Your browser is old and dusty. Try Google Chrome!

Details for slr1979

ORF slr1979
Accession NP_441536.1
Symbol trpE
Category Aromatic amino acid family
Definition anthranilate synthase component I
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -53 -39 4.91614 0.142
NP_441061.1_3 Reverse -48 -67 17.6982 0.121
NP_440795.1_7 Forward -53 -46 14.6904 0.0123
NP_440795.1_7 Reverse -46 -53 14.6904 0.0123
NP_441418.1_6 Forward -54 -35 -9.83364 0.0294
NP_441418.1_6 Reverse -45 -64 -30.6798 0.291
NP_442291.1_5 Reverse -44 -60 16.9715 0.0187
NP_440897.1_6 Forward -54 -35 -0.492971 0.183
NP_441453.1_1 Reverse -38 -56 6.1149 0.241
NP_441453.1_4 Reverse -45 -53 16.539 0.00633
NP_441453.1_4 Forward -54 -46 16.539 0.00633
NP_442151.1_6 Forward -54 -40 18.0925 0.0083
NP_442151.1_6 Reverse -45 -59 16.9125 0.013
NP_442151.1_6 Reverse -192 -206 7.9644 0.184
NP_441818.1_1 Reverse -46 -57 18.8393 0.00301
NP_441818.1_1 Forward -53 -42 10.1862 0.232
NP_440226.1_1 Reverse -45 -64 20.354 0.0102
NP_440996.1_2 Forward -96 -87 14.8477 0.248
NP_442655.1_10 Forward -57 -38 -19.6667 0.282
NP_442173.1_1 Forward -53 -45 15.4574 0.00633
NP_442173.1_1 Reverse -46 -54 15.4574 0.00633
NP_442752.1_4 Forward -54 -47 13.8055 0.0199
NP_442752.1_4 Reverse -45 -52 13.8055 0.0199
NP_442752.1_4 Forward -201 -194 10.5605 0.1
NP_442752.1_4 Reverse -272 -279 9.47889 0.109
NP_443027.1_4 Forward -56 -46 14.0414 0.0452
NP_443027.1_4 Reverse -43 -53 14.0414 0.0452
NP_441745.1_3 Forward -51 -32 15.6332 0.215
NP_441812.1_3 Reverse -44 -58 11.5043 0.21
NP_442975.1_10 Forward -58 -44 13.1753 0.0459
NP_442975.1_10 Reverse -41 -55 4.91554 0.234
NP_441225.1_5 Forward -386 -367 7.27595 0.282
NP_440784.1_7 Forward -53 -46 15.9687 0.0123
NP_440784.1_7 Reverse -46 -53 15.9687 0.0123
NP_441250.1_3 Reverse -132 -151 4.03102 0.252
NP_440061.1_9 Forward -56 -42 10.3237 0.126
NP_440061.1_9 Forward -325 -311 5.60385 0.279
NP_441054.1_4 Forward -64 -46 0.412472 0.174
NP_442062.1_8 Forward -54 -44 17.3846 0.00193
NP_442062.1_8 Reverse -45 -55 17.3846 0.00193
NP_441859.1_3 Forward -55 -36 2.16195 0.266
NP_440304.1_4 Forward -56 -46 10.8948 0.051
NP_440304.1_4 Reverse -43 -53 10.8948 0.051
NP_440304.1_4 Reverse -235 -245 5.97822 0.185
NP_442242.1_4 Forward -53 -46 14.3954 0.0124
NP_442242.1_4 Reverse -46 -53 14.3954 0.0124
NP_440044.1_8 Reverse -46 -65 7.17762 0.0851
NP_441594.1_6 Forward -318 -299 3.73603 0.225
NP_441594.1_6 Reverse -312 -331 0.294447 0.289
NP_442110.1_7 Forward -54 -40 10.816 0.0644
NP_442110.1_7 Reverse -45 -59 9.14437 0.0755
NP_442110.1_7 Forward -122 -108 3.14618 0.216
NP_440300.1_1 Reverse -375 -394 9.93006 0.232
NP_441925.1_4 Forward -37 -18 -14.2592 0.261
NP_441083.1_5 Forward -54 -44 20.3345 0.00053
NP_441083.1_5 Reverse -45 -55 20.3345 0.00053
NP_441738.1_2 Forward -52 -45 15.28 0.0102
NP_441738.1_2 Reverse -47 -54 15.28 0.0102
NP_441738.1_2 Forward -168 -161 6.52862 0.261
NP_441558.1_5 Forward -56 -37 10.4225 0.098
NP_440209.1_1 Reverse -45 -53 18.1123 0.00295
NP_440209.1_1 Forward -54 -46 18.1123 0.00295
NP_442889.1_1 Forward -330 -311 -7.17871 0.199
NP_442889.1_8 Forward -57 -43 11.5037 0.0733
NP_442889.1_8 Reverse -189 -203 6.29216 0.196
NP_441713.1_1 Reverse -39 -58 -5.9004 0.114
NP_440178.1_7 Reverse -44 -63 12.3892 0.00536
NP_441716.1_1 Forward -54 -40 22.2224 0.00332
NP_441716.1_1 Reverse -45 -59 4.22782 0.256
NP_442111.1_4 Forward -55 -41 12.0943 0.0451
NP_440906.1_5 Forward -53 -46 15.8704 0.0124
NP_440906.1_5 Reverse -46 -53 15.8704 0.0124
NP_440747.1_10 Reverse -42 -54 17.2469 0.000522
NP_440747.1_10 Forward -57 -45 7.51213 0.00286
NP_441130.1_10 Reverse -43 -57 7.76774 0.149
NP_441486.1_1 Forward -57 -43 20.9441 0.00262
NP_441486.1_1 Reverse -42 -56 12.1926 0.0129
NP_442634.1_4 Forward -56 -42 -1.5737 0.149
NP_441265.1_3 Reverse -39 -53 3.14618 0.181
NP_440842.1_10 Reverse -152 -166 5.50613 0.251
NP_441014.1_5 Forward -59 -41 9.95058 0.269
NP_441014.1_10 Reverse -44 -63 3.73524 0.206
NP_441014.1_10 Forward -55 -36 -1.08295 0.257
NP_441014.1_10 Reverse -236 -255 -1.57461 0.262
NP_442848.1_1 Forward -60 -46 7.17775 0.0791
NP_442848.1_1 Reverse -39 -53 -0.983719 0.263
NP_441012.1_4 Reverse -41 -54 7.49244 0.272
NP_443018.1_3 Forward -53 -46 14.8871 0.0123
NP_443018.1_3 Reverse -46 -53 14.8871 0.0123
NP_443018.1_3 Forward -47 -40 10.2655 0.107
NP_441634.1_8 Reverse -43 -57 2.16287 0.17
NP_440376.1_1 Forward -54 -45 19.4693 0.000692
NP_440376.1_1 Reverse -45 -54 19.4693 0.000692
NP_441588.1_4 Reverse -47 -57 8.63316 0.14
NP_442687.1_1 Reverse -102 -115 14.2767 0.247
NP_442687.1_7 Forward -55 -45 8.92815 0.0994
NP_442687.1_7 Reverse -44 -54 8.92815 0.0994
NP_442946.1_7 Forward -155 -140 11.9367 0.284
NP_440533.1_9 Forward -54 -35 16.9124 0.0669
NP_440360.1_5 Reverse -300 -319 -0.0988766 0.297
NP_442658.1_1 Reverse -43 -53 6.76441 0.214
NP_442658.1_1 Forward -56 -46 6.76441 0.214
NP_442198.1_7 Forward -327 -308 11.7 0.209
NP_440141.1_4 Reverse -15 -34 -6.29373 0.296
NP_442205.1_9 Reverse -24 -40 -3.97304 0.3
NP_441414.1_9 Forward -54 -35 -4.52377 0.156
NP_441414.1_9 Reverse -45 -64 -9.047 0.252
NP_442321.1_4 Reverse -290 -309 -9.44032 0.298
NP_441958.1_5 Forward -55 -45 12.2714 0.00183
NP_441958.1_5 Reverse -44 -54 12.2714 0.00183
NP_441127.1_1 Reverse -315 -329 14.1593 0.153
NP_440203.1_5 Forward -51 -41 15.7125 0.0611
NP_440984.1_7 Forward -59 -45 7.57108 0.166
NP_439990.1_5 Reverse -40 -53 20.7671 0.00296
NP_442690.1_1 Reverse -332 -351 -12.5869 0.245
NP_442911.1_2 Reverse -35 -54 15.6341 0.0106
NP_442911.1_2 Forward -64 -45 -3.63879 0.115
NP_441580.1_6 Forward -65 -46 -8.16202 0.254
NP_441580.1_6 Reverse -34 -53 -8.16202 0.254
NP_440153.1_5 Reverse -46 -60 8.75105 0.132
NP_442064.1_1 Reverse -40 -59 -11.3086 0.259
NP_440993.1_3 Reverse -35 -54 3.53858 0.181
NP_440602.1_8 Reverse -45 -59 17.5025 0.0898
NP_439975.1_2 Forward -108 -90 12.9988 0.155
NP_441348.1_3 Forward -59 -40 9.53756 0.215
NP_441099.1_5 Reverse -35 -54 7.7676 0.0409
NP_440809.1_9 Reverse -36 -54 -8.04399 0.225
NP_441294.1_7 Forward -58 -44 14.914 0.033
NP_440411.1_10 Forward -230 -211 8.70022 0.293
NP_441646.1_1 Forward -40 -21 -0.39387 0.264
NP_442438.1_10 Reverse -40 -54 8.75105 0.0731
NP_442438.1_10 Forward -59 -45 7.86607 0.0859
NP_442231.1_8 Forward -65 -46 21.3373 0.098
NP_441000.1_6 Reverse -44 -58 -4.7203 0.251
NP_440147.1_4 Forward -56 -43 2.08423 0.21
NP_440147.1_4 Reverse -43 -56 2.08423 0.21
NP_441550.1_8 Reverse -43 -53 12.3692 0.0336
NP_441550.1_8 Forward -56 -46 12.3692 0.0336
NP_441916.1_7 Forward -54 -44 10.3048 0.0261
NP_441916.1_7 Reverse -45 -55 10.3048 0.0261
NP_441916.1_10 Forward -62 -43 1.0811 0.27
NP_441041.1_4 Forward -54 -35 7.96426 0.036
NP_441041.1_4 Reverse -45 -64 -6.29373 0.166
NP_442004.1_6 Forward -54 -40 8.55439 0.14
NP_441725.1_5 Forward -53 -43 11.2881 0.0247
NP_441725.1_5 Reverse -46 -56 11.2881 0.0247
NP_439966.1_7 Reverse -43 -53 15.8108 0.0124
NP_439966.1_7 Forward -56 -46 15.8108 0.0124
NP_442941.1_3 Forward -53 -43 19.9412 0.00262
NP_442941.1_3 Reverse -46 -56 19.9412 0.00262
NP_440289.1_2 Forward -57 -44 13.294 0.0132
NP_440289.1_2 Reverse -42 -55 3.75586 0.0741
NP_442281.1_1 Forward -59 -45 17.2068 0.00633
NP_442281.1_1 Reverse -40 -54 8.84875 0.075
NP_442256.1_2 Reverse -43 -61 -8.83064 0.236
NP_440437.1_1 Reverse -39 -58 2.3594 0.135
NP_441556.1_6 Forward -251 -233 12.7668 0.296
NP_441644.1_6 Forward -54 -44 17.3841 0.00127
NP_441644.1_6 Reverse -45 -55 17.3841 0.00127
NP_442215.1_2 Reverse -190 -206 9.30165 0.0591
NP_442215.1_2 Reverse -43 -59 5.6634 0.0775
NP_442215.1_2 Forward -56 -40 4.48343 0.0838
NP_442029.1_6 Forward -59 -40 3.93269 0.274
NP_440253.1_2 Reverse -45 -63 12.3105 0.0284
NP_440253.1_2 Forward -54 -36 -1.06249 0.23
NP_440929.1_8 Forward -54 -45 19.2726 0.000701
NP_440929.1_8 Reverse -45 -54 19.2726 0.000701
NP_442933.1_5 Reverse -53 -72 9.24257 0.289
NP_442933.1_10 Forward -54 -45 17.601 0.00325
NP_442933.1_10 Reverse -45 -54 17.601 0.00325
NP_441751.2_8 Forward -53 -39 6.3911 0.0354
NP_441751.2_8 Reverse -46 -60 -3.24533 0.137
NP_442554.1_8 Forward -53 -43 15.9097 0.00747
NP_442554.1_8 Reverse -46 -56 15.9097 0.00747
NP_441762.1_7 Forward -55 -43 -6.84419 0.284
NP_441762.1_7 Reverse -44 -56 -6.84419 0.284
NP_442142.1_4 Reverse -42 -55 15.4566 0.0264
NP_442142.1_4 Forward -57 -44 14.1783 0.0311
NP_442292.1_1 Forward -53 -44 18.486 0.00229
NP_442292.1_1 Reverse -46 -55 18.486 0.00229
NP_440895.1_6 Reverse -39 -52 10.8357 0.202
NP_440895.1_6 Reverse -2 -15 10.5407 0.202
NP_443009.1_5 Reverse -44 -55 8.90795 0.0965
NP_443009.1_5 Forward -55 -44 8.90795 0.0965
NP_441726.1_4 Forward -203 -189 17.6008 0.226
NP_441715.1_4 Forward -53 -43 14.828 0.0268
NP_441715.1_4 Reverse -46 -56 14.828 0.0268
NP_440279.1_8 Forward -293 -274 12.9791 0.242
NP_441468.1_1 Forward -53 -46 15.8704 0.0124
NP_441468.1_1 Reverse -46 -53 15.8704 0.0124
NP_441015.1_8 Forward -324 -305 4.22769 0.259
NP_441015.1_10 Forward -53 -34 -8.16202 0.272
NP_441673.1_1 Forward -54 -45 20.8459 0.000698
NP_441673.1_1 Reverse -45 -54 20.8459 0.000698
NP_441876.1_9 Forward -211 -201 10.501 0.292
NP_441826.1_2 Forward -60 -46 13.8643 0.0213
NP_441826.1_2 Reverse -39 -53 5.89945 0.0946
NP_442043.1_1 Forward -84 -65 14.8474 0.0364
NP_442868.1_6 Forward -56 -46 9.91146 0.038
NP_442868.1_6 Reverse -43 -53 9.91146 0.038
NP_442719.1_2 Forward -255 -237 -6.4714 0.225
NP_441056.1_1 Reverse -45 -64 9.24257 0.069
NP_441612.1_2 Reverse -45 -55 8.54929 0.21
NP_441612.1_2 Forward -54 -44 8.54929 0.21
NP_443058.1_7 Forward -55 -36 5.80098 0.237
NP_442427.1_8 Forward -63 -44 16.1257 0.0732
NP_442808.1_1 Reverse -44 -54 8.63269 0.0481
NP_442808.1_1 Forward -55 -45 8.63269 0.0481
NP_442542.1_2 Reverse -313 -326 7.00078 0.197
NP_442050.1_5 Reverse -43 -53 16.4991 0.00812
NP_442050.1_5 Forward -56 -46 16.4991 0.00812
NP_440558.1_2 Reverse -36 -55 4.916 0.147
NP_442789.1_4 Reverse -298 -317 -7.86702 0.299
NP_441878.1_6 Forward -55 -45 10.4031 0.0176
NP_441878.1_6 Reverse -44 -54 10.4031 0.0176
NP_441036.1_8 Reverse -390 -400 11.4848 0.119
NP_441036.1_8 Forward -55 -45 8.33817 0.174
NP_441036.1_8 Reverse -44 -54 8.33817 0.174
NP_442650.1_2 Forward -54 -40 6.6861 0.13
NP_441557.1_5 Forward -54 -45 19.9609 0.000699
NP_441557.1_5 Reverse -45 -54 19.9609 0.000699
NP_441445.1_1 Forward -63 -44 8.65258 0.117
NP_441445.1_1 Reverse -36 -55 8.45592 0.121
NP_441445.1_1 Reverse -2 -21 6.98095 0.138
NP_441433.1_8 Forward -323 -304 3.83436 0.197
NP_441433.1_8 Forward -206 -187 -3.24547 0.276
NP_442183.1_1 Reverse -45 -59 7.37441 0.143
NP_442183.1_1 Forward -54 -40 7.07942 0.149
NP_442397.1_9 Forward -54 -35 4.12936 0.26
NP_441549.1_9 Forward -37 -19 -10.6989 0.285
NP_442347.1_2 Forward -53 -44 12.4878 0.056
NP_442347.1_2 Reverse -46 -55 12.4878 0.056
NP_442645.1_2 Forward -62 -43 -4.72043 0.0608
NP_441633.1_3 Forward -56 -43 -6.07724 0.236
NP_441633.1_3 Reverse -43 -56 -6.07724 0.236
NP_440136.1_2 Forward -53 -46 15.9687 0.0123
NP_440136.1_2 Reverse -46 -53 15.9687 0.0123
NP_442590.1_10 Reverse -45 -64 4.71934 0.272
NP_442590.1_10 Reverse -5 -24 3.24438 0.294
NP_442998.1_5 Reverse -205 -215 11.7798 0.176
NP_442998.1_5 Forward -146 -136 10.8948 0.201
NP_442998.1_10 Forward -52 -45 15.5754 0.0102
NP_442998.1_10 Reverse -47 -54 15.5754 0.0102
NP_440299.1_1 Reverse -41 -54 22.3398 0.000547
NP_440299.1_1 Forward -58 -45 4.44361 0.207
NP_441799.1_1 Forward -58 -44 10.0287 0.0797
NP_441799.1_1 Forward -387 -373 7.27547 0.147
NP_441799.1_1 Reverse -41 -55 5.30886 0.214
NP_441007.1_10 Forward -59 -46 0.805932 0.216
NP_442333.2_5 Forward -65 -46 -14.5535 0.278
NP_440256.1_1 Reverse -42 -61 8.16093 0.0239
NP_440256.1_1 Forward -57 -38 -0.688862 0.0954
NP_441559.1_8 Reverse -40 -54 2.75286 0.143
NP_441559.1_8 Reverse -131 -145 -7.57189 0.295
NP_441270.1_5 Reverse -11 -30 14.6533 0.211
NP_442860.1_6 Reverse -131 -150 17.3559 0.262
NP_440915.1_6 Reverse -41 -55 3.8345 0.1
NP_440915.1_6 Reverse -20 -34 -3.44199 0.296
NP_440717.1_3 Forward -327 -313 10.2254 0.231
NP_441704.1_8 Reverse -34 -53 16.0265 0.0888
NP_442452.1_8 Reverse -39 -53 13.6669 0.273
NP_442993.1_1 Reverse -45 -61 -7.70961 0.146
NP_442386.1_9 Reverse -44 -53 13.8639 0.0289
NP_442386.1_9 Forward -55 -46 13.8639 0.0289
NP_440570.1_5 Forward -400 -381 -3.73712 0.292
NP_441750.1_4 Reverse -41 -60 6.78429 0.159
NP_441340.1_5 Forward -53 -46 15.6737 0.0124
NP_441340.1_5 Reverse -46 -53 15.6737 0.0124
NP_441340.1_9 Forward -85 -75 7.29115 0.289
NP_441271.1_1 Reverse -39 -57 11.1298 0.247
NP_441947.1_10 Forward -56 -38 7.09898 0.252
NP_442484.1_2 Reverse -34 -53 3.24438 0.21
NP_442484.1_2 Forward -175 -156 2.55606 0.224
NP_440161.1_10 Reverse -308 -327 14.5282 0.288
NP_440586.1_8 Forward -53 -46 13.2151 0.026
NP_440586.1_8 Reverse -46 -53 13.2151 0.026
NP_440586.1_8 Forward -47 -40 9.08521 0.178
NP_442251.1_6 Forward -53 -46 15.2804 0.0124
NP_442251.1_6 Reverse -46 -53 15.2804 0.0124
NP_442959.1_5 Forward -95 -76 6.68596 0.251
NP_441262.1_3 Reverse -45 -52 14.7888 0.0223
NP_441262.1_3 Forward -54 -47 14.7888 0.0223
NP_440027.1_3 Forward -27 -9 5.42659 0.244
NP_443051.1_1 Reverse -44 -53 10.4228 0.00754
NP_443051.1_1 Forward -55 -46 10.4228 0.00754
NP_439996.1_2 Reverse -307 -326 4.916 0.244
NP_439984.1_10 Reverse -94 -108 10.6187 0.255
NP_439937.1_9 Forward -55 -38 -16.383 0.287
NP_441595.1_5 Reverse -18 -36 6.01734 0.231
NP_440408.1_3 Forward -60 -41 -2.95047 0.257
NP_440439.1_1 Reverse -42 -55 0.117615 0.202
NP_440439.1_1 Forward -129 -116 -0.0790467 0.207
NP_439943.1_4 Reverse -155 -174 6.39097 0.27
NP_440372.1_2 Forward -53 -46 16.3621 0.0124
NP_440372.1_2 Reverse -46 -53 16.3621 0.0124
NP_440316.1_10 Reverse -314 -324 7.35486 0.251
NP_441803.1_2 Reverse -40 -59 -1.08219 0.294
NP_439977.1_5 Reverse -39 -58 0.196116 0.212
NP_440139.1_1 Forward -60 -41 3.73524 0.2
NP_440267.1_2 Forward -59 -45 8.45543 0.162
NP_442384.1_10 Forward -54 -41 17.4239 0.00585
NP_442384.1_10 Reverse -24 -37 13.9823 0.0177
NP_442384.1_10 Reverse -45 -58 1.10092 0.268
NP_442262.1_10 Forward -53 -46 14.1988 0.0123
NP_442262.1_10 Reverse -46 -53 14.1988 0.0123
NP_442262.1_10 Forward -47 -40 9.18389 0.211
NP_441689.1_5 Forward -56 -46 15.3192 0.0403
NP_441689.1_5 Reverse -43 -53 15.3192 0.0403
NP_441689.1_5 Forward -128 -118 6.17443 0.197
NP_442244.1_6 Forward -330 -311 7.66927 0.225
NP_440163.1_10 Reverse -42 -52 12.4681 0.159
NP_440163.1_10 Forward -57 -47 11.3864 0.169
NP_440344.1_10 Reverse -38 -55 10.3636 0.0072
NP_441965.1_3 Reverse -35 -54 6.29264 0.149
NP_441965.1_10 Forward -57 -41 7.63002 0.144
NP_441640.1_8 Forward -53 -34 3.83436 0.128
NP_440297.1_9 Forward -53 -43 9.32148 0.0917
NP_440297.1_9 Reverse -46 -56 9.32148 0.0917
NP_440297.1_9 Forward -47 -37 -0.118297 0.282
NP_440894.1_10 Reverse -295 -314 6.29264 0.217
NP_440999.1_9 Reverse -296 -310 7.9644 0.0802
NP_440999.1_9 Reverse -41 -55 3.34284 0.131
NP_440888.1_2 Reverse -45 -59 18.0918 0.00261
NP_440888.1_2 Forward -54 -40 16.8135 0.00536
NP_440888.1_2 Forward -33 -19 5.80051 0.262
NP_442948.1_2 Forward -55 -36 11.5042 0.128
NP_441543.1_2 Forward -53 -44 16.9127 0.00359
NP_441543.1_2 Reverse -46 -55 16.9127 0.00359
NP_442845.1_2 Reverse -39 -53 12.6843 0.104
NP_442845.1_2 Forward -54 -40 7.86607 0.195
NP_442845.1_2 Forward -60 -46 5.1128 0.243
NP_441469.1_8 Forward -55 -46 6.48957 0.227
NP_441469.1_8 Reverse -44 -53 6.48957 0.227
NP_443064.1_6 Forward -54 -44 12.5669 0.0796
NP_443064.1_6 Reverse -45 -55 12.5669 0.0796
NP_441306.1_10 Reverse -316 -330 16.5185 0.247
NP_442578.1_7 Forward -53 -46 14.5921 0.026
NP_442578.1_7 Reverse -46 -53 14.5921 0.026
NP_441462.1_2 Forward -54 -44 11.5831 0.00406
NP_441462.1_2 Reverse -45 -55 11.5831 0.00406
NP_443062.1_1 Reverse -45 -63 7.76586 0.168
NP_443062.1_1 Forward -54 -36 6.79079 0.192
NP_443062.1_6 Reverse -37 -56 7.37428 0.17
NP_442204.1_1 Reverse -41 -52 9.69511 0.0736
NP_442204.1_1 Forward -205 -194 7.82682 0.112
NP_441560.1_8 Reverse -40 -59 16.2847 0.0771
NP_440516.1_8 Forward -54 -45 16.9127 0.00442
NP_440516.1_8 Reverse -45 -54 16.9127 0.00442
NP_442428.1_5 Forward -53 -46 15.8704 0.0124
NP_442428.1_5 Reverse -46 -53 15.8704 0.0124
NP_442120.1_10 Reverse -294 -313 -5.01543 0.199
NP_442120.1_10 Forward -60 -41 -10.817 0.261
NP_440673.1_3 Forward -52 -45 12.4288 0.0426
NP_440673.1_3 Reverse -47 -54 12.4288 0.0426
NP_441052.1_2 Forward -54 -44 19.9412 0.00106
NP_441052.1_2 Reverse -45 -55 19.9412 0.00106
NP_442219.1_9 Forward -53 -44 17.7976 0.00718
NP_442219.1_9 Reverse -46 -55 17.7976 0.00718
NP_440436.1_4 Forward -53 -44 17.2072 0.00233
NP_440436.1_4 Reverse -46 -55 17.2072 0.00233
NP_441884.1_9 Reverse -297 -316 -3.04881 0.0594
NP_441884.1_9 Reverse -336 -355 -20.65 0.199
NP_441884.1_9 Forward -57 -38 -22.2233 0.277
NP_441719.1_4 Forward -53 -46 16.3621 0.0124
NP_441719.1_4 Reverse -46 -53 16.3621 0.0124
NP_442366.1_3 Reverse -191 -209 -3.6191 0.253
NP_442873.1_3 Forward -256 -237 4.62021 0.262
NP_441115.1_4 Reverse -191 -209 8.47483 0.247
NP_442206.1_10 Forward -54 -39 4.40479 0.178
NP_440728.1_9 Reverse -141 -159 14.8832 0.294
NP_443054.1_2 Reverse -43 -57 3.04785 0.24
NP_441851.1_10 Forward -55 -45 15.8113 0.00552
NP_441851.1_10 Reverse -44 -54 15.8113 0.00552
NP_442622.1_1 Reverse -29 -48 -11.8003 0.257
NP_442515.1_1 Reverse -44 -58 9.43936 0.0629
NP_442515.1_1 Forward -55 -41 1.86788 0.147
NP_440940.1_7 Reverse -35 -53 3.75497 0.274
NP_441349.1_10 Reverse -35 -54 2.16274 0.0762
NP_441349.1_10 Forward -64 -45 -9.73531 0.297
NP_441409.1_6 Reverse -39 -58 27.4338 0.000995
NP_440432.1_9 Reverse -46 -61 5.3881 0.0555
NP_442843.1_1 Forward -317 -298 -9.83364 0.271
NP_442944.1_9 Reverse -36 -55 16.9124 0.228
NP_440431.1_3 Forward -55 -36 -11.6036 0.288
NP_442450.1_5 Reverse -43 -53 9.32148 0.115
NP_442450.1_5 Forward -56 -46 9.32148 0.115
NP_440588.1_2 Reverse -36 -55 -6.09707 0.269
NP_440195.1_4 Forward -66 -47 5.89931 0.284
NP_440195.1_4 Reverse -33 -52 3.93269 0.297
NP_442006.1_2 Reverse -153 -170 -15.8908 0.23
NP_442243.1_1 Reverse -39 -57 2.08335 0.204
NP_441570.1_1 Forward -54 -36 2.57575 0.0243
NP_441570.1_1 Reverse -45 -63 -0.472507 0.0472
NP_441078.1_4 Forward -54 -45 19.6659 0.0007
NP_441078.1_4 Reverse -45 -54 19.6659 0.0007
NP_442729.1_8 Reverse -41 -54 8.37742 0.125
NP_440526.1_3 Reverse -46 -57 10.1862 0.0646
NP_440526.1_3 Forward -53 -42 7.92465 0.126
NP_441432.1_8 Reverse -44 -53 16.8143 0.00595
NP_441432.1_8 Forward -55 -46 16.8143 0.00595
NP_442320.1_8 Forward -60 -46 11.996 0.0175
NP_442320.1_8 Reverse -39 -53 5.89945 0.0309
NP_441732.1_2 Reverse -41 -57 1.82849 0.026
NP_441732.1_2 Forward -58 -42 -16.5594 0.174
NP_440760.1_1 Reverse -45 -64 -21.24 0.233
NP_440760.1_1 Forward -54 -35 -22.9117 0.274
NP_442797.1_7 Reverse -38 -56 2.77242 0.238
NP_440199.1_10 Forward -57 -47 16.7946 0.0381
NP_440199.1_10 Reverse -42 -52 7.64985 0.231
NP_442624.1_1 Forward -281 -264 18.1317 0.221
NP_440578.1_8 Reverse -8 -27 10.5209 0.285
NP_440913.1_1 Reverse -43 -61 4.83737 0.254
NP_440713.1_3 Reverse -261 -280 0.884433 0.28
NP_440713.1_4 Reverse -35 -54 15.2408 0.0791
NP_442489.1_2 Reverse -40 -59 1.96607 0.278
NP_442489.1_7 Forward -54 -45 20.1576 0.000695
NP_442489.1_7 Reverse -45 -54 20.1576 0.000695
NP_442079.1_7 Forward -53 -34 19.174 0.0744
NP_440559.1_1 Forward -53 -44 17.4043 0.00658
NP_440559.1_1 Reverse -46 -55 17.4043 0.00658
NP_441659.2_8 Forward -54 -44 18.1713 0.00133
NP_441659.2_8 Reverse -45 -55 18.1713 0.00133
NP_441022.1_1 Reverse -73 -82 10.9707 0.284
NP_442913.1_10 Forward -63 -44 11.2092 0.0421
NP_442346.1_5 Forward -55 -45 16.6963 0.00248
NP_442346.1_5 Reverse -44 -54 16.6963 0.00248
NP_440352.1_5 Reverse -343 -362 17.3279 0.0821
NP_440352.1_5 Reverse -194 -213 10.6116 0.27
NP_440545.1_3 Forward -58 -41 -4.18939 0.22
NP_441856.1_3 Forward -57 -38 -1.57384 0.239
NP_440025.1_3 Reverse -122 -136 10.514 0.29
NP_441923.1_6 Forward -47 -33 18.6825 0.109
NP_440010.1_10 Forward -213 -194 3.44104 0.257
NP_442603.1_7 Forward -54 -40 19.7634 0.00895
NP_442603.1_10 Reverse -311 -328 15.7208 0.267
NP_441833.1_4 Forward -53 -46 15.9687 0.0124
NP_441833.1_4 Reverse -46 -53 15.9687 0.0124
NP_441895.1_10 Reverse -201 -220 -18.4868 0.282
NP_441895.1_10 Forward -149 -130 -18.8801 0.282
NP_441112.1_8 Reverse -186 -205 3.44104 0.232
NP_442162.1_9 Forward -53 -46 16.2637 0.0124
NP_442162.1_9 Reverse -46 -53 16.2637 0.0124
NP_440671.1_4 Reverse -39 -53 18.3875 0.0136
NP_440671.1_4 Forward -60 -46 13.7659 0.0748
NP_440224.1_1 Forward -65 -46 -4.32711 0.297
NP_442073.1_6 Reverse -36 -55 0.196116 0.25
NP_442073.1_8 Forward -186 -167 9.63507 0.241
NP_442140.1_3 Forward -53 -43 4.40493 0.243
NP_442140.1_3 Reverse -46 -56 4.40493 0.243
NP_441813.1_5 Reverse -43 -53 15.9097 0.01
NP_441813.1_5 Forward -56 -46 15.9097 0.01
NP_440590.1_4 Forward -53 -40 6.1158 0.0583
NP_440590.1_4 Reverse -46 -59 2.57589 0.0845
NP_440567.1_1 Forward -53 -39 6.58777 0.0816
NP_442497.1_2 Forward -144 -125 17.5024 0.162
NP_442497.1_10 Forward -53 -44 10.4228 0.0087
NP_442497.1_10 Reverse -46 -55 10.4228 0.0087
NP_440821.1_4 Reverse -43 -53 18.2696 0.00448
NP_440821.1_4 Forward -56 -46 18.2696 0.00448
NP_441239.1_9 Reverse -43 -55 4.36554 0.253
NP_441239.1_9 Forward -56 -44 4.36554 0.253
NP_440156.1_4 Forward -216 -206 15.8108 0.176
NP_441892.1_1 Forward -57 -40 -2.12444 0.218
NP_440665.1_1 Forward -213 -194 -14.7502 0.264
NP_441017.1_6 Forward -58 -44 14.1586 0.157
NP_441617.1_6 Reverse -76 -95 0.196116 0.253
NP_440546.1_4 Forward -54 -44 10.046 0.109
NP_440546.1_4 Reverse -45 -55 10.046 0.109
NP_443033.1_7 Reverse -34 -53 11.0125 0.293
NP_440462.1_6 Reverse -43 -53 7.74818 0.0699
NP_440462.1_6 Forward -56 -46 7.74818 0.0699
NP_440462.1_6 Forward -128 -118 2.04498 0.294
NP_442340.1_3 Forward -322 -303 -8.55534 0.249
NP_440868.1_4 Reverse -41 -53 6.1355 0.0878
NP_440868.1_4 Forward -58 -46 5.93884 0.0879
NP_441848.1_4 Reverse -347 -363 7.45517 0.288
NP_441848.1_7 Forward -186 -167 5.50519 0.209
NP_441084.1_6 Reverse -217 -231 16.2281 0.0689
NP_440653.1_10 Reverse -193 -212 5.50599 0.227
NP_442039.1_4 Forward -53 -46 15.1821 0.0124
NP_442039.1_4 Reverse -46 -53 15.1821 0.0124
NP_442679.1_1 Forward -158 -139 15.9291 0.0468
NP_441926.1_3 Reverse -45 -61 5.56507 0.17
NP_442837.1_3 Forward -53 -46 15.7721 0.0124
NP_442837.1_3 Reverse -46 -53 15.7721 0.0124
NP_441760.1_7 Forward -52 -34 8.08229 0.265
NP_440160.1_2 Forward -33 -14 -0.885524 0.232
NP_442053.1_1 Forward -54 -45 18.3876 0.0007
NP_442053.1_1 Reverse -45 -54 18.3876 0.0007
NP_440505.1_3 Reverse -43 -53 16.303 0.00696
NP_440505.1_3 Forward -56 -46 16.303 0.00696
NP_441536.1_1 Forward -200 -181 28.7121 0.000306
NP_441536.1_2 Forward -47 -28 33.8253 0.00000943
NP_441536.1_3 Forward -163 -144 32.3503 0.000018
NP_441536.1_4 Forward -70 -52 34.0417 0.0000124
NP_441536.1_5 Forward -220 -201 29.5971 0.000769
NP_441536.1_6 Forward -244 -225 27.5904 0.00046
NP_441536.1_7 Forward -27 -8 26.9412 0.00326
NP_441536.1_8 Forward -142 -123 27.2371 0.00244
NP_441536.1_9 Forward -266 -247 26.1555 0.00675
NP_441203.1_1 Forward -53 -34 -18.9784 0.297
NP_441203.1_1 Reverse -46 -65 -20.5517 0.297
NP_442532.1_4 Forward -93 -75 7.28623 0.3
NP_440914.1_1 Forward -54 -44 17.5935 0.000537
NP_440914.1_1 Reverse -45 -55 17.5935 0.000537
NP_441011.1_8 Forward -53 -44 8.25953 0.144
NP_441011.1_8 Reverse -46 -55 8.25953 0.144
NP_442101.1_10 Forward -62 -43 -7.86702 0.222
NP_442533.1_1 Forward -51 -32 -13.7669 0.238
NP_442533.1_6 Forward -54 -45 17.2076 0.00137
NP_442533.1_6 Reverse -45 -54 17.2076 0.00137
NP_440661.1_6 Reverse -13 -32 6.68596 0.196
NP_441482.1_7 Reverse -39 -53 0.589577 0.0554
NP_441482.1_7 Forward -60 -46 -8.94853 0.193
NP_439944.1_9 Forward -53 -43 19.0562 0.00329
NP_439944.1_9 Reverse -46 -56 19.0562 0.00329
NP_441697.1_5 Forward -193 -174 -7.78302 0.249
NP_441028.1_6 Forward -212 -202 5.38779 0.255
NP_441028.1_6 Reverse -304 -314 3.51951 0.292
NP_440116.1_8 Forward -53 -34 11.7008 0.0278
NP_440116.1_8 Reverse -46 -65 -6.58872 0.211
NP_440115.1_6 Reverse -42 -52 9.41981 0.115
NP_440115.1_6 Forward -125 -115 5.5849 0.236
NP_440007.1_9 Reverse -41 -55 10.0294 0.163
NP_440007.1_9 Forward -58 -44 0.88457 0.29
NP_441602.1_3 Reverse -46 -65 -4.52377 0.268
NP_441972.1_5 Forward -53 -34 -0.000545616 0.159
NP_441106.1_1 Forward -55 -46 9.63616 0.0311
NP_441106.1_1 Reverse -44 -53 9.63616 0.0311
NP_439903.1_6 Reverse -234 -253 -1.18128 0.293
NP_441286.1_1 Forward -55 -43 21.3768 0.00196
NP_441286.1_1 Reverse -44 -56 21.3768 0.00196
NP_442674.1_3 Forward -209 -190 8.75009 0.193
NP_440670.1_8 Forward -54 -45 18.3876 0.000699
NP_440670.1_8 Reverse -45 -54 18.3876 0.000699
NP_440886.1_4 Reverse -313 -332 13.2741 0.274
NP_440886.1_7 Forward -55 -45 7.94438 0.0805
NP_440886.1_7 Reverse -44 -54 7.94438 0.0805
NP_440886.1_7 Forward -275 -265 3.91283 0.26
NP_442614.1_2 Forward -54 -40 9.2427 0.242
NP_442614.1_2 Reverse -45 -59 5.80112 0.297
NP_442382.1_7 Forward -67 -48 5.80098 0.247
NP_440404.1_8 Forward -295 -276 16.5191 0.164
NP_440404.1_9 Forward -197 -178 10.8379 0.209
NP_442072.1_9 Reverse -44 -62 -12.5672 0.0852
NP_442072.1_9 Forward -123 -105 -22.007 0.216
NP_441753.1_10 Reverse -210 -229 1.0811 0.277
NP_442264.1_2 Forward -58 -41 18.0334 0.088
NP_441463.1_3 Reverse -35 -54 -9.44032 0.28
NP_441463.1_6 Forward -56 -42 17.4322 0.114
NP_441463.1_6 Reverse -43 -57 7.96207 0.25
NP_441626.1_2 Forward -53 -46 15.7721 0.0124
NP_441626.1_2 Reverse -46 -53 15.7721 0.0124
NP_442365.1_7 Reverse -41 -60 -4.81876 0.25
NP_442794.1_1 Reverse -41 -53 19.7052 0.00523
NP_442794.1_1 Forward -205 -193 7.4138 0.138
NP_442467.1_4 Reverse -45 -64 8.35759 0.216
NP_440387.1_1 Forward -54 -38 -3.57971 0.162
NP_440387.1_1 Reverse -45 -61 -4.36636 0.185
NP_441993.1_1 Reverse -45 -64 6.52718 0.179
NP_441174.1_4 Reverse -202 -212 16.6963 0.23
NP_440114.1_10 Reverse -45 -59 10.4227 0.148
NP_441510.2_7 Forward -60 -46 10.3237 0.28
NP_441552.1_3 Reverse -38 -57 13.175 0.292
NP_440766.1_4 Reverse -41 -55 7.9644 0.0871
NP_440422.1_10 Forward -351 -332 8.46802 0.212
NP_441133.1_3 Forward -69 -50 21.2389 0.127
NP_439910.1_2 Forward -62 -45 -4.18939 0.0692
NP_439910.1_2 Reverse -37 -54 -12.8425 0.103
NP_440457.1_1 Reverse -41 -53 8.29878 0.101
NP_440457.1_1 Forward -58 -46 0.0389777 0.25
NP_442680.1_5 Forward -159 -140 0.169919 0.268
NP_440142.1_9 Reverse -131 -145 12.5853 0.284
NP_442509.1_9 Forward -54 -44 8.14104 0.192
NP_442509.1_9 Reverse -45 -55 8.14104 0.192
NP_442509.1_9 Reverse -24 -34 6.46942 0.268
NP_441440.1_1 Reverse -309 -328 13.7658 0.187
NP_440554.1_4 Forward -53 -43 7.05986 0.106
NP_440554.1_4 Reverse -46 -56 7.05986 0.106
NP_441845.1_6 Reverse -33 -51 -0.7675 0.274
NP_441885.1_5 Forward -54 -44 20.9245 0.000538
NP_441885.1_5 Reverse -45 -55 20.9245 0.000538
NP_442341.1_7 Forward -55 -41 16.1259 0.0186
NP_442341.1_7 Reverse -44 -58 8.35772 0.0881
NP_442341.1_7 Reverse -191 -205 6.78443 0.118
NP_442341.1_9 Forward -56 -42 8.94708 0.162
NP_442341.1_9 Reverse -43 -57 7.07881 0.204
NP_443000.1_7 Forward -56 -46 17.0896 0.00865
NP_443000.1_7 Reverse -43 -53 17.0896 0.00865
NP_440507.2_3 Reverse -36 -55 9.34008 0.226
NP_442513.1_5 Forward -62 -43 6.39016 0.282
NP_440275.1_3 Forward -56 -46 8.1415 0.0602
NP_440275.1_3 Reverse -43 -53 8.1415 0.0602
NP_440091.1_1 Forward -58 -46 16.4603 0.0153
NP_440091.1_1 Reverse -41 -53 -0.452677 0.273
NP_440679.1_5 Forward -51 -32 5.40766 0.292
NP_442451.1_2 Forward -62 -43 -11.2103 0.287
NP_439962.1_4 Forward -34 -15 -6.78538 0.285
NP_440149.1_8 Forward -54 -35 10.7175 0.0454
NP_440149.1_8 Reverse -45 -64 6.09597 0.0712
NP_440149.1_8 Reverse -259 -278 -7.86702 0.294
NP_441105.1_3 Forward -59 -40 4.916 0.0744
NP_441105.1_3 Reverse -34 -53 3.04771 0.0936
NP_440216.1_1 Reverse -45 -59 7.9644 0.00737
NP_440216.1_1 Forward -54 -40 -10.3252 0.145
NP_440216.1_9 Forward -47 -38 5.3096 0.298
NP_440172.1_1 Forward -54 -44 15.0247 0.00945
NP_440172.1_1 Reverse -45 -55 15.0247 0.00945
NP_442015.1_10 Reverse -41 -54 18.8988 0.00492
NP_442015.1_10 Forward -58 -45 0.60927 0.221
NP_441226.1_7 Forward -53 -46 14.4934 0.0123
NP_441226.1_7 Reverse -46 -53 14.4934 0.0123
NP_441111.1_7 Forward -53 -45 18.7023 0.00294
NP_441111.1_7 Reverse -46 -54 18.7023 0.00294
NP_442379.1_10 Forward -61 -44 -1.43612 0.223
NP_441766.1_2 Forward -54 -45 17.5026 0.00297
NP_441766.1_2 Reverse -45 -54 17.5026 0.00297
NP_440416.1_9 Forward -49 -30 -18.9784 0.267
NP_443052.1_8 Forward -64 -45 -8.752 0.179
NP_443052.1_9 Forward -326 -307 -6.49039 0.283
NP_440261.1_5 Forward -53 -40 -2.93064 0.0983
NP_440261.1_5 Reverse -46 -59 -10.6005 0.201
NP_440988.1_10 Forward -56 -42 8.4809 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCCGCTCTTTGGAGTTGGGAATTCGCATTAGCACTTTGATTTTTACCCTGGTTTATAGCACCAATTTATATTTGCTCACCACTGCCCCGGAGGAAATTACCGCTGGACTAGAAGAATTAATGGCTCCCCTACGGCGCTTTAAATTACCCATTACAGAAATCACCTTAATTTTGACCCTTGCTTTACGATTTATCCCCTTGGTGATGGAAGAAATTCAAAATCTATTCCGTTCCATTCGCACTAGGGCCATTAATTGGAAAAAACTGGGCATTAAACGGAGCGCTCAAATCTGGATTTTAGTGGTGGAAAGATTACTAGAAAACCTTTTATTGCGGGCAGAACAAATGGCGATCGCCATGGAAGTGCGGGGCTTCACCACTCCCAACGAGCATCAAGTTCA

CDS

GTGGCATCAATTGCGCATTGTTCGGGCGGATTGGTTGGTGCTGGGAACTTTGATTTTATTTTGGGGGGCTCGGATCCTGTGGGGAGGCATGGCCTGATGGAACTCCAACCCTGGCATTGGTGTTGTTTGCCCCTAGAAGGCCGCACGGGCAGTGAAATTTTTAGTCAATTATTTGGTCATCAAGGCATCGCCACCCTACTAGAAAGTCCCTATCCTGCTTCACCGGATCATCCCCATTTAGGCCGTTATTCCCTCTGTGCCGGCCAACCGAGAAAGGGTAGGTTATGGACTCCTAAGCCGGAAGAGATTTTTAGCTTTTTAAACCAACTTTGCCCATGTAATCATGATGTAAATTTGACAAAAAATATTCCTGAACATTTACCTTTCCATGGCGGTTGGTTAGGCTGGTTAGGTTACGACACTGCTTGGGCAATTGAAAAATTACCTTATTCAAAAGCTGATGATTTACCTTTTCCGGTGGCCTATTGGTACGAGCCTGAAAATTTTGTAATTTTAGATCATCAAGAGCAATTATTATGGTTAGCTACTACCGACCAGGAGAAAATTAAGTTTTTTCAAACTCAGTTAGCAGATAAAATCAACTCAGTTTCATCGCCTCAAGTGCCTCCCTTAAATTTGACCTATACCACTGACCAAGATCAGTACGAAACCATGGTCAATCAAGCGAAACAATATATTAAAGCCGGAGATATTTTTCAAGCTAATTTAACACTACGTTTCATTGCTAAAACTGAGCAAAAGCTTAACAGTTGGCAGGTCTATCAACATCTACAAACTATCAATCCTTCTCCTTTCGCTAGTTACTGGCGATCGCCGTGGGGAGATGTGGTTAGTTGTTCTCCGGAAAGATTAGTTAAGTTAGAAGGCAATGTGGCCCAAACTAGACCCATTGCTGGCACTAGGGCAAGGGGCAAAAATCTGGCGGAGGATGAACAATTATTGCAGGAGTTGCTGGTTAACACCAAAGAGTTGGCAGAACATATCATGTTGGTGGATTTAGAACGCAATGACCTCGGCCGGGTCTGTACCTGGGGAACGGTGGAAGTAGATGAATTATTGGCGATCGAGCGCTATAGCCATGTGTCCCATTTAGTTAGTAATGTAAAAGGCATTTTACAACCAGATAAAACCGGAGTAGATTTGGTCAAAGCTTTGTTTCCCGGTGGCACCATTACCGGCTGTCCCAAAATACGTTGTTTAGAAATTATTGAAGAATTAGAACCAGTGCGGCGGAGTTTGTTTTACGGTTCCTGTGGCTACTGGGATCAACGGGGGAACTTAGATTTAAATATTCTCATTCGCACCCTGTTATTCACCTCTGGACAAGTGACAGGACAAGTGGGAGCCGGCATTGTGGCAGACAGTGATCCCGCCAAGGAATGGTTAGAATCATTGCAAAAAGCCAAAGCTTTATTGGCGGCATTGGAGGGACTATAA

Protein

MASIAHCSGGLVGAGNFDFILGGSDPVGRHGLMELQPWHWCCLPLEGRTGSEIFSQLFGHQGIATLLESPYPASPDHPHLGRYSLCAGQPRKGRLWTPKPEEIFSFLNQLCPCNHDVNLTKNIPEHLPFHGGWLGWLGYDTAWAIEKLPYSKADDLPFPVAYWYEPENFVILDHQEQLLWLATTDQEKIKFFQTQLADKINSVSSPQVPPLNLTYTTDQDQYETMVNQAKQYIKAGDIFQANLTLRFIAKTEQKLNSWQVYQHLQTINPSPFASYWRSPWGDVVSCSPERLVKLEGNVAQTRPIAGTRARGKNLAEDEQLLQELLVNTKELAEHIMLVDLERNDLGRVCTWGTVEVDELLAIERYSHVSHLVSNVKGILQPDKTGVDLVKALFPGGTITGCPKIRCLEIIEELEPVRRSLFYGSCGYWDQRGNLDLNILIRTLLFTSGQVTGQVGAGIVADSDPAKEWLESLQKAKALLAALEGL