse -199 -218 -1.27961 0.264
NP_441462.1_2 Forward -321 -311 8.53483 0.0354
NP_443062.1_1 Reverse -312 -330 6.8883 0.19
NP_442204.1_5 Forward -321 -302 0.786102 0.252
NP_440516.1_8 Forward -321 -312 10.5211 0.00816
NP_440516.1_8 Reverse -302 -311 -0.590259 0.283
NP_442428.1_5 Forward -16 -9 9.57722 0.0852
NP_442428.1_5 Forward -320 -313 6.13563 0.209
NP_442428.1_5 Reverse -313 -320 6.0373 0.212
NP_440673.1_3 Reverse -314 -321 12.4288 0.0426
NP_440673.1_3 Reverse -370 -377 7.41394 0.263
NP_441052.1_2 Reverse -312 -322 10.6981 0.0285
NP_441052.1_2 Forward -311 -301 7.74818 0.0642
NP_442219.1_8 Forward -126 -107 9.9065 0.219
NP_442219.1_8 Forward -247 -228 6.71761 0.291
NP_442219.1_9 Reverse -313 -322 7.96454 0.0696
NP_442219.1_9 Forward -16 -7 2.65466 0.241
NP_442219.1_9 Reverse -341 -350 2.06468 0.289
NP_440436.1_4 Reverse -313 -322 7.57079 0.124
NP_442086.1_6 Reverse -356 -375 12.1925 0.255
NP_442907.1_7 Forward -177 -158 12.0942 0.287
NP_441719.1_4 Forward -320 -313 13.5105 0.026
NP_441719.1_4 Reverse -313 -320 6.52896 0.188
NP_441719.1_4 Reverse -309 -316 3.97235 0.231
NP_441733.1_10 Forward -324 -311 7.49244 0.153
NP_441733.1_10 Reverse -5 -18 6.50913 0.184
NP_441004.1_1 Forward -354 -335 -10.817 0.226
NP_442366.1_5 Forward -324 -314 14.8275 0.0375
NP_442873.1_9 Reverse -20 -39 5.50519 0.26
NP_441851.1_9 Forward -225 -206 11.1109 0.227
NP_441851.1_10 Forward -322 -312 4.40493 0.271
NP_442515.1_1 Forward -322 -308 0.687908 0.183
NP_441046.1_2 Forward -332 -313 8.65258 0.221
NP_441349.1_10 Reverse -302 -321 -1.67217 0.106
NP_441409.1_6 Forward -317 -298 0.58944 0.0648
NP_439960.1_10 Forward -34 -16 -2.83245 0.258
NP_442450.1_5 Reverse -310 -320 8.23984 0.13
NP_442168.1_5 Forward -220 -201 2.3594 0.232
NP_440943.1_5 Forward -239 -225 11.701 0.273
NP_442006.1_2 Reverse -195 -212 -16.4808 0.254
NP_442006.1_2 Forward -47 -30 -17.2674 0.271
NP_442006.1_2 Forward -348 -331 -17.6607 0.279
NP_443047.1_6 Reverse -355 -374 20.4523 0.0732
NP_441570.1_1 Forward -321 -303 -15.9105 0.236
NP_441570.1_1 Reverse -302 -320 -16.1071 0.238
NP_441078.1_4 Reverse -302 -311 5.80125 0.104
NP_441078.1_4 Forward -311 -302 5.70292 0.111
NP_441078.1_4 Forward -321 -312 0.196389 0.205
NP_441078.1_4 Reverse -312 -321 -0.000272808 0.205
NP_441091.1_5 Reverse -106 -125 1.67108 0.29
NP_440526.1_3 Reverse -313 -324 0.64819 0.273
NP_441432.1_8 Forward -322 -313 7.27622 0.101
NP_441432.1_8 Reverse -301 -310 5.99792 0.124
NP_442320.1_8 Reverse -302 -316 -5.31028 0.217
NP_440760.1_1 Reverse -312 -331 -13.9635 0.119
NP_440199.1_10 Forward -324 -314 7.25653 0.231
NP_442353.1_4 Reverse -12 -31 2.55527 0.229
NP_442489.1_7 Reverse -312 -321 7.47288 0.0613
NP_442489.1_7 Forward -321 -312 0.688044 0.152
NP_440559.1_1 Reverse -313 -322 7.76787 0.0918
NP_440559.1_1 Forward -320 -311 6.09625 0.134
NP_440559.1_1 Reverse -309 -318 4.81794 0.193
NP_441659.2_8 Forward -321 -311 0.275027 0.27
NP_441022.1_1 Forward -234 -225 11.4503 0.284
NP_441022.1_1 Reverse -225 -234 11.4503 0.284
NP_442913.1_9 Forward -125 -106 10.6192 0.207
NP_442346.1_5 Forward -378 -368 5.5849 0.238
NP_442346.1_5 Reverse -311 -321 4.3066 0.291
NP_440025.1_5 Forward -135 -116 17.0107 0.18
NP_440010.1_4 Reverse -358 -377 -0.29631 0.25
NP_442311.1_5 Reverse -201 -220 1.17943 0.27
NP_442875.1_8 Forward -179 -160 20.1573 0.0741
NP_442603.1_7 Forward -17 -3 10.8154 0.125
NP_441585.1_5 Forward -253 -234 2.06362 0.28
NP_441833.1_4 Reverse -313 -320 6.52896 0.0924
NP_441833.1_4 Forward -320 -313 6.23397 0.163
NP_442162.1_9 Forward -320 -313 6.62729 0.142
NP_442162.1_9 Reverse -313 -320 6.52896 0.178
NP_440671.1_4 Forward -160 -146 6.88276 0.233
NP_441973.1_6 Reverse -164 -182 16.6158 0.27
NP_442943.1_1 Forward -178 -163 15.26 0.0725
NP_442199.1_5 Forward -385 -366 -3.93378 0.216
NP_442140.1_3 Forward -320 -310 4.10993 0.261
NP_442547.1_7 Forward -375 -356 11.001 0.266
NP_441813.1_5 Reverse -310 -320 8.73149 0.0367
NP_440594.1_6 Reverse -9 -28 11.0117 0.177
NP_440590.1_4 Reverse -313 -326 1.78924 0.111
NP_440567.1_1 Forward -316 -302 -0.590395 0.293
NP_442497.1_10 Forward -320 -311 1.08137 0.115
NP_442497.1_10 Reverse -313 -322 0.589713 0.153
NP_440821.1_4 Reverse -6 -16 4.3066 0.131
NP_440821.1_4 Forward -323 -313 -0.314959 0.251
NP_441239.1_9 Reverse -294 -306 3.48056 0.285
NP_441239.1_9 Reverse -310 -322 2.98891 0.3
NP_441727.1_3 Forward -138 -119 8.75091 0.202
NP_441892.1_1 Reverse -359 -376 3.77542 0.119
NP_441892.1_1 Reverse -303 -320 -2.81276 0.228
NP_442669.1_1 Forward -182 -163 1.27776 0.235
NP_442044.1_1 Reverse -363 -382 -14.3569 0.289
NP_441017.1_6 Reverse -304 -318 12.8803 0.217
NP_441541.1_1 Forward -194 -176 -3.62671 0.268
NP_441541.1_1 Forward -290 -272 -4.19966 0.272
NP_441617.1_6 Reverse -227 -246 -5.21209 0.274
NP_440546.1_4 Forward -305 -295 10.4338 0.109
NP_440546.1_4 Reverse -302 -312 8.00989 0.209
NP_440675.1_1 Forward -128 -109 3.53937 0.251
NP_441537.1_1 Forward -212 -193 23.1072 0.0705
NP_441537.1_2 Forward -258 -239 18.0953 0.101
NP_441537.1_3 Forward -273 -259 15.6336 0.264
NP_441537.1_4 Forward -186 -167 18.6683 0.159
NP_440868.1_4 Reverse -308 -320 10.3637 0.0388
NP_440696.1_3 Forward -321 -303 3.3624 0.207
NP_440825.1_7 Reverse -313 -323 13.0072 0.152
NP_442837.1_3 Reverse -313 -320 12.1338 0.0702
NP_442837.1_3 Forward -16 -9 10.1672 0.0935
NP_442837.1_3 Reverse -111 -118 6.52896 0.2
NP_442837.1_3 Forward -320 -313 6.0373 0.25
NP_440160.1_2 Reverse -350 -369 -8.45701 0.286
NP_442053.1_1 Reverse -312 -321 14.1594 0.0136
NP_442053.1_1 Forward -321 -312 7.86621 0.0863
NP_440505.1_3 Forward -351 -341 6.56821 0.176
NP_440505.1_3 Reverse -300 -310 5.48657 0.227
NP_440914.1_1 Forward -377 -367 8.81029 0.186
NP_441011.1_8 Forward -16 -7 6.48957 0.191
NP_439944.1_9 Forward -310 -300 6.76487 0.168
NP_440007.1_9 Reverse -359 -373 2.65453 0.277
NP_441972.1_5 Forward -376 -357 5.40766 0.0921
NP_442306.1_3 Reverse -121 -140 16.1257 0.183
NP_441286.1_1 Forward -322 -310 5.05386 0.0259
NP_441286.1_1 Reverse -301 -313 3.38223 0.0467
NP_441808.1_8 Forward -35 -16 9.3409 0.259
NP_441626.1_2 Forward -320 -313 6.13563 0.177
NP_441626.1_2 Reverse -313 -320 5.93897 0.231
NP_441962.1_4 Reverse -117 -136 -11.6036 0.243
NP_441431.1_2 Reverse -309 -323 6.88214 0.257
NP_441993.1_1 Forward -377 -358 9.06107 0.136
NP_441993.1_4 Forward -321 -302 18.1898 0.133
NP_440814.1_4 Forward -330 -311 -11.0136 0.224
NP_440492.1_8 Reverse -118 -137 13.47 0.252
NP_441237.1_9 Reverse -313 -323 12.0747 0.139
NP_442930.1_1 Forward -94 -84 16.4008 0.19
NP_442867.1_8 Reverse -31 -50 6.09597 0.27
NP_440457.1_1 Forward -158 -146 0.628964 0.25
NP_440801.1_8 Forward -66 -47 -1.37718 0.276
NP_441436.1_8 Forward -350 -331 13.4708 0.215
NP_442509.1_9 Forward -321 -311 6.37109 0.274
NP_442862.1_3 Forward -242 -225 15.0835 0.137
NP_441885.1_5 Reverse -312 -322 1.25834 0.11
NP_441885.1_5 Forward -311 -301 0.0783647 0.183
NP_441885.1_5 Forward -203 -193 -1.19994 0.255
NP_440628.1_2 Forward -180 -161 24.6805 0.0182
NP_442341.1_7 Reverse -311 -325 3.93283 0.208
NP_443000.1_7 Forward -323 -313 0.57002 0.294
NP_440507.2_3 Forward -320 -301 7.57013 0.274
NP_440275.1_3 Reverse -210 -220 6.27322 0.118
NP_442638.1_3 Forward -185 -166 12.5568 0.298
NP_441207.1_7 Forward -170 -156 8.19046 0.293
NP_440149.1_10 Forward -377 -358 -11.8003 0.285
NP_441105.1_3 Reverse -297 -316 11.9958 0.0363
NP_441105.1_3 Reverse -357 -376 -2.55715 0.164
NP_442373.1_2 Forward -41 -22 -3.24547 0.198
NP_440216.1_1 Forward -321 -307 -2.95034 0.0635
NP_440172.1_1 Forward -321 -311 7.55152 0.0761
NP_441111.1_7 Reverse -313 -321 8.86921 0.0589
NP_441766.1_2 Reverse -312 -321 8.55452 0.054
NP_440416.1_9 Forward -126 -107 -14.6519 0.179
NP_440416.1_9 Reverse -301 -320 -14.7502 0.18
NP_440416.1_9 Reverse -345 -364 -19.1751 0.27
NP_440416.1_9 Forward -379 -360 -19.1751 0.27
NP_443052.1_8 Forward -27 -8 -11.4069 0.229
NP_443052.1_9 Reverse -105 -124 2.94938 0.166
NP_443052.1_9 Reverse -202 -221 -6.1954 0.279
NP_442116.1_6 Reverse -87 -104 6.06813 0.287
NP_440591.1_9 Forward -126 -108 10.3439 0.126
NP_442564.1_10 Reverse -213 -227 8.55439 0.296
NP_440261.1_5 Forward -320 -307 -6.47056 0.201
NP_440261.1_5 Forward -16 -3 -11.1904 0.246
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATATCATGTTGGTGGATTTAGAACGCAATGACCTCGGCCGGGTCTGTACCTGGGGAACGGTGGAAGTAGATGAATTATTGGCGATCGAGCGCTATAGCCATGTGTCCCATTTAGTTAGTAATGTAAAAGGCATTTTACAACCAGATAAAACCGGAGTAGATTTGGTCAAAGCTTTGTTTCCCGGTGGCACCATTACCGGCTGTCCCAAAATACGTTGTTTAGAAATTATTGAAGAATTAGAACCAGTGCGGCGGAGTTTGTTTTACGGTTCCTGTGGCTACTGGGATCAACGGGGGAACTTAGATTTAAATATTCTCATTCGCACCCTGTTATTCACCTCTGGACAAGTGACAGGACAAGTGGGAGCCGGCATTGTGGCAGACAGTGATCCCGCCAAGGA

CDS

ATGGTTAGAATCATTGCAAAAAGCCAAAGCTTTATTGGCGGCATTGGAGGGACTATAAAAAATATGGGATTTTTCAAAGGCTTTACTTATCCACTCCGCACATTCAAAATTCTACGTGAAAGTCCAGGCTTATTAGTTTATATTATTATTCCTTTAATTATTAATATTAGCTTAGGTATTTTACTTTATTGGCAACTATTAAATCTAGGTAATGATAGCGTCGATATACTGCGTAATTATGCCCACGATTGGATTGAAATTTTAAACCGACGCATTCCCAAAGTACTGCCCTACATCTTGCCGGTGCTAAAATTTATCTTTTTTCTTTATATCTGGCTAATACGCTTACTATTGCTAGTTATTGCGGGATTTTTACTTTCCCAGGTGGGAGGATTATTAGGTTCTCCTTGGTATAGCATCTTGTCAGAAAAGCTGGAAACAAAACTCCTAGGTAAATTAGCCATTCAGGAAGTGGGATTGTTACAGGACATCAAACGAGCTTTAGCCTTTGAATTGAAAAAAATAGTTTTATTAATTACTTTTACCATCATCGGTTTTGCCACCAACCTTCTGCCTGCATTTGGTACTCCCCTAGCTGCAGTAGTGGGCATTAGCTCCACATCTTTATTAACTTGCCTAGATTTTTTTGACCCTCCCCTCGAACGCCGTCGTCTCAAATTTCGTCGTAAGTTACTATTGATTTTTCAATCTCTCCCCCTGAGCGCTGGCTTTGCCCTAGCAAGTTTAGTTTGGGTCAGCATTCCTCTGGTTAATTTAGTAACTATTCCTTTTTGTGTGACCGCTGGTACCTTATTTTTCTGCGAAGAAATTTACCCCCGGTTTTTCCAAGTCCAAGAAGAAATGGAGGCGGAGGTAAACAAGGGGGCGAATTAA

Protein

MVRIIAKSQSFIGGIGGTIKNMGFFKGFTYPLRTFKILRESPGLLVYIIIPLIINISLGILLYWQLLNLGNDSVDILRNYAHDWIEILNRRIPKVLPYILPVLKFIFFLYIWLIRLLLLVIAGFLLSQVGGLLGSPWYSILSEKLETKLLGKLAIQEVGLLQDIKRALAFELKKIVLLITFTIIGFATNLLPAFGTPLAAVVGISSTSLLTCLDFFDPPLERRRLKFRRKLLLIFQSLPLSAGFALASLVWVSIPLVNLVTIPFCVTAGTLFFCEEIYPRFFQVQEEMEAEVNKGAN