Your browser is old and dusty. Try Google Chrome!

Details for slr1975

ORF slr1975
Accession NP_441530.1
Symbol
Category N-acylglucosamine 2-epimerase
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_1 Reverse -240 -258 18.2266 0.164
NP_441061.1_2 Reverse -295 -309 11.406 0.0519
NP_441061.1_2 Forward -302 -288 6.48943 0.117
NP_440795.1_7 Forward -302 -295 14.6904 0.0123
NP_440795.1_7 Reverse -295 -302 14.6904 0.0123
NP_442100.1_1 Forward -160 -141 5.87233 0.296
NP_441418.1_6 Reverse -294 -313 -3.73712 0.0249
NP_441418.1_6 Forward -303 -284 -19.2734 0.0867
NP_442291.1_5 Reverse -293 -309 8.31834 0.0558
NP_440897.1_6 Forward -303 -284 -0.197979 0.182
NP_441453.1_1 Reverse -287 -305 3.75497 0.263
NP_441453.1_4 Reverse -294 -302 16.539 0.00633
NP_441453.1_4 Forward -303 -295 16.539 0.00633
NP_441453.1_4 Forward -46 -38 4.24765 0.259
NP_442151.1_6 Reverse -294 -308 11.3077 0.104
NP_442151.1_6 Forward -303 -289 6.6861 0.224
NP_441818.1_1 Reverse -295 -306 15.6928 0.0257
NP_441818.1_1 Forward -302 -291 9.69459 0.232
NP_440226.1_1 Reverse -294 -313 13.1758 0.0383
NP_441630.1_3 Forward -311 -292 1.67108 0.239
NP_440259.1_4 Reverse -280 -294 9.11791 0.281
NP_441098.1_3 Forward -207 -188 1.25016 0.25
NP_443002.1_5 Forward -339 -321 10.8348 0.256
NP_442173.1_1 Forward -302 -294 15.4574 0.00633
NP_442173.1_1 Reverse -295 -303 15.4574 0.00633
NP_442752.1_4 Forward -303 -296 13.8055 0.0199
NP_442752.1_4 Reverse -294 -301 13.8055 0.0199
NP_443027.1_4 Reverse -292 -302 14.828 0.0437
NP_443027.1_4 Forward -305 -295 13.1564 0.0521
NP_441812.1_3 Forward -304 -290 17.3058 0.0613
NP_442975.1_10 Reverse -290 -304 13.7653 0.0459
NP_442975.1_10 Forward -307 -293 3.34225 0.259
NP_440784.1_7 Forward -302 -295 15.9687 0.0123
NP_440784.1_7 Reverse -295 -302 15.9687 0.0123
NP_442909.1_7 Reverse -295 -309 20.8451 0.0224
NP_440061.1_9 Reverse -292 -306 20.4518 0.0035
NP_440110.1_8 Reverse -342 -361 -0.590531 0.225
NP_442062.1_3 Reverse -140 -159 -2.26216 0.269
NP_442062.1_8 Forward -303 -293 19.4496 0.000558
NP_442062.1_8 Reverse -294 -304 17.3846 0.00193
NP_441859.1_3 Reverse -293 -312 9.53674 0.129
NP_441802.1_1 Forward -387 -368 8.94757 0.22
NP_440304.1_4 Reverse -292 -302 10.8948 0.051
NP_440304.1_4 Forward -305 -295 9.91146 0.051
NP_442242.1_4 Forward -302 -295 14.3954 0.0124
NP_442242.1_4 Reverse -295 -302 14.3954 0.0124
NP_440044.1_8 Reverse -295 -314 -2.85214 0.272
NP_440044.1_8 Forward -302 -283 -3.83545 0.292
NP_442097.1_9 Reverse -302 -320 12.8022 0.271
NP_442207.1_4 Reverse -14 -33 7.7676 0.285
NP_442602.1_3 Forward -358 -339 -0.197208 0.216
NP_439918.1_3 Forward -306 -287 3.6377 0.266
NP_441208.1_9 Forward -306 -292 13.7659 0.103
NP_441594.1_6 Forward -312 -293 1.0811 0.274
NP_440370.1_10 Forward -312 -293 7.96426 0.244
NP_442110.1_7 Reverse -294 -308 8.25939 0.0953
NP_441083.1_3 Reverse -324 -334 13.1559 0.22
NP_441083.1_5 Reverse -294 -304 20.3345 0.00053
NP_441083.1_5 Forward -303 -293 11.3864 0.0159
NP_442827.1_8 Forward -311 -292 10.6184 0.0597
NP_441434.1_6 Reverse -220 -230 15.5163 0.277
NP_441141.1_2 Reverse -293 -312 13.2733 0.283
NP_441738.1_2 Forward -301 -294 15.28 0.0102
NP_441738.1_2 Reverse -296 -303 15.28 0.0102
NP_440209.1_1 Reverse -294 -302 18.1123 0.00295
NP_440209.1_1 Forward -303 -295 18.1123 0.00295
NP_442889.1_8 Reverse -291 -305 13.4703 0.0588
NP_441770.1_4 Reverse -253 -272 -12.4886 0.291
NP_441770.1_10 Forward -371 -352 11.2092 0.23
NP_440178.1_7 Reverse -293 -312 -13.1769 0.129
NP_442570.1_3 Forward -387 -368 -8.55534 0.288
NP_441716.1_1 Reverse -294 -308 19.9608 0.00829
NP_441327.1_5 Forward -286 -277 15.0444 0.191
NP_442111.1_4 Reverse -293 -307 2.5562 0.271
NP_441163.1_1 Reverse -29 -46 11.6411 0.183
NP_440906.1_5 Forward -302 -295 15.8704 0.0124
NP_440906.1_5 Reverse -295 -302 15.8704 0.0124
NP_440747.1_10 Forward -306 -294 7.51213 0.00286
NP_440747.1_10 Reverse -291 -303 -2.02597 0.0196
NP_441130.1_10 Reverse -292 -306 20.0591 0.00928
NP_441130.1_10 Forward -305 -291 8.16106 0.14
NP_441486.1_1 Reverse -291 -305 13.1759 0.00897
NP_441486.1_1 Forward -306 -292 11.3077 0.0164
NP_442145.1_4 Forward -168 -149 10.1695 0.163
NP_442634.1_4 Forward -305 -291 -3.63866 0.161
NP_440470.1_5 Reverse -143 -162 7.30471 0.278
NP_440403.1_4 Forward -312 -293 11.0125 0.068
NP_440842.1_10 Reverse -80 -94 2.45787 0.274
NP_441014.1_10 Forward -304 -285 4.32522 0.197
NP_442848.1_1 Forward -309 -295 26.0573 0.00131
NP_442848.1_5 Forward -341 -323 1.98577 0.276
NP_441012.1_4 Reverse -296 -309 6.80412 0.276
NP_443018.1_3 Forward -302 -295 14.8871 0.0123
NP_443018.1_3 Reverse -295 -302 14.8871 0.0123
NP_443018.1_3 Forward -45 -38 10.7572 0.0907
NP_443018.1_3 Reverse -38 -45 4.56234 0.241
NP_441316.1_7 Reverse -292 -307 -3.26502 0.273
NP_441634.1_8 Forward -305 -291 5.21113 0.114
NP_441634.1_8 Reverse -292 -306 3.14618 0.155
NP_440376.1_1 Forward -303 -294 19.4693 0.000692
NP_440376.1_1 Reverse -294 -303 19.4693 0.000692
NP_441857.1_5 Forward -310 -292 8.67227 0.185
NP_441588.1_4 Forward -301 -291 6.96153 0.178
NP_442687.1_7 Reverse -293 -303 15.8113 0.0125
NP_442687.1_7 Forward -304 -294 8.92815 0.0994
NP_442687.1_7 Reverse -36 -46 5.38824 0.206
NP_441846.1_10 Forward -380 -361 -22.125 0.257
NP_440642.1_10 Reverse -279 -293 13.5686 0.13
NP_440642.1_10 Reverse -264 -278 6.68548 0.225
NP_441013.1_2 Reverse -320 -338 -4.8974 0.299
NP_441422.1_7 Reverse -292 -309 6.82368 0.0992
NP_442658.1_1 Reverse -292 -302 15.9091 0.00966
NP_442658.1_1 Reverse -35 -45 10.206 0.128
NP_442658.1_1 Forward -305 -295 9.616 0.147
NP_441553.1_9 Reverse -137 -156 8.45592 0.263
NP_441855.2_8 Reverse -353 -372 18.5831 0.185
NP_441414.1_9 Forward -303 -284 -5.80207 0.18
NP_440184.1_1 Forward -166 -147 15.1262 0.0864
NP_442937.1_5 Forward -308 -289 13.6675 0.0879
NP_441958.1_5 Forward -304 -294 12.2714 0.00183
NP_441958.1_5 Reverse -293 -303 12.2714 0.00183
NP_442486.1_6 Reverse -288 -307 -5.9004 0.28
NP_442836.1_5 Forward -309 -290 23.1072 0.0122
NP_440203.1_5 Reverse -378 -388 14.3359 0.0886
NP_440203.1_5 Reverse -297 -307 12.6642 0.141
NP_440984.1_7 Reverse -320 -334 16.1259 0.0466
NP_440984.1_7 Reverse -126 -140 6.29277 0.219
NP_441162.1_3 Forward -346 -327 11.2092 0.21
NP_439990.1_5 Reverse -289 -302 6.70579 0.223
NP_442690.1_1 Reverse -141 -160 -2.16383 0.134
NP_442690.1_1 Forward -165 -146 -16.3235 0.287
NP_442911.1_2 Forward -313 -294 3.93269 0.0406
NP_442911.1_2 Reverse -284 -303 -1.7705 0.0897
NP_440153.1_5 Reverse -295 -309 17.8958 0.0482
NP_440153.1_8 Reverse -294 -307 4.44418 0.2
NP_440858.1_1 Forward -360 -341 2.16274 0.183
NP_442536.1_4 Reverse -336 -354 11.0322 0.211
NP_440200.1_6 Forward -64 -45 9.63589 0.176
NP_443055.1_3 Forward -312 -293 15.1332 0.105
NP_440993.1_2 Forward -308 -292 1.92682 0.272
NP_440496.1_1 Forward -108 -89 3.04771 0.266
NP_441099.1_5 Forward -49 -30 -11.4069 0.28
NP_441099.1_5 Forward -313 -294 -11.7019 0.288
NP_441099.1_5 Forward -114 -95 -12.2919 0.299
NP_442002.1_9 Reverse -293 -300 10.7572 0.185
NP_440809.1_9 Reverse -285 -303 -7.94566 0.225
NP_441294.1_7 Reverse -290 -304 9.4426 0.244
NP_441646.1_1 Forward -52 -33 -0.197208 0.259
NP_441646.1_1 Forward -310 -291 -0.590531 0.269
NP_442438.1_10 Forward -308 -294 9.43936 0.0637
NP_442438.1_10 Reverse -289 -303 1.57289 0.191
NP_442885.1_4 Forward -90 -77 15.6342 0.264
NP_441000.1_6 Forward -304 -290 -3.44199 0.221
NP_441000.1_6 Reverse -293 -307 -5.60527 0.285
NP_441110.1_10 Reverse -367 -386 16.0274 0.152
NP_440147.1_4 Reverse -292 -305 12.8023 0.0326
NP_440147.1_4 Forward -305 -292 0.805932 0.244
NP_441175.1_7 Reverse -134 -153 5.60432 0.276
NP_441550.1_8 Forward -305 -295 16.7941 0.00906
NP_441550.1_8 Reverse -292 -302 6.0761 0.214
NP_441916.1_7 Forward -303 -293 18.4663 0.00144
NP_441916.1_7 Reverse -294 -304 10.3048 0.0261
NP_441041.1_4 Forward -303 -284 -11.9969 0.256
NP_441041.1_7 Reverse -291 -303 10.916 0.0864
NP_442396.1_5 Reverse -290 -303 6.90245 0.215
NP_440569.1_10 Forward -161 -142 7.11373 0.231
NP_442004.1_6 Reverse -294 -308 8.94771 0.14
NP_441725.1_5 Forward -302 -292 11.2881 0.0247
NP_441725.1_5 Reverse -295 -305 9.02648 0.0553
NP_441725.1_5 Forward -45 -35 5.68323 0.115
NP_439966.1_7 Reverse -292 -302 18.4657 0.00473
NP_439966.1_7 Forward -305 -295 14.8275 0.0177
NP_439966.1_9 Reverse -292 -301 0.983037 0.253
NP_439966.1_9 Forward -305 -296 0.884706 0.253
NP_442941.1_3 Forward -302 -292 11.4848 0.0116
NP_442941.1_3 Reverse -295 -305 10.9931 0.0116
NP_440289.1_2 Reverse -291 -304 21.3571 0.00262
NP_440289.1_2 Forward -306 -293 -4.50394 0.288
NP_440983.1_9 Forward -312 -293 4.62101 0.285
NP_440260.1_7 Forward -107 -88 -2.55715 0.241
NP_442281.1_1 Reverse -289 -303 11.012 0.0511
NP_442281.1_1 Forward -308 -294 6.98048 0.111
NP_442281.1_1 Forward -339 -325 2.65393 0.26
NP_441334.1_7 Reverse -292 -311 -20.3551 0.275
NP_442575.1_8 Forward -281 -262 -3.73712 0.255
NP_442256.1_2 Forward -305 -287 -8.83064 0.236
NP_440437.1_1 Reverse -288 -307 10.3242 0.0441
NP_442049.1_6 Forward -311 -292 7.7676 0.215
NP_441087.1_6 Reverse -267 -285 -3.32482 0.296
NP_441457.1_7 Forward -371 -352 2.55606 0.255
NP_442982.1_5 Forward -344 -325 -1.18052 0.263
NP_441644.1_6 Reverse -294 -304 17.3841 0.00127
NP_441644.1_6 Forward -303 -293 10.1076 0.0628
NP_441644.1_6 Reverse -325 -335 6.27276 0.163
NP_441644.1_6 Forward -46 -36 3.91283 0.256
NP_442215.1_2 Reverse -323 -339 6.35172 0.0719
NP_442215.1_2 Forward -305 -289 1.43517 0.134
NP_442215.1_2 Reverse -358 -374 -3.8747 0.223
NP_442215.1_2 Reverse -373 -389 -6.92296 0.281
NP_440253.1_2 Forward -303 -285 7.98396 0.064
NP_440253.1_2 Reverse -294 -312 2.96908 0.126
NP_440929.1_8 Forward -303 -294 19.2726 0.000701
NP_440929.1_8 Reverse -294 -303 19.2726 0.000701
NP_440929.1_9 Reverse -350 -364 15.6342 0.279
NP_442933.1_10 Forward -303 -294 17.601 0.00325
NP_442933.1_10 Reverse -294 -303 17.601 0.00325
NP_441751.2_8 Forward -302 -288 3.14618 0.0713
NP_441751.2_8 Reverse -295 -309 -3.04867 0.134
NP_442554.1_8 Reverse -295 -305 18.0729 0.00543
NP_442554.1_8 Forward -302 -292 13.8447 0.0145
NP_442554.1_8 Reverse -326 -336 4.69992 0.176
NP_441762.1_7 Reverse -293 -305 11.8387 0.0142
NP_441762.1_7 Forward -304 -292 2.89058 0.0676
NP_441762.1_7 Forward -47 -35 -6.94252 0.284
NP_442142.1_4 Reverse -291 -304 15.85 0.0264
NP_442142.1_4 Forward -337 -324 11.5234 0.0552
NP_442142.1_4 Forward -306 -293 6.90188 0.153
NP_442292.1_1 Reverse -295 -304 18.486 0.00229
NP_442292.1_1 Forward -302 -293 9.63616 0.0183
NP_442292.1_5 Forward -307 -288 -0.4922 0.257
NP_440919.1_7 Reverse -319 -337 11.4282 0.171
NP_442476.1_6 Reverse -295 -309 9.83269 0.0801
NP_441711.1_4 Forward -312 -293 11.6025 0.106
NP_443009.1_2 Reverse -296 -315 0.884433 0.216
NP_443009.1_5 Forward -304 -293 18.3477 0.00265
NP_441726.1_4 Forward -213 -199 13.2743 0.288
NP_441865.1_3 Forward -172 -154 18.3087 0.0897
NP_441865.1_3 Reverse -212 -230 13.0972 0.255
NP_441715.1_4 Forward -302 -292 16.303 0.0117
NP_441715.1_4 Reverse -295 -305 7.84651 0.107
NP_440620.1_4 Reverse -201 -215 14.6219 0.272
NP_441448.1_1 Reverse -292 -311 7.7676 0.211
NP_441448.1_1 Forward -110 -91 4.42435 0.279
NP_440158.1_1 Reverse -151 -170 9.69201 0.269
NP_441198.1_5 Reverse -296 -309 15.7516 0.206
NP_440379.1_5 Reverse -316 -335 -7.76869 0.248
NP_441468.1_1 Forward -302 -295 15.8704 0.0124
NP_441468.1_1 Reverse -295 -302 15.8704 0.0124
NP_441468.1_1 Reverse -38 -45 4.07068 0.263
NP_441020.2_6 Forward -305 -288 11.9369 0.107
NP_441015.1_8 Forward -249 -230 4.916 0.258
NP_441015.1_8 Forward -340 -321 2.85105 0.272
NP_441015.1_10 Forward -339 -320 -5.11376 0.217
NP_441015.1_10 Reverse -21 -40 -8.45701 0.273
NP_441673.1_1 Forward -303 -294 20.8459 0.000698
NP_441673.1_1 Reverse -294 -303 20.8459 0.000698
NP_441826.1_2 Forward -309 -295 18.7808 0.0115
NP_441826.1_2 Forward -39 -25 0.294584 0.19
NP_442490.1_9 Reverse -282 -301 -3.73712 0.244
NP_441764.1_1 Reverse -140 -159 11.2092 0.164
NP_441764.1_8 Forward -235 -225 11.5978 0.284
NP_442868.1_6 Forward -305 -295 17.4829 0.012
NP_442868.1_6 Reverse -292 -302 0.963343 0.205
NP_442719.1_2 Forward -159 -141 -0.473239 0.162
NP_441612.1_2 Reverse -294 -304 8.54929 0.21
NP_443058.1_7 Forward -85 -66 1.86774 0.294
NP_442808.1_1 Reverse -293 -303 18.4657 0.00201
NP_442808.1_1 Forward -304 -294 8.63269 0.0481
NP_441101.1_10 Reverse -354 -373 -0.39387 0.189
NP_442775.1_1 Reverse -292 -311 12.8808 0.274
NP_440145.1_3 Forward -313 -294 -0.295539 0.14
NP_442542.1_2 Forward -305 -292 4.54251 0.3
NP_442050.1_1 Reverse -30 -49 6.78429 0.281
NP_442050.1_5 Forward -305 -295 15.6142 0.01
NP_442050.1_5 Reverse -292 -302 9.12434 0.193
NP_441114.1_3 Reverse -377 -386 8.25953 0.231
NP_441114.1_3 Forward -44 -35 7.96454 0.231
NP_440558.1_2 Reverse -357 -376 2.0644 0.173
NP_440558.1_2 Forward -49 -30 -4.6221 0.247
NP_440111.2_2 Forward -314 -295 1.37609 0.201
NP_441518.1_3 Forward -313 -294 -12.4886 0.263
NP_441878.1_6 Forward -304 -294 10.4031 0.0176
NP_441878.1_6 Reverse -293 -303 10.4031 0.0176
NP_441878.1_6 Reverse -324 -334 9.7148 0.0237
NP_441878.1_6 Forward -335 -325 1.06167 0.116
NP_441878.1_6 Forward -370 -360 -7.19813 0.21
NP_441878.1_6 Reverse -36 -46 -7.59145 0.245
NP_441036.1_8 Reverse -293 -303 17.7779 0.000554
NP_441036.1_8 Forward -304 -294 8.33817 0.174
NP_442650.1_2 Reverse -294 -308 4.71948 0.163
NP_441557.1_5 Forward -303 -294 19.9609 0.000699
NP_441557.1_5 Reverse -294 -303 19.9609 0.000699
NP_441445.1_1 Reverse -285 -304 9.93088 0.0994
NP_441445.1_1 Forward -149 -130 2.26107 0.238
NP_441445.1_1 Forward -312 -293 1.96607 0.245
NP_441590.1_4 Forward -37 -18 4.03023 0.29
NP_442066.2_9 Reverse -290 -303 9.36073 0.175
NP_441433.1_8 Reverse -326 -345 1.17943 0.236
NP_441308.1_8 Reverse -292 -302 10.1081 0.22
NP_440101.1_5 Reverse -287 -306 14.7491 0.109
NP_441458.1_10 Reverse -285 -304 12.3892 0.091
NP_442183.1_1 Reverse -294 -308 15.7325 0.0187
NP_442183.1_1 Forward -303 -289 13.4709 0.0423
NP_440086.1_4 Forward -180 -166 18.6311 0.163
NP_441819.1_5 Forward -165 -146 9.7875 0.261
NP_442347.1_2 Reverse -295 -304 12.4878 0.056
NP_442347.1_2 Forward -302 -293 11.1111 0.056
NP_442645.1_2 Forward -311 -292 -20.7484 0.288
NP_441037.1_4 Forward -305 -295 9.55921 0.21
NP_441037.1_4 Reverse -292 -302 7.02532 0.237
NP_442594.1_8 Forward -286 -267 5.01433 0.254
NP_441633.1_3 Reverse -292 -305 6.01747 0.0481
NP_441633.1_3 Forward -305 -292 1.29759 0.109
NP_441633.1_7 Forward -46 -27 26.0572 0.00376
NP_440136.1_2 Forward -302 -295 15.9687 0.0123
NP_440136.1_2 Reverse -295 -302 15.9687 0.0123
NP_442590.1_10 Reverse -24 -43 6.78429 0.237
NP_442590.1_10 Forward -309 -290 3.04771 0.297
NP_442998.1_5 Forward -103 -93 12.3697 0.174
NP_442998.1_5 Forward -352 -342 10.8948 0.201
NP_442998.1_5 Reverse -140 -150 10.8948 0.201
NP_442998.1_5 Reverse -81 -91 7.74818 0.284
NP_442998.1_5 Forward -285 -275 7.45319 0.292
NP_442998.1_10 Forward -301 -294 15.5754 0.0102
NP_442998.1_10 Reverse -296 -303 15.5754 0.0102
NP_440299.1_1 Forward -307 -294 19.4882 0.00234
NP_440299.1_1 Reverse -296 -309 2.28034 0.292
NP_440299.1_1 Reverse -290 -303 2.18201 0.294
NP_441799.1_1 Reverse -290 -304 11.012 0.0629
NP_441799.1_1 Forward -307 -293 10.0287 0.0797
NP_441007.1_10 Forward -308 -295 8.86907 0.108
NP_440256.1_1 Reverse -291 -310 -0.197208 0.0907
NP_440256.1_1 Forward -337 -318 -8.65367 0.264
NP_440256.1_1 Reverse -17 -36 -9.24366 0.275
NP_440256.1_1 Forward -306 -287 -9.44032 0.28
NP_441090.1_6 Forward -391 -377 10.226 0.239
NP_441090.1_6 Reverse -325 -339 9.14437 0.261
NP_440709.1_1 Forward -159 -140 12.1917 0.0464
NP_441559.1_8 Reverse -289 -303 -6.29359 0.276
NP_441559.1_8 Forward -308 -294 -6.68692 0.279
NP_440915.1_6 Forward -307 -293 5.60446 0.088
NP_440915.1_6 Reverse -290 -304 -3.24533 0.292
NP_440717.1_3 Forward -344 -330 8.75042 0.258
NP_441704.1_8 Forward -314 -295 12.0933 0.122
NP_440702.1_5 Reverse -325 -344 11.6025 0.0964
NP_441494.1_6 Reverse -180 -193 7.00078 0.269
NP_442993.1_1 Forward -303 -287 9.30165 0.0201
NP_442386.1_9 Reverse -293 -302 15.7322 0.0144
NP_442386.1_9 Forward -304 -295 13.8639 0.0289
NP_441340.1_5 Forward -302 -295 15.6737 0.0124
NP_441340.1_5 Reverse -295 -302 15.6737 0.0124
NP_441340.1_5 Forward -45 -38 3.97235 0.274
NP_441340.1_9 Forward -286 -276 8.25522 0.256
NP_441947.1_4 Reverse -283 -302 14.9458 0.16
NP_440194.1_3 Forward -313 -294 3.24438 0.271
NP_439976.1_5 Forward -98 -84 11.602 0.268
NP_442240.1_1 Reverse -265 -284 10.1267 0.207
NP_442240.1_2 Reverse -295 -314 -14.9469 0.195
NP_440161.1_3 Forward -305 -286 17.0107 0.0774
NP_440586.1_8 Forward -302 -295 13.2151 0.026
NP_440586.1_8 Reverse -295 -302 13.2151 0.026
NP_442251.1_6 Forward -302 -295 15.2804 0.0124
NP_442251.1_6 Reverse -295 -302 15.2804 0.0124
NP_442959.1_5 Reverse -143 -162 4.81767 0.299
NP_441262.1_3 Reverse -294 -301 14.7888 0.0223
NP_441262.1_3 Forward -303 -296 14.7888 0.0223
NP_440027.1_3 Forward -313 -295 8.08151 0.196
NP_440027.1_3 Forward -39 -21 6.40989 0.225
NP_440027.1_3 Reverse -294 -312 2.08335 0.293
NP_443051.1_1 Reverse -293 -302 10.4228 0.00754
NP_443051.1_1 Forward -304 -295 10.4228 0.00754
NP_443051.1_5 Reverse -172 -191 7.96426 0.235
NP_439937.1_8 Reverse -292 -311 -1.7705 0.249
NP_439937.1_9 Reverse -293 -310 -8.02495 0.173
NP_439937.1_9 Forward -304 -287 -16.4814 0.287
NP_442294.1_3 Forward -95 -81 16.3219 0.165
NP_440439.1_1 Forward -306 -293 10.8357 0.0339
NP_440439.1_1 Reverse -291 -304 1.19926 0.159
NP_442239.1_8 Forward -369 -350 4.52268 0.296
NP_440372.1_2 Forward -302 -295 16.3621 0.0124
NP_440372.1_2 Reverse -295 -302 16.3621 0.0124
NP_440574.1_3 Reverse -289 -308 1.37609 0.19
NP_440316.1_10 Reverse -324 -334 5.5849 0.291
NP_441803.1_2 Forward -260 -241 6.09597 0.159
NP_441803.1_2 Reverse -289 -308 -1.37718 0.298
NP_439977.1_5 Reverse -288 -307 11.7008 0.0652
NP_439977.1_7 Forward -57 -38 10.9134 0.266
NP_442384.1_10 Reverse -294 -307 12.9006 0.0241
NP_442384.1_10 Forward -303 -290 6.50913 0.0995
NP_441877.1_7 Forward -314 -295 2.55527 0.225
NP_441877.1_9 Forward -168 -151 11.2486 0.164
NP_442790.1_4 Forward -312 -293 -1.47551 0.103
NP_442262.1_10 Forward -302 -295 14.1988 0.0123
NP_442262.1_10 Reverse -295 -302 14.1988 0.0123
NP_442262.1_10 Forward -45 -38 9.87221 0.164
NP_441689.1_5 Reverse -292 -302 8.53436 0.132
NP_441689.1_5 Forward -305 -295 5.87944 0.197
NP_440163.1_10 Reverse -291 -301 15.2213 0.0762
NP_440344.1_10 Reverse -287 -304 19.6067 0.00203
NP_440344.1_10 Forward -310 -293 -2.81276 0.074
NP_440075.1_2 Forward -388 -369 4.71934 0.292
NP_440282.1_10 Forward -344 -325 -8.752 0.263
NP_440531.1_6 Forward -311 -292 3.93269 0.135
NP_441965.1_10 Forward -306 -290 8.61333 0.123
NP_441640.1_8 Forward -302 -283 7.07928 0.111
NP_440297.1_9 Forward -302 -292 9.32148 0.0917
NP_440297.1_9 Reverse -295 -305 -0.216628 0.282
NP_442280.1_10 Reverse -372 -390 7.30503 0.268
NP_442280.1_10 Forward -344 -326 6.23363 0.28
NP_441896.1_3 Forward -312 -293 1.76941 0.209
NP_441103.1_2 Forward -314 -296 6.60656 0.298
NP_440894.1_10 Reverse -289 -308 14.6508 0.0965
NP_440999.1_9 Reverse -290 -304 11.111 0.0474
NP_440999.1_9 Forward -307 -293 2.85119 0.142
NP_440888.1_2 Reverse -294 -308 18.8785 0.00178
NP_440888.1_2 Forward -303 -289 14.5519 0.0168
NP_440888.1_2 Forward -39 -25 10.1271 0.104
NP_440888.1_2 Forward -115 -101 6.39049 0.236
NP_440600.1_1 Forward -156 -137 16.1855 0.158
NP_440600.1_4 Forward -311 -293 0.0191479 0.146
NP_440491.1_1 Forward -306 -287 10.0356 0.202
NP_440491.1_1 Reverse -27 -46 6.91701 0.284
NP_439969.1_1 Forward -117 -98 -6.29373 0.288
NP_442033.1_10 Reverse -292 -311 5.30933 0.077
NP_440575.1_8 Forward -400 -381 0.491109 0.185
NP_441543.1_2 Forward -302 -293 18.486 0.00236
NP_441543.1_2 Reverse -295 -304 16.9127 0.00359
NP_442845.1_2 Forward -309 -295 4.71948 0.254
NP_441304.1_10 Reverse -336 -345 13.2744 0.25
NP_441178.1_6 Reverse -322 -341 4.81688 0.268
NP_441319.1_8 Reverse -288 -306 11.5239 0.147
NP_441469.1_8 Reverse -293 -302 16.126 0.00797
NP_441469.1_8 Reverse -36 -45 8.94785 0.227
NP_441469.1_8 Forward -304 -295 6.48957 0.227
NP_443064.1_6 Reverse -294 -304 12.5669 0.0796
NP_442578.1_7 Forward -302 -295 14.5921 0.026
NP_442578.1_7 Reverse -295 -302 14.5921 0.026
NP_440710.1_1 Reverse -349 -367 -9.32229 0.297
NP_441462.1_2 Forward -303 -293 11.5831 0.00406
NP_441462.1_2 Reverse -294 -304 11.5831 0.00406
NP_441621.1_7 Reverse -292 -306 -3.24533 0.188
NP_441621.1_7 Forward -305 -291 -3.44199 0.188
NP_443062.1_1 Forward -303 -285 6.49827 0.198
NP_443062.1_1 Reverse -300 -318 3.86557 0.282
NP_443062.1_6 Reverse -286 -305 12.2908 0.0996
NP_442204.1_1 Forward -338 -327 6.74518 0.152
NP_442204.1_1 Forward -307 -296 0.648657 0.281
NP_442204.1_5 Reverse -284 -303 2.75272 0.206
NP_440544.1_5 Reverse -228 -235 13.8024 0.28
NP_440516.1_2 Reverse -288 -306 -1.75081 0.292
NP_440516.1_8 Forward -303 -294 16.9127 0.00442
NP_440516.1_8 Reverse -294 -303 16.9127 0.00442
NP_442428.1_5 Forward -302 -295 15.8704 0.0124
NP_442428.1_5 Reverse -295 -302 15.8704 0.0124
NP_442428.1_5 Reverse -38 -45 4.46401 0.267
NP_441867.1_2 Forward -258 -239 -13.7669 0.277
NP_440673.1_2 Reverse -315 -334 9.60917 0.24
NP_440673.1_3 Forward -301 -294 12.4288 0.0426
NP_440673.1_3 Reverse -296 -303 12.4288 0.0426
NP_440673.1_3 Forward -44 -37 9.67555 0.179
NP_440673.1_3 Reverse -377 -384 6.72562 0.277
NP_440673.1_7 Reverse -235 -254 14.6508 0.0925
NP_441052.1_2 Reverse -294 -304 19.9412 0.00106
NP_441052.1_2 Forward -303 -293 10.5014 0.0285
NP_442219.1_9 Reverse -295 -304 17.7976 0.00718
NP_442219.1_9 Forward -302 -293 8.35786 0.0681
NP_440436.1_4 Forward -302 -293 18.1905 0.00233
NP_440436.1_4 Reverse -295 -304 17.2072 0.00233
NP_441884.1_8 Reverse -293 -312 0.491109 0.138
NP_441884.1_9 Reverse -291 -310 14.3558 0.0078
NP_441086.1_3 Forward -163 -144 11.0381 0.17
NP_441719.1_4 Forward -302 -295 16.3621 0.0124
NP_441719.1_4 Reverse -295 -302 16.3621 0.0124
NP_441733.1_10 Forward -306 -293 10.639 0.106
NP_441004.1_1 Reverse -282 -301 -15.8318 0.279
NP_441231.1_3 Reverse -377 -396 12.88 0.259
NP_441577.1_1 Reverse -143 -162 13.8641 0.214
NP_442366.1_3 Forward -304 -286 7.39397 0.0747
NP_440129.1_10 Reverse -287 -301 3.63784 0.191
NP_442694.1_4 Forward -93 -84 13.8644 0.217
NP_442694.1_4 Reverse -222 -231 10.8161 0.294
NP_442206.1_10 Reverse -294 -309 1.06154 0.238
NP_440328.1_4 Forward -35 -16 -0.787193 0.289
NP_443054.1_2 Forward -305 -291 3.34284 0.24
NP_443054.1_2 Reverse -292 -306 3.04785 0.24
NP_441851.1_10 Reverse -293 -303 16.008 0.00552
NP_441851.1_10 Forward -304 -294 15.8113 0.00552
NP_442622.1_8 Reverse -294 -312 -18.8604 0.285
NP_441668.1_4 Forward -251 -232 3.6377 0.187
NP_442515.1_1 Forward -304 -290 4.03116 0.109
NP_442515.1_1 Reverse -293 -307 2.65453 0.131
NP_441982.1_6 Reverse -80 -89 13.5358 0.274
NP_441982.1_6 Reverse -149 -158 12.4854 0.275
NP_442689.1_8 Reverse -145 -162 -4.97604 0.268
NP_441349.1_10 Reverse -284 -303 -9.73531 0.297
NP_441409.1_6 Reverse -288 -307 -15.5368 0.297
NP_441107.1_1 Forward -271 -252 17.0107 0.287
NP_440432.1_9 Reverse -295 -310 -1.10174 0.167
NP_442843.1_1 Reverse -38 -57 -1.96717 0.202
NP_442843.1_1 Forward -333 -314 -9.44032 0.266
NP_440474.1_8 Forward -302 -288 14.3553 0.0637
NP_440474.1_8 Forward -135 -121 6.58715 0.222
NP_441124.1_5 Reverse -140 -150 17.4963 0.168
NP_442450.1_5 Reverse -292 -302 9.32148 0.115
NP_440588.1_2 Reverse -285 -304 -2.16383 0.161
NP_440195.1_4 Forward -318 -299 12.5858 0.127
NP_442006.1_2 Reverse -325 -342 -5.76269 0.146
NP_442006.1_2 Reverse -331 -348 -6.25434 0.159
NP_442006.1_2 Forward -334 -317 -19.0374 0.297
NP_441003.1_9 Forward -343 -324 6.39097 0.249
NP_442243.1_1 Forward -309 -291 1.19838 0.219
NP_441570.1_1 Reverse -294 -312 11.9172 0.00702
NP_441078.1_4 Forward -303 -294 19.6659 0.0007
NP_441078.1_4 Reverse -294 -303 19.6659 0.0007
NP_441078.1_4 Forward -334 -325 -1.37691 0.254
NP_441078.1_4 Reverse -325 -334 -1.47524 0.266
NP_442729.1_8 Reverse -290 -303 9.45906 0.125
NP_442729.1_8 Forward -307 -294 8.77074 0.125
NP_440539.1_9 Reverse -73 -92 -1.47551 0.286
NP_442348.1_2 Reverse -338 -347 7.57121 0.28
NP_440526.1_3 Reverse -295 -306 10.6779 0.0646
NP_440526.1_3 Forward -302 -291 1.92649 0.267
NP_441432.1_8 Forward -304 -295 16.8143 0.00595
NP_441432.1_8 Reverse -293 -302 8.25953 0.0755
NP_441432.1_9 Forward -188 -175 8.79228 0.287
NP_442320.1_8 Forward -309 -295 4.81781 0.0459
NP_442320.1_8 Reverse -288 -302 -2.65535 0.0926
NP_441732.1_2 Reverse -290 -306 2.91013 0.0145
NP_441732.1_2 Forward -307 -291 -16.0677 0.164
NP_440629.1_1 Reverse -141 -159 1.98577 0.245
NP_440629.1_4 Reverse -131 -150 7.47261 0.292
NP_440760.1_1 Reverse -294 -313 -7.08038 0.0677
NP_442797.1_7 Forward -47 -29 0.117479 0.278
NP_440131.1_4 Reverse -324 -343 18.0924 0.2
NP_440199.1_10 Reverse -291 -301 14.533 0.0861
NP_442407.1_6 Forward -254 -235 9.43923 0.296
NP_442400.1_10 Reverse -145 -158 9.61097 0.271
NP_440713.1_4 Reverse -20 -39 6.68596 0.187
NP_440713.1_4 Forward -313 -294 6.39097 0.19
NP_442489.1_2 Reverse -283 -302 14.0608 0.137
NP_442489.1_7 Forward -303 -294 20.1576 0.000695
NP_442489.1_7 Reverse -294 -303 20.1576 0.000695
NP_442489.1_7 Forward -334 -325 -1.37691 0.195
NP_442489.1_7 Reverse -325 -334 -1.47524 0.203
NP_442079.1_6 Forward -342 -323 12.3892 0.289
NP_442079.1_7 Forward -302 -283 1.17943 0.26
NP_440559.1_1 Reverse -295 -304 17.4043 0.00658
NP_440559.1_1 Forward -302 -293 8.75118 0.0586
NP_440559.1_1 Reverse -38 -47 4.42462 0.277
NP_442763.1_8 Reverse -91 -110 7.57094 0.159
NP_441659.2_8 Reverse -294 -304 18.1713 0.00133
NP_441659.2_8 Forward -303 -293 11.9764 0.0147
NP_441659.2_8 Forward -39 -29 0.275027 0.27
NP_442913.1_10 Reverse -237 -256 -3.44213 0.21
NP_439956.1_7 Reverse -298 -317 2.26107 0.275
NP_442008.1_2 Forward -373 -354 8.45592 0.2
NP_440442.1_3 Forward -310 -296 14.9459 0.287
NP_440779.1_5 Forward -303 -286 -14.6125 0.254
NP_442346.1_5 Forward -304 -294 16.6963 0.00248
NP_442346.1_5 Reverse -36 -46 10.1081 0.107
NP_442346.1_5 Reverse -293 -303 9.02648 0.118
NP_442346.1_5 Reverse -299 -309 5.97822 0.219
NP_442346.1_5 Forward -335 -325 4.99491 0.267
NP_442346.1_10 Reverse -314 -333 5.30933 0.168
NP_440352.1_5 Forward -138 -119 10.2223 0.278
NP_440352.1_5 Forward -295 -276 9.93029 0.289
NP_440545.1_3 Forward -307 -290 12.6252 0.0199
NP_441856.1_3 Reverse -128 -147 -2.45882 0.261
NP_441629.1_3 Forward -341 -322 -2.45958 0.269
NP_441629.1_3 Forward -46 -27 -4.72118 0.297
NP_440459.1_2 Forward -343 -326 8.49531 0.259
NP_441653.1_2 Forward -314 -295 2.65991 0.289
NP_440010.1_4 Forward -313 -294 15.3382 0.157
NP_442603.1_7 Reverse -294 -308 18.7801 0.0119
NP_441888.1_7 Forward -308 -294 3.8345 0.225
NP_440449.1_6 Forward -335 -317 10.6874 0.149
NP_441948.1_4 Reverse -287 -305 7.59063 0.0623
NP_441833.1_4 Forward -302 -295 15.9687 0.0124
NP_441833.1_4 Reverse -295 -302 15.9687 0.0124
NP_441329.1_1 Reverse -195 -214 5.1084 0.268
NP_441329.1_1 Forward -217 -198 4.34446 0.294
NP_441895.1_10 Reverse -137 -156 -19.2734 0.282
NP_442162.1_9 Forward -302 -295 16.2637 0.0124
NP_442162.1_9 Reverse -295 -302 16.2637 0.0124
NP_442796.1_2 Forward -332 -313 14.3036 0.269
NP_442943.1_1 Reverse -146 -161 2.7228 0.298
NP_440772.1_8 Forward -324 -305 8.45592 0.259
NP_442546.1_2 Forward -93 -74 10.6184 0.115
NP_442199.1_5 Reverse -286 -305 -5.80207 0.254
NP_442140.1_3 Reverse -295 -305 13.5497 0.0542
NP_442140.1_3 Forward -302 -292 8.33817 0.119
NP_440875.1_9 Forward -301 -291 8.37203 0.233
NP_441813.1_5 Reverse -292 -302 17.188 0.00979
NP_441813.1_5 Forward -305 -295 8.73149 0.0367
NP_440590.1_4 Reverse -295 -308 14.2773 0.011
NP_440590.1_4 Forward -302 -289 5.32916 0.0585
NP_440567.1_1 Reverse -295 -309 8.35772 0.0584
NP_440567.1_1 Forward -302 -288 5.89945 0.0945
NP_442497.1_10 Forward -302 -293 10.4228 0.0087
NP_442497.1_10 Reverse -295 -304 10.4228 0.0087
NP_440821.1_4 Reverse -292 -302 19.0562 0.00399
NP_440821.1_4 Forward -305 -295 17.9746 0.00497
NP_441239.1_9 Reverse -292 -304 13.3137 0.037
NP_441239.1_9 Reverse -323 -335 11.4454 0.0607
NP_441239.1_9 Forward -305 -293 9.67541 0.0987
NP_441239.1_9 Reverse -35 -47 7.51213 0.158
NP_441239.1_9 Forward -336 -324 4.36554 0.253
NP_440706.1_1 Forward -307 -288 6.19431 0.0818
NP_441892.1_1 Forward -312 -295 15.3785 0.03
NP_441892.1_1 Forward -343 -326 -1.63279 0.21
NP_442193.1_1 Reverse -325 -343 13.0972 0.221
NP_441508.1_1 Reverse -141 -160 13.9214 0.159
NP_441541.1_1 Forward -158 -140 -2.67179 0.264
NP_440833.1_6 Forward -349 -335 7.57046 0.278
NP_440212.1_9 Reverse -212 -231 6.61611 0.169
NP_440500.1_4 Reverse -172 -191 14.9458 0.202
NP_442052.1_8 Forward -48 -38 14.1397 0.253
NP_440546.1_4 Forward -303 -293 11.8882 0.0679
NP_440546.1_4 Reverse -294 -304 10.046 0.109
NP_440546.1_4 Reverse -325 -335 7.23423 0.252
NP_440462.1_6 Reverse -292 -302 15.418 0.0142
NP_440462.1_6 Forward -305 -295 10.3048 0.0396
NP_440868.1_4 Reverse -290 -302 10.7571 0.0364
NP_440868.1_4 Forward -307 -295 9.97041 0.0405
NP_440270.1_6 Forward -345 -326 15.6341 0.125
NP_441672.1_10 Reverse -22 -41 13.7658 0.244
NP_442402.1_4 Reverse -87 -106 2.85027 0.154
NP_442402.1_4 Forward -186 -167 -0.984623 0.189
NP_442402.1_4 Reverse -253 -272 -5.90115 0.249
NP_442402.1_10 Forward -149 -139 10.206 0.299
NP_441848.1_4 Reverse -136 -152 7.35968 0.29
NP_441848.1_7 Reverse -90 -109 0.490334 0.228
NP_441084.1_6 Forward -336 -322 9.05325 0.295
NP_440696.1_3 Reverse -20 -38 4.05072 0.2
NP_442039.1_4 Forward -302 -295 15.1821 0.0124
NP_442039.1_4 Reverse -295 -302 15.1821 0.0124
NP_441811.1_8 Forward -309 -295 8.35772 0.238
NP_440825.1_6 Forward -101 -82 8.45592 0.285
NP_442696.1_2 Forward -304 -286 10.8356 0.194
NP_442837.1_3 Forward -302 -295 15.7721 0.0124
NP_442837.1_3 Reverse -295 -302 15.7721 0.0124
NP_442053.1_1 Forward -303 -294 18.3876 0.0007
NP_442053.1_1 Reverse -294 -303 18.3876 0.0007
NP_440505.1_3 Forward -305 -295 16.598 0.00683
NP_440505.1_3 Reverse -292 -302 13.8447 0.0247
NP_440505.1_3 Reverse -104 -114 8.82982 0.133
NP_441102.1_1 Forward -302 -283 5.11266 0.256
NP_441102.1_2 Reverse -213 -232 5.99764 0.298
NP_441203.1_1 Forward -45 -26 -20.3551 0.297
NP_442532.1_7 Reverse -294 -308 6.29277 0.171
NP_440914.1_1 Reverse -294 -304 17.5935 0.000537
NP_440914.1_1 Forward -303 -293 8.6151 0.186
NP_441011.1_8 Forward -302 -293 16.9127 0.00602
NP_441011.1_8 Reverse -295 -304 8.25953 0.144
NP_441011.1_8 Forward -139 -130 5.3096 0.271
NP_442533.1_6 Forward -303 -294 17.2076 0.00137
NP_442533.1_6 Reverse -294 -303 17.2076 0.00137
NP_442533.1_6 Forward -334 -325 13.8644 0.0178
NP_442533.1_6 Reverse -325 -334 7.17789 0.0948
NP_442533.1_6 Reverse -30 -39 3.14632 0.224
NP_442541.1_10 Reverse -360 -374 0.883986 0.295
NP_442232.1_3 Forward -311 -292 -14.3569 0.288
NP_442322.1_4 Forward -342 -325 -2.71511 0.235
NP_440854.1_7 Reverse -186 -200 14.143 0.261
NP_442229.1_1 Forward -305 -291 8.94708 0.184
NP_441482.1_7 Forward -309 -295 -0.688726 0.0612
NP_439944.1_9 Reverse -295 -305 19.1546 0.00329
NP_439944.1_9 Forward -302 -292 10.3048 0.0887
NP_441697.1_5 Forward -152 -133 -7.01908 0.239
NP_441697.1_5 Forward -231 -212 -7.68752 0.248
NP_441697.1_5 Reverse -135 -154 -9.1199 0.268
NP_441697.1_5 Reverse -145 -164 -10.6478 0.28
NP_441028.1_6 Reverse -97 -107 13.2542 0.159
NP_441028.1_6 Reverse -263 -273 8.04271 0.217
NP_441028.1_6 Forward -89 -79 4.89613 0.275
NP_439945.1_2 Reverse -140 -157 14.2112 0.237
NP_440115.1_6 Forward -306 -296 17.9746 0.0163
NP_440007.1_9 Reverse -290 -304 0.786239 0.29
NP_441602.1_3 Reverse -31 -50 -0.39387 0.224
NP_441602.1_4 Forward -314 -295 8.35759 0.293
NP_441972.1_5 Reverse -295 -314 -3.93378 0.201
NP_441972.1_5 Reverse -326 -345 -7.27704 0.247
NP_441106.1_1 Reverse -293 -302 18.191 0.0028
NP_441106.1_1 Forward -304 -295 9.63616 0.0311
NP_441106.1_1 Forward -335 -326 2.75299 0.261
NP_441106.1_3 Reverse -137 -156 11.6025 0.217
NP_439903.1_6 Reverse -291 -310 2.26028 0.231
NP_441286.1_1 Forward -304 -292 14.4936 0.00418
NP_441286.1_1 Reverse -293 -305 12.1337 0.0104
NP_442674.1_3 Forward -311 -292 9.63507 0.174
NP_440670.1_8 Forward -303 -294 18.3876 0.000699
NP_440670.1_8 Reverse -294 -303 18.3876 0.000699
NP_440886.1_7 Reverse -293 -303 17.7774 0.0011
NP_440886.1_7 Forward -304 -294 7.94438 0.0805
NP_442614.1_2 Forward -327 -313 11.2093 0.206
NP_442614.1_2 Forward -303 -289 7.17775 0.275
NP_442614.1_2 Forward -271 -257 5.80112 0.297
NP_439995.1_5 Reverse -284 -303 11.5042 0.189
NP_442072.1_9 Reverse -293 -311 -23.187 0.284
NP_442072.1_9 Reverse -317 -335 -23.3836 0.292
NP_440513.1_4 Reverse -294 -313 13.6675 0.19
NP_439899.1_1 Reverse -137 -155 13.7263 0.149
NP_440907.2_8 Reverse -295 -305 10.8943 0.0969
NP_440907.2_8 Forward -302 -292 7.84605 0.117
NP_441021.1_8 Forward -308 -290 3.26407 0.23
NP_441463.1_3 Reverse -284 -303 -8.06369 0.264
NP_441463.1_6 Reverse -292 -306 8.92841 0.25
NP_441626.1_2 Forward -302 -295 15.7721 0.0124
NP_441626.1_2 Reverse -295 -302 15.7721 0.0124
NP_442365.1_7 Reverse -290 -309 -0.983855 0.189
NP_440107.1_5 Reverse -293 -312 5.89931 0.139
NP_442794.1_1 Forward -307 -295 3.48056 0.286
NP_442615.1_1 Reverse -285 -303 12.4089 0.0137
NP_441962.1_4 Forward -308 -289 3.6377 0.102
NP_441962.1_9 Reverse -240 -259 6.29264 0.258
NP_440387.1_1 Reverse -294 -310 13.9232 0.00763
NP_440387.1_1 Forward -303 -287 -3.28472 0.157
NP_441431.1_2 Forward -49 -35 12.3887 0.12
NP_441431.1_2 Reverse -291 -305 5.70218 0.291
NP_442020.1_1 Reverse -144 -163 -0.0996487 0.267
NP_441836.1_2 Reverse -288 -307 0.884433 0.197
NP_441993.1_1 Reverse -294 -313 6.13735 0.186
NP_441993.1_1 Forward -255 -236 1.36194 0.28
NP_440114.1_10 Forward -303 -289 13.5693 0.0531
NP_441425.1_4 Forward -287 -273 17.2075 0.282
NP_442698.1_10 Forward -245 -226 1.57275 0.297
NP_442698.1_10 Forward -279 -260 1.17943 0.297
NP_442698.1_10 Forward -307 -288 -0.885524 0.297
NP_442698.1_10 Forward -246 -227 -0.885524 0.297
NP_441552.1_3 Forward -310 -291 14.5516 0.235
NP_440766.1_4 Forward -307 -293 17.4042 0.0256
NP_441237.1_9 Reverse -295 -305 14.9263 0.0242
NP_441237.1_9 Forward -45 -35 13.648 0.0742
NP_442930.1_1 Forward -153 -143 12.4676 0.239
NP_439910.1_2 Reverse -286 -303 -11.9575 0.0788
NP_442867.1_8 Reverse -235 -254 5.01433 0.277
NP_440457.1_1 Forward -307 -295 7.21714 0.105
NP_440457.1_1 Reverse -290 -302 -0.0593532 0.25
NP_440457.1_1 Forward -374 -362 -0.846001 0.278
NP_440457.1_1 Reverse -26 -38 -0.944332 0.285
NP_442680.1_5 Reverse -77 -96 -0.318533 0.281
NP_441332.1_6 Reverse -267 -277 16.9714 0.0994
NP_442509.1_9 Forward -303 -293 16.2041 0.00739
NP_442509.1_9 Reverse -294 -304 8.14104 0.192
NP_442582.1_3 Forward -160 -146 13.667 0.258
NP_440554.1_4 Forward -302 -292 14.6313 0.02
NP_440554.1_4 Reverse -295 -305 6.37155 0.123
NP_441845.1_6 Reverse -282 -300 1.69077 0.274
NP_441885.1_5 Reverse -294 -304 20.9245 0.000538
NP_441885.1_5 Forward -303 -293 11.4848 0.00668
NP_442341.1_7 Reverse -293 -307 19.9608 0.00702
NP_442341.1_7 Forward -304 -290 16.0275 0.0189
NP_442341.1_9 Reverse -292 -306 4.52221 0.299
NP_441173.1_9 Reverse -344 -352 12.9004 0.206
NP_441173.1_9 Forward -88 -80 12.1137 0.21
NP_441173.1_9 Forward -156 -148 10.6388 0.261
NP_441173.1_9 Reverse -345 -353 9.75379 0.284
NP_443000.1_7 Forward -305 -295 10.4031 0.0345
NP_443000.1_7 Reverse -292 -302 8.73149 0.0437
NP_440507.2_3 Forward -312 -293 7.37347 0.281
NP_440552.1_8 Forward -165 -148 20.1054 0.0201
NP_442513.1_5 Forward -311 -292 6.09517 0.282
NP_441842.1_10 Reverse -287 -301 8.94771 0.203
NP_441842.1_10 Forward -310 -296 7.07942 0.267
NP_440275.1_3 Forward -305 -295 17.6796 0.0102
NP_440275.1_3 Reverse -292 -302 8.4365 0.0602
NP_440091.1_1 Reverse -290 -302 10.7571 0.0429
NP_440091.1_1 Forward -307 -295 8.29878 0.0653
NP_441397.1_8 Forward -105 -92 14.4811 0.192
NP_441397.1_8 Forward -239 -226 12.8577 0.255
NP_443010.1_10 Reverse -291 -308 12.2409 0.0924
NP_443010.1_10 Forward -306 -289 7.40921 0.172
NP_442451.1_2 Forward -311 -292 -8.16202 0.241
NP_442686.1_5 Reverse -355 -374 16.5191 0.241
NP_440258.1_8 Reverse -181 -200 13.2733 0.261
NP_439962.1_4 Forward -256 -237 -1.47551 0.215
NP_440149.1_8 Reverse -294 -313 2.94938 0.103
NP_440149.1_8 Forward -303 -284 -7.17871 0.275
NP_440149.1_8 Reverse -20 -39 -7.4737 0.285
NP_441105.1_3 Forward -314 -295 -2.85214 0.169
NP_440216.1_1 Forward -303 -289 -1.47537 0.0328
NP_440216.1_1 Reverse -294 -308 -9.44018 0.145
NP_440216.1_9 Forward -383 -374 9.24284 0.286
NP_440172.1_1 Reverse -294 -304 15.0247 0.00945
NP_440172.1_1 Forward -303 -293 8.73149 0.0586
NP_440172.1_1 Reverse -37 -47 2.7333 0.268
NP_440167.1_3 Forward -313 -294 12.8808 0.196
NP_442015.1_10 Forward -307 -294 12.6056 0.0365
NP_442015.1_10 Reverse -290 -303 0.805932 0.218
NP_441226.1_7 Forward -302 -295 14.4934 0.0123
NP_441226.1_7 Reverse -295 -302 14.4934 0.0123
NP_441226.1_7 Reverse -269 -276 5.64364 0.286
NP_440305.1_1 Forward -200 -186 13.094 0.283
NP_441111.1_7 Forward -302 -294 18.7023 0.00294
NP_441111.1_7 Reverse -295 -303 18.7023 0.00294
NP_441766.1_2 Forward -303 -294 17.5026 0.00297
NP_441766.1_2 Reverse -294 -303 17.5026 0.00297
NP_440416.1_9 Forward -40 -21 -9.63698 0.133
NP_440416.1_9 Reverse -287 -306 -12.5869 0.159
NP_440416.1_9 Reverse -323 -342 -18.1918 0.253
NP_440416.1_9 Reverse -314 -333 -19.6667 0.276
NP_440072.1_5 Forward -378 -360 -1.65248 0.259
NP_442116.1_6 Reverse -194 -211 9.31486 0.231
NP_442116.1_6 Forward -162 -145 6.25912 0.283
NP_440261.1_5 Reverse -295 -308 -2.63565 0.0924
NP_440261.1_5 Forward -302 -289 -2.93064 0.0983
NP_440261.1_5 Forward -139 -126 -4.9956 0.183
NP_440988.1_10 Reverse -292 -306 10.1267 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAGAATTTTGTTCCTGGGCAATGAAAGGAGGGGTAAGGGCCGCCTGACTGGGTAAAACTCCCCCTAGGCCAGGGCCGAAAGTGCAGAAACCAACGGTGGCGATCGCCGTTAAGAAAGGAAAAATGGGACGGGGGAAACAAATCATGGCAGGCAACACTGGGCGGGGAAGAAAAAATGCCTTCTTTATTTAATGATGGTTTAAAGAATGAAATTAATCCCGCTTTTTATTAACAACGTAAGGATTTTTAACAAATTTTCACAGTTATCGGCCGCAGTAAAAAAATAACCGACTCCCGGGGGACAAAATTGGCTTTTTGCCCAGTCGTGCTATGTTGTGTTGTTGTCTGAAAACTGAGCCATTGCGCACCGCCATCCATCACATAGTTAATAGTTTAATTGT

CDS

ATGATTGCCCATCGCCGTCAGGAGTTAGCCCAGCAATATTACCAGGCTTTACACCAGGACGTATTGCCCTTTTGGGAAAAATATTCCCTCGATCGCCAGGGGGGCGGTTACTTTACCTGCTTAGACCGTAAAGGCCAGGTTTTTGACACAGATAAATTCATTTGGTTACAAAACCGTCAGGTATGGCAGTTTGCCGTTTTCTACAACCGTTTGGAACCAAAACCCCAATGGTTAGAAATTGCCCGCCATGGTGCTGATTTTTTAGCTCGCCACGGCCGAGATCAAGACGGTAATTGGTATTTTGCTTTGGATCAGGAAGGCAAACCCCTGCGTCAACCCTATAACGTTTTTTCCGATTGCTTCGCCGCCATGGCCTTTAGTCAATATGCCTTAGCCAGTGGGGCGCAGGAAGCTAAAGCCATTGCCCTGCAGGCCTACAATAACGTCCTACGCCGTCAGCACAATCCCAAAGGTCAATACGAGAAGTCCTATCCAGGTACTAGACCCCTCAAATCCCTGGCGGTGCCGATGATTTTAGCCAACCTCACCCTGGAGATGGAATGGTTATTACCGCCTACTACCGTGGAAGAGGTGTTGGCCCAAACCGTCAGAGAAGTGATGACGGATTTCCTCGACCCAGAAATAGGATTAATGCGGGAAGCGGTGACCCCCACAGGAGAATTTGTTGATAGTTTTGAAGGGCGGTTGCTCAACCCAGGACACGGCATTGAAGCCATGTGGTTCATGATGGACATTGCCCAACGCTCCGGCGATCGCCAGTTACAGGAGCAAGCCATTGCAGTGGTGTTGAACACCCTGGAATATGCCTGGGATGAAGAATTTGGTGGCATATTTTATTTCCTTGATCGCCAGGGCCACCCTCCCCAACAACTGGAATGGGACCAAAAGCTCTGGTGGGTACATTTGGAAACCCTGGTTGCCCTAGCCAAGGGCCACCAAGCCACTGGCCAAGAAAAATGTTGGCAATGGTTTGAGCGGGTCCATGATTACGCCTGGAGTCATTTCGCCGATCCTGAGTATGGGGAATGGTTTGGCTACCTGAATCGCCGGGGAGAGGTGTTACTCAACCTAAAAGGGGGGAAATGGAAAGGGTGCTTCCACGTGCCCCGAGCTCTGTGGCTCTGTGCGGAAACTCTCCAACTTCCGGTTAGTTAA

Protein

MIAHRRQELAQQYYQALHQDVLPFWEKYSLDRQGGGYFTCLDRKGQVFDTDKFIWLQNRQVWQFAVFYNRLEPKPQWLEIARHGADFLARHGRDQDGNWYFALDQEGKPLRQPYNVFSDCFAAMAFSQYALASGAQEAKAIALQAYNNVLRRQHNPKGQYEKSYPGTRPLKSLAVPMILANLTLEMEWLLPPTTVEEVLAQTVREVMTDFLDPEIGLMREAVTPTGEFVDSFEGRLLNPGHGIEAMWFMMDIAQRSGDRQLQEQAIAVVLNTLEYAWDEEFGGIFYFLDRQGHPPQQLEWDQKLWWVHLETLVALAKGHQATGQEKCWQWFERVHDYAWSHFADPEYGEWFGYLNRRGEVLLNLKGGKWKGCFHVPRALWLCAETLQLPVS