Your browser is old and dusty. Try Google Chrome!

Details for slr1966

ORF slr1966
Accession NP_441511.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -171 -185 0.88457 0.197
NP_441061.1_2 Forward -54 -40 0.786239 0.199
NP_440795.1_7 Forward -393 -386 6.92228 0.26
NP_441418.1_6 Reverse -319 -338 -9.83364 0.0294
NP_441418.1_6 Reverse -313 -332 -10.4236 0.035
NP_441418.1_6 Reverse -310 -329 -20.4534 0.114
NP_441418.1_6 Reverse -316 -335 -28.8115 0.211
NP_441453.1_4 Reverse -46 -54 4.34598 0.257
NP_441623.1_1 Reverse -176 -194 -3.91409 0.273
NP_442655.1_10 Reverse -322 -341 -11.0136 0.23
NP_442655.1_10 Reverse -319 -338 -11.8986 0.261
NP_443027.1_4 Reverse -44 -54 8.04317 0.219
NP_443027.1_4 Forward -286 -276 6.76487 0.269
NP_441745.1_3 Forward -29 -10 14.8466 0.227
NP_442975.1_10 Forward -183 -169 5.60385 0.216
NP_441675.1_4 Forward -204 -185 6.39097 0.236
NP_441093.1_9 Forward -32 -13 16.0274 0.213
NP_440061.1_9 Forward -339 -325 9.6354 0.143
NP_440061.1_9 Forward -19 -5 8.94708 0.157
NP_440110.1_8 Forward -105 -86 -2.85214 0.282
NP_441054.1_6 Reverse -323 -342 13.7658 0.257
NP_441476.1_5 Reverse -374 -393 -3.63879 0.239
NP_439979.1_7 Reverse -166 -183 13.9035 0.267
NP_442062.1_3 Reverse -123 -142 1.17943 0.23
NP_442062.1_3 Forward -150 -131 -1.7705 0.264
NP_442062.1_8 Reverse -46 -56 3.71661 0.256
NP_441900.1_2 Forward -341 -323 11.1298 0.114
NP_442972.1_1 Forward -222 -204 12.1912 0.254
NP_442972.1_2 Forward -279 -265 15.2402 0.136
NP_440304.1_4 Reverse -21 -31 11.8781 0.051
NP_440044.1_8 Forward -393 -374 -0.787193 0.228
NP_441660.1_9 Reverse -320 -339 11.4058 0.218
NP_440011.1_1 Forward -265 -246 12.2908 0.264
NP_440916.1_1 Reverse -79 -93 8.45605 0.267
NP_439918.1_2 Reverse -313 -332 1.0811 0.217
NP_441352.1_2 Forward -186 -167 6.68596 0.186
NP_441365.1_5 Forward -226 -207 9.53756 0.00411
NP_442110.1_7 Forward -28 -14 4.62115 0.197
NP_442726.1_1 Forward -327 -308 7.66927 0.288
NP_441925.1_4 Forward -341 -322 -14.9476 0.263
NP_440856.1_7 Reverse -313 -332 -3.24547 0.198
NP_441738.1_2 Forward -366 -359 8.29857 0.176
NP_441558.1_5 Reverse -44 -63 13.4708 0.0578
NP_442889.1_8 Forward -58 -44 6.0955 0.203
NP_442889.1_8 Reverse -37 -51 4.12889 0.27
NP_442889.1_10 Forward -219 -200 10.6234 0.274
NP_442398.1_4 Reverse -181 -200 6.58682 0.274
NP_441713.1_5 Reverse -277 -296 12.9791 0.211
NP_440178.1_7 Forward -112 -93 -22.125 0.255
NP_442111.1_1 Forward -63 -44 12.585 0.29
NP_441163.1_1 Reverse -306 -323 5.74131 0.27
NP_441163.1_1 Reverse -333 -350 4.65968 0.286
NP_440747.1_10 Forward -52 -40 -12.1541 0.227
NP_441486.1_1 Forward -58 -44 -1.96703 0.175
NP_441486.1_1 Forward -182 -168 -5.9986 0.272
NP_440842.1_6 Forward -339 -320 11.405 0.261
NP_441014.1_8 Reverse -10 -29 -8.94866 0.288
NP_441014.1_8 Forward -336 -317 -9.63698 0.299
NP_441012.1_4 Forward -326 -313 8.18076 0.272
NP_441012.1_4 Reverse -104 -117 6.01747 0.286
NP_443018.1_3 Forward -54 -47 12.5271 0.0523
NP_443018.1_3 Reverse -47 -54 12.5271 0.0523
NP_443018.1_3 Reverse -281 -288 8.49558 0.141
NP_441634.1_8 Forward -324 -310 -0.295402 0.252
NP_441857.1_3 Reverse -107 -126 17.7965 0.141
NP_441077.1_6 Forward -221 -205 12.8282 0.136
NP_442485.1_2 Reverse -6 -25 11.7992 0.288
NP_442485.1_3 Forward -339 -320 1.27776 0.23
NP_441846.1_10 Reverse -313 -332 -20.2567 0.256
NP_441846.1_10 Reverse -7 -26 -23.2067 0.279
NP_440642.1_10 Reverse -216 -230 7.96378 0.215
NP_441511.1_4 Forward -368 -349 20.053 0.187
NP_442658.1_1 Forward -291 -281 5.78111 0.25
NP_440141.1_4 Reverse -316 -335 -10.227 0.298
NP_442782.1_2 Reverse -314 -328 5.01447 0.249
NP_442496.1_5 Forward -201 -183 7.29564 0.256
NP_440607.1_5 Reverse -316 -335 3.83436 0.226
NP_441256.1_1 Forward -331 -312 4.81767 0.115
NP_442937.1_5 Reverse -320 -339 13.1758 0.095
NP_440651.1_1 Forward -191 -172 6.98095 0.282
NP_440203.1_5 Reverse -84 -94 12.3692 0.154
NP_440203.1_5 Forward -365 -355 8.63269 0.29
NP_440984.1_7 Forward -22 -8 8.65272 0.139
NP_439990.1_5 Reverse -275 -288 6.80412 0.221
NP_441338.2_5 Forward -397 -378 8.75091 0.247
NP_442690.1_1 Forward -165 -146 -4.13045 0.145
NP_442690.1_1 Forward -149 -130 -10.817 0.22
NP_442690.1_1 Forward -139 -120 -16.6185 0.29
NP_442536.1_7 Forward -185 -166 7.17762 0.273
NP_442536.1_8 Reverse -316 -335 16.6174 0.138
NP_440200.1_7 Forward -205 -186 9.00218 0.204
NP_440475.1_2 Forward -161 -142 21.416 0.0464
NP_441294.1_7 Forward -338 -324 10.0185 0.213
NP_441000.1_5 Reverse -372 -391 9.83173 0.214
NP_442771.1_1 Reverse -38 -56 -10.4039 0.258
NP_441550.1_8 Reverse -6 -16 5.97777 0.22
NP_441916.1_2 Forward -297 -278 24.8422 0.00295
NP_440206.1_4 Reverse -315 -334 5.80018 0.242
NP_440465.1_10 Reverse -325 -344 2.3594 0.268
NP_441041.1_4 Reverse -313 -332 -8.85033 0.208
NP_440569.1_6 Reverse -310 -329 4.62101 0.24
NP_441369.1_2 Forward -231 -212 -9.24366 0.225
NP_441547.1_2 Forward -60 -42 5.32902 0.223
NP_442941.1_3 Reverse -171 -181 -0.609952 0.264
NP_440983.1_5 Forward -340 -321 2.26107 0.199
NP_440983.1_5 Forward -334 -315 1.17943 0.214
NP_441678.1_9 Reverse -313 -332 1.57275 0.223
NP_442281.1_1 Reverse -41 -55 2.06395 0.278
NP_442281.1_1 Forward -327 -313 1.96562 0.282
NP_441566.1_3 Forward -205 -186 20.649 0.0877
NP_441860.1_4 Forward -227 -214 17.2272 0.281
NP_440867.1_10 Forward -26 -7 5.40766 0.271
NP_442215.1_2 Reverse -168 -184 -1.41643 0.185
NP_442215.1_2 Reverse -37 -53 -7.11963 0.286
NP_442029.1_1 Reverse -323 -342 -1.08219 0.156
NP_440929.1_8 Forward -17 -8 3.63797 0.214
NP_442933.1_2 Forward -227 -209 6.59093 0.269
NP_442926.1_3 Forward -300 -281 5.11266 0.244
NP_442554.1_8 Reverse -47 -57 7.74818 0.0846
NP_442554.1_8 Forward -54 -44 4.10993 0.198
NP_442554.1_8 Reverse -9 -19 1.84832 0.292
NP_441762.1_7 Forward -180 -168 -7.33585 0.287
NP_442313.1_5 Forward -327 -308 9.43923 0.191
NP_442142.1_4 Forward -331 -318 10.0485 0.0806
NP_442142.1_4 Forward -334 -321 6.0169 0.175
NP_441024.1_7 Reverse -63 -81 10.0481 0.275
NP_442406.1_3 Reverse -124 -143 18.5853 0.0533
NP_442301.1_2 Forward -332 -313 6.39016 0.263
NP_442301.1_2 Forward -341 -322 5.89851 0.263
NP_442301.1_2 Forward -338 -319 5.60352 0.263
NP_441715.1_4 Reverse -171 -181 7.05986 0.118
NP_440357.1_3 Reverse -6 -25 3.44104 0.242
NP_440379.1_5 Reverse -310 -329 -7.96535 0.25
NP_441468.1_1 Reverse -47 -54 3.97235 0.277
NP_441468.1_1 Forward -54 -47 3.97235 0.277
NP_441020.2_6 Reverse -311 -328 6.82368 0.251
NP_441015.1_10 Reverse -320 -339 6.29264 0.109
NP_441015.1_10 Reverse -323 -342 5.80098 0.112
NP_441015.1_10 Reverse -314 -333 -11.1119 0.291
NP_441673.1_1 Forward -32 -23 -8.06341 0.254
NP_441826.1_2 Forward -185 -171 8.75105 0.0691
NP_441826.1_2 Reverse -17 -31 -3.34366 0.284
NP_441251.1_8 Reverse -118 -131 13.4306 0.254
NP_442361.1_8 Forward -339 -321 17.0304 0.282
NP_442427.1_3 Forward -373 -355 0.117479 0.275
NP_441911.1_10 Forward -227 -208 9.81228 0.227
NP_442808.1_1 Reverse -312 -322 2.83119 0.254
NP_442630.1_3 Forward -209 -190 20.944 0.0134
NP_442542.1_2 Reverse -38 -51 6.21414 0.232
NP_442542.1_9 Reverse -153 -167 5.50552 0.261
NP_442342.1_7 Reverse -227 -246 16.6603 0.224
NP_440334.1_2 Forward -73 -60 15.6539 0.203
NP_440558.1_2 Reverse -14 -33 5.40766 0.145
NP_440558.1_2 Reverse -99 -118 -5.50708 0.26
NP_442789.1_4 Forward -393 -374 -4.03212 0.258
NP_442792.1_5 Reverse -314 -331 8.00365 0.296
NP_441878.1_6 Reverse -22 -32 1.455 0.0979
NP_441878.1_6 Reverse -39 -49 -6.90313 0.198
NP_441036.1_7 Forward -199 -189 16.7941 0.0578
NP_441036.1_8 Forward -170 -160 11.5831 0.114
NP_441445.1_1 Reverse -319 -338 2.55606 0.233
NP_441574.1_1 Forward -301 -282 -5.40875 0.26
NP_441549.1_9 Forward -36 -18 -7.45401 0.207
NP_441411.1_10 Reverse -381 -400 18.2882 0.107
NP_442888.1_6 Forward -66 -47 4.42435 0.228
NP_442594.1_8 Reverse -323 -342 1.57275 0.299
NP_441633.1_3 Reverse -168 -181 0.707601 0.117
NP_442590.1_9 Forward -395 -376 4.03102 0.277
NP_442998.1_10 Reverse -42 -49 10.4622 0.0819
NP_440731.1_2 Reverse -313 -332 3.44104 0.295
NP_440299.1_1 Reverse -169 -182 8.77016 0.0851
NP_440299.1_1 Forward -53 -40 6.31189 0.146
NP_440299.1_1 Reverse -166 -179 6.11523 0.152
NP_441799.1_6 Reverse -317 -336 19.5673 0.0984
NP_440640.1_6 Reverse -313 -332 7.27595 0.174
NP_441007.1_10 Reverse -323 -336 -0.275709 0.273
NP_442334.1_2 Reverse -331 -348 -14.4158 0.3
NP_441435.1_4 Forward -299 -280 17.994 0.153
NP_441559.1_8 Forward -327 -313 -4.03198 0.215
NP_441559.1_8 Forward -174 -160 -7.76856 0.299
NP_441270.1_5 Forward -103 -84 12.6039 0.236
NP_442860.1_3 Reverse -168 -187 8.94757 0.258
NP_441179.1_9 Forward -330 -320 9.22267 0.28
NP_442386.1_9 Reverse -45 -54 11.3073 0.0971
NP_442386.1_9 Forward -56 -47 10.914 0.111
NP_442386.1_9 Forward -118 -109 8.75075 0.184
NP_442386.1_9 Reverse -312 -321 8.55409 0.193
NP_440570.1_5 Reverse -315 -334 -1.86883 0.277
NP_442054.1_2 Forward -28 -9 -3.73712 0.254
NP_441750.1_1 Reverse -319 -338 6.78429 0.0983
NP_441340.1_5 Reverse -47 -54 4.07068 0.239
NP_441340.1_5 Forward -54 -47 4.07068 0.239
NP_441340.1_9 Forward -70 -60 9.02648 0.256
NP_441340.1_9 Forward -223 -213 8.25522 0.256
NP_441271.1_8 Forward -24 -14 14.4347 0.266
NP_441947.1_10 Forward -330 -312 1.59244 0.276
NP_440639.1_1 Reverse -126 -145 11.8967 0.141
NP_440168.1_2 Forward -336 -317 -4.72043 0.291
NP_440146.1_2 Forward -295 -281 11.406 0.3
NP_442240.1_1 Reverse -233 -252 3.04693 0.295
NP_442714.1_5 Forward -226 -207 3.44104 0.238
NP_441160.1_6 Forward -330 -311 1.86774 0.282
NP_440586.1_8 Forward -54 -47 7.61025 0.227
NP_440586.1_8 Reverse -47 -54 7.61025 0.227
NP_440684.1_9 Forward -185 -171 16.3225 0.072
NP_440027.1_3 Forward -337 -319 3.75497 0.267
NP_443051.1_5 Forward -76 -57 13.1758 0.195
NP_443051.1_5 Reverse -351 -370 9.3409 0.235
NP_439996.1_6 Forward -27 -8 10.8286 0.208
NP_439937.1_8 Reverse -320 -339 -4.42544 0.284
NP_440408.1_3 Forward -185 -166 -0.197208 0.22
NP_440408.1_7 Reverse -8 -27 10.0292 0.253
NP_440408.1_7 Forward -257 -238 8.84924 0.267
NP_441789.1_7 Forward -332 -313 -2.55791 0.257
NP_440316.1_10 Reverse -318 -328 6.76487 0.253
NP_439977.1_8 Forward -147 -128 18.0934 0.178
NP_441877.1_7 Forward -184 -165 3.04693 0.218
NP_441877.1_9 Forward -142 -125 13.0185 0.127
NP_442262.1_10 Forward -54 -47 10.4622 0.145
NP_442262.1_10 Reverse -47 -54 10.4622 0.145
NP_442262.1_10 Reverse -281 -288 8.59391 0.22
NP_440163.1_10 Reverse -316 -326 8.92815 0.256
NP_440163.1_10 Reverse -43 -53 8.73149 0.262
NP_440344.1_10 Forward -186 -169 -9.40093 0.146
NP_440344.1_10 Reverse -306 -323 -13.7275 0.293
NP_440282.1_10 Forward -332 -313 -8.06369 0.259
NP_441965.1_10 Reverse -289 -305 4.3851 0.242
NP_440297.1_9 Forward -54 -44 0.766681 0.282
NP_440297.1_9 Reverse -47 -57 0.176696 0.282
NP_442454.1_2 Forward -151 -132 9.7875 0.291
NP_442147.1_7 Reverse -329 -348 10.3242 0.244
NP_442147.1_7 Reverse -323 -342 10.2259 0.249
NP_442077.1_5 Reverse -50 -69 5.99764 0.0853
NP_441543.1_2 Reverse -171 -180 5.89959 0.169
NP_442845.1_2 Reverse -40 -54 14.6509 0.0775
NP_440380.1_1 Forward -185 -166 -9.24366 0.261
NP_441304.1_10 Reverse -357 -366 13.4711 0.241
NP_441551.1_5 Forward -21 -5 8.61263 0.237
NP_441469.1_8 Forward -56 -47 14.0611 0.0612
NP_442315.1_1 Reverse -317 -335 4.9357 0.256
NP_442337.1_6 Reverse -318 -337 13.0559 0.263
NP_442337.1_8 Forward -122 -103 0.196116 0.255
NP_442578.1_5 Reverse -379 -398 5.211 0.257
NP_443062.1_6 Forward -190 -171 4.22769 0.221
NP_440277.1_4 Forward -396 -377 18.879 0.0914
NP_442204.1_1 Forward -173 -162 7.1385 0.14
NP_442204.1_6 Reverse -319 -338 15.2408 0.1
NP_442487.1_1 Forward -369 -350 25.2696 0.00772
NP_442487.1_2 Forward -342 -323 32.3494 0.0000491
NP_442487.1_2 Forward -345 -326 4.71854 0.232
NP_442487.1_2 Forward -339 -320 2.6536 0.232
NP_442487.1_3 Forward -294 -275 17.3057 0.19
NP_442487.1_4 Forward -390 -371 29.7937 0.000548
NP_442872.1_1 Forward -339 -320 -9.73531 0.241
NP_442428.1_5 Forward -54 -47 4.36568 0.271
NP_442428.1_5 Reverse -47 -54 4.36568 0.271
NP_442428.1_5 Forward -178 -171 3.67736 0.298
NP_441443.1_7 Reverse -316 -335 11.2092 0.0937
NP_441443.1_7 Reverse -310 -329 -0.0988766 0.245
NP_442120.1_10 Forward -67 -48 -1.67217 0.171
NP_441884.1_9 Reverse -5 -24 -13.6686 0.138
NP_441884.1_9 Reverse -20 -39 -15.0452 0.138
NP_442902.1_7 Forward -27 -8 13.9625 0.24
NP_441321.1_5 Forward -271 -252 2.75272 0.285
NP_440222.1_6 Reverse -112 -125 12.6056 0.283
NP_441004.1_1 Reverse -319 -338 -3.14714 0.154
NP_441004.1_1 Reverse -322 -341 -15.6352 0.276
NP_442366.1_3 Reverse -169 -187 7.98396 0.0698
NP_442873.1_5 Forward -335 -316 10.9134 0.246
NP_442694.1_9 Reverse -69 -88 13.9625 0.188
NP_440328.1_4 Reverse -154 -173 1.17943 0.232
NP_443054.1_2 Forward -324 -310 2.2612 0.245
NP_440864.1_3 Reverse -85 -104 6.88262 0.297
NP_441851.1_10 Forward -118 -108 10.3048 0.0962
NP_441851.1_10 Forward -56 -46 4.3066 0.277
NP_442026.1_3 Forward -232 -213 3.04771 0.192
NP_442622.1_3 Forward -378 -359 5.01433 0.215
NP_441501.1_9 Forward -330 -311 14.7483 0.253
NP_442856.1_7 Reverse -319 -338 -6.49039 0.298
NP_442515.1_1 Forward -50 -36 1.47456 0.158
NP_440593.1_3 Forward -22 -3 -4.72043 0.251
NP_440165.1_5 Reverse -358 -377 0.687771 0.143
NP_442689.1_8 Forward -161 -144 -7.72931 0.292
NP_441349.1_10 Forward -179 -160 -7.96535 0.262
NP_441661.1_3 Forward -93 -76 10.7569 0.131
NP_441409.1_6 Forward -175 -156 -12.0953 0.225
NP_442843.1_1 Reverse -47 -66 -8.06369 0.253
NP_442843.1_1 Forward -393 -374 -11.2103 0.286
NP_440474.1_8 Forward -288 -274 13.4703 0.0696
NP_441031.1_1 Reverse -119 -138 13.4748 0.125
NP_441031.1_1 Reverse -129 -148 4.21976 0.292
NP_442006.1_2 Reverse -319 -336 -3.00942 0.132
NP_442006.1_2 Reverse -313 -330 -5.46769 0.143
NP_441003.1_9 Forward -331 -312 3.24438 0.295
NP_441078.1_4 Reverse -40 -49 5.80125 0.104
NP_441078.1_4 Forward -49 -40 5.70292 0.111
NP_440707.1_9 Reverse -320 -339 1.47442 0.292
NP_442443.1_1 Reverse -320 -339 -4.13045 0.268
NP_440793.1_1 Reverse -181 -195 10.0287 0.293
NP_442320.1_2 Forward -120 -101 13.9625 0.26
NP_442320.1_8 Reverse -286 -300 -3.44199 0.122
NP_442320.1_8 Forward -185 -171 -5.9986 0.261
NP_441732.1_2 Reverse -19 -35 -16.4611 0.167
NP_441732.1_2 Forward -341 -325 -17.4444 0.258
NP_442447.1_1 Forward -75 -56 4.03102 0.281
NP_440461.1_3 Reverse -324 -343 18.879 0.12
NP_440461.1_3 Reverse -327 -346 14.0608 0.297
NP_442353.1_4 Forward -343 -324 0.0970122 0.281
NP_442400.1_10 Reverse -128 -141 7.22367 0.292
NP_442489.1_7 Reverse -23 -32 -1.77023 0.247
NP_440565.1_3 Reverse -224 -243 16.5473 0.218
NP_442913.1_10 Forward -263 -244 -3.3438 0.207
NP_442776.1_2 Forward -182 -163 10.2259 0.258
NP_442346.1_5 Reverse -45 -55 11.2881 0.0706
NP_440352.1_5 Forward -205 -186 11.3903 0.261
NP_440545.1_3 Forward -21 -4 -6.746 0.287
NP_441856.1_7 Reverse -319 -338 15.2408 0.192
NP_440831.1_3 Reverse -322 -341 8.81407 0.221
NP_440831.1_3 Reverse -319 -338 7.35791 0.256
NP_440831.1_3 Forward -26 -7 5.7076 0.28
NP_441923.1_6 Reverse -320 -334 15.8309 0.168
NP_440459.1_2 Forward -64 -47 8.00365 0.272
NP_440010.1_4 Reverse -318 -337 -3.44288 0.299
NP_441233.1_9 Forward -335 -316 14.6508 0.217
NP_441888.1_9 Reverse -292 -311 16.6052 0.26
NP_441047.1_1 Forward -25 -6 1.96607 0.229
NP_441329.1_3 Reverse -71 -81 15.3887 0.25
NP_440671.1_1 Forward -142 -123 4.12128 0.276
NP_440671.1_4 Forward -185 -171 14.6509 0.0573
NP_442943.1_1 Reverse -146 -161 14.2073 0.0926
NP_442045.1_5 Reverse -376 -395 7.7676 0.197
NP_442199.1_5 Reverse -284 -303 4.52268 0.106
NP_442140.1_1 Forward -346 -327 12.9468 0.275
NP_442140.1_3 Reverse -47 -57 12.3697 0.0632
NP_442914.1_9 Reverse -12 -31 13.4708 0.227
NP_440594.1_6 Forward -343 -324 5.50519 0.285
NP_442497.1_2 Reverse -351 -370 15.3391 0.206
NP_440821.1_4 Forward -181 -171 -0.0199663 0.217
NP_440227.1_10 Reverse -103 -122 12.29 0.212
NP_441239.1_9 Forward -57 -45 8.29878 0.137
NP_441239.1_9 Forward -19 -7 7.90546 0.147
NP_441239.1_9 Reverse -311 -323 5.44718 0.221
NP_441239.1_9 Reverse -290 -302 3.57889 0.283
NP_441239.1_9 Forward -325 -313 2.98891 0.3
NP_440624.1_5 Forward -135 -117 6.3177 0.298
NP_440665.1_1 Forward -334 -315 -14.1602 0.261
NP_442193.1_1 Reverse -313 -331 21.4553 0.0555
NP_441017.1_6 Reverse -42 -56 14.0603 0.157
NP_442629.1_3 Reverse -276 -295 5.70265 0.272
NP_440833.1_6 Forward -155 -141 8.25877 0.277
NP_442216.1_4 Forward -367 -359 8.1805 0.255
NP_442138.1_1 Forward -330 -311 1.47364 0.26
NP_440546.1_6 Forward -121 -102 7.37428 0.273
NP_440462.1_4 Reverse -321 -335 7.07942 0.278
NP_442340.1_3 Reverse -282 -301 -8.65367 0.254
NP_441582.1_5 Reverse -181 -200 3.14526 0.275
NP_441474.1_1 Forward -332 -313 2.26028 0.247
NP_442402.1_10 Reverse -187 -197 11.8776 0.231
NP_441848.1_4 Reverse -120 -136 8.21911 0.288
NP_441848.1_7 Reverse -378 -397 6.98015 0.196
NP_439942.1_2 Forward -166 -147 14.1524 0.228
NP_442039.1_7 Reverse -48 -58 14.0414 0.211
NP_442679.1_1 Forward -234 -215 -1.08219 0.226
NP_442837.1_3 Forward -178 -171 4.16902 0.28
NP_440160.1_2 Reverse -313 -332 -7.67036 0.286
NP_440160.1_3 Forward -334 -315 12.9783 0.209
NP_440160.1_9 Reverse -39 -58 8.65258 0.258
NP_441102.1_1 Reverse -171 -190 3.6377 0.285
NP_442532.1_2 Reverse -340 -359 0.524783 0.267
NP_442533.1_1 Reverse -316 -335 -13.5702 0.237
NP_442533.1_6 Forward -322 -313 6.48957 0.109
NP_442533.1_6 Forward -55 -46 4.62128 0.179
NP_442322.1_4 Forward -331 -314 -1.33848 0.226
NP_441482.1_7 Reverse -17 -31 -2.06536 0.0922
NP_439944.1_9 Forward -110 -100 6.46988 0.179
NP_439944.1_9 Forward -54 -44 5.28991 0.262
NP_441697.1_5 Forward -220 -201 -10.1703 0.278
NP_441028.1_6 Reverse -188 -198 14.6309 0.158
NP_441028.1_6 Reverse -243 -253 13.2542 0.159
NP_441028.1_6 Forward -13 -3 6.37109 0.23
NP_441527.1_4 Forward -227 -208 -3.39039 0.166
NP_441527.1_4 Reverse -342 -361 -8.35597 0.243
NP_441527.1_4 Forward -228 -209 -10.5523 0.272
NP_441527.1_4 Forward -220 -201 -12.0802 0.285
NP_441527.1_4 Forward -234 -215 -12.7486 0.293
NP_441527.1_4 Forward -219 -200 -12.8441 0.294
NP_439965.1_1 Forward -58 -39 -7.86702 0.244
NP_443045.1_2 Forward -23 -4 16.9124 0.181
NP_440317.1_2 Forward -111 -92 7.86593 0.29
NP_442673.1_7 Forward -150 -131 14.5621 0.192
NP_441106.1_3 Reverse -121 -140 11.9958 0.217
NP_441216.1_5 Forward -333 -314 12.88 0.224
NP_441186.1_4 Reverse -135 -145 15.5158 0.235
NP_441286.1_1 Forward -50 -38 1.80894 0.0791
NP_441286.1_1 Forward -33 -21 -4.9759 0.183
NP_441286.1_1 Forward -18 -6 -6.15587 0.251
NP_440092.1_9 Forward -326 -307 15.7324 0.235
NP_440886.1_4 Reverse -6 -25 14.6508 0.228
NP_440886.1_7 Reverse -169 -179 7.35439 0.0966
NP_440886.1_7 Forward -335 -325 6.66608 0.115
NP_440886.1_7 Forward -338 -328 6.56775 0.118
NP_440886.1_7 Forward -332 -322 5.38779 0.185
NP_440886.1_7 Reverse -87 -97 3.32285 0.287
NP_440828.1_4 Forward -338 -319 -4.62285 0.246
NP_441001.1_10 Reverse -318 -337 12.4875 0.249
NP_440513.1_6 Reverse -150 -169 11.11 0.222
NP_441808.1_8 Reverse -313 -332 6.39097 0.289
NP_442022.1_4 Reverse -319 -338 15.3391 0.152
NP_442264.1_2 Forward -36 -19 6.72535 0.25
NP_442264.1_2 Reverse -36 -53 5.54538 0.275
NP_441021.1_1 Reverse -281 -300 5.89931 0.0704
NP_441463.1_2 Forward -135 -117 -1.1671 0.293
NP_441463.1_3 Reverse -282 -301 -2.55715 0.156
NP_441463.1_6 Forward -34 -20 6.51256 0.269
NP_440107.1_2 Reverse -7 -26 7.37428 0.299
NP_441962.1_4 Forward -294 -275 -11.3086 0.239
NP_441431.1_3 Reverse -319 -338 7.27595 0.242
NP_441993.1_1 Forward -111 -92 3.21363 0.239
NP_441993.1_1 Reverse -314 -333 3.11618 0.241
NP_441993.1_1 Forward -32 -13 1.84923 0.269
NP_440358.1_8 Forward -142 -123 0.884433 0.258
NP_442698.1_10 Reverse -42 -61 0.58944 0.297
NP_441510.2_6 Reverse -13 -32 17.3048 0.107
NP_441272.1_8 Forward -206 -188 11.2289 0.296
NP_442582.1_3 Forward -211 -197 14.3354 0.235
NP_441253.1_1 Forward -332 -313 9.83255 0.205
NP_441885.1_5 Reverse -40 -50 0.176696 0.177
NP_440478.1_10 Forward -57 -43 6.98109 0.279
NP_442341.1_7 Forward -338 -324 7.17775 0.11
NP_440409.1_1 Forward -25 -6 1.76941 0.18
NP_440076.1_5 Reverse -312 -331 18.6815 0.081
NP_440552.1_8 Reverse -125 -142 10.6517 0.262
NP_442513.1_5 Reverse -320 -339 6.1935 0.282
NP_442932.1_9 Forward -199 -180 6.98095 0.249
NP_442451.1_2 Forward -25 -6 -9.24366 0.259
NP_439962.1_4 Forward -297 -278 -4.03212 0.265
NP_442495.1_5 Reverse -302 -321 5.211 0.293
NP_440149.1_8 Forward -192 -173 -4.91709 0.215
NP_441105.1_3 Reverse -35 -54 -0.590531 0.138
NP_441105.1_3 Forward -190 -171 -7.17871 0.248
NP_440216.1_1 Forward -169 -155 -3.24533 0.0754
NP_440216.1_9 Reverse -48 -57 7.47288 0.286
NP_442015.1_10 Reverse -166 -179 1.59258 0.204
NP_441111.1_7 Reverse -171 -179 -0.570565 0.233
NP_440244.1_9 Forward -106 -93 16.5389 0.15
NP_443052.1_9 Forward -338 -319 -1.08219 0.222
NP_440072.1_5 Reverse -319 -337 -1.75081 0.264
NP_442154.1_1 Reverse -320 -338 5.52568 0.0591
NP_442154.1_1 Forward -25 -7 -6.66736 0.141
NP_442154.1_1 Reverse -314 -332 -9.0273 0.175
NP_442154.1_1 Reverse -311 -329 -13.6489 0.217
NP_442154.1_1 Reverse -317 -335 -14.0422 0.217
NP_440261.1_5 Forward -16 -3 -4.40561 0.147
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAGAGCAGGGGTGGCAAATTGGGCCGCACAGATTAAATCCCCTTCATTTTCTCGATTTTCGTCGTCCACCACCACCACGGCCTTGCCCGCTTTAATGTCAGCTAGGGCTGCATCAATGGCATCAAACATCGGTAAATCGGACGGGATACGGGGGACAGAAACGTTCAAGGTGCAGAAAAGGAAAAAGTTAAAACTTAAGAAGCTGGAGGAAAATTGACAACGGTGGTCGCAGAAGATCGACTGTTGCAACAATTTAGCTTTGTTAACTATTTTAAAGCTTTTCTGGGAAGGCTTTGGTTTCTTCGTCGTAGGGGATGAATTTCTCTAAAAAAGGGAAACTTATTCTGCCATGGCTATAGTCCTATGATGGAAAGCGCCCTGGTTCCGCTGGCCCCCATCC

CDS

ATGATTGACCGCGAATTTTTGCTTGACCCCAATTCCCACTCCCCATCCGACCTTTCCTCGGCTAAAAGTCGCCCCTGGTTAGCTTCCCCCTGGCCCTGGACCATGGCGATCGCCGTTTTGTTGGGTTGGGGAGGTATGGCCCTGTGGCAGTCCCCTTGGTCGAAGCTAAAACTACCTTCTTTCTCCAGTTCGGTGGAAATCGCCCCTCTAGTGATGGAAGGGGGGGATCCCTATCTGCGGGCCTTGATGCGGACCATCAGTGCTAGTGAAGCCAATACGCCCCAACCCTATAACGTTATTTACGGGGGACAGCATGTCCAGGACTTGAGCGAACATCCCAACCGTTGCGTCAAAATTTTTATGGGGCCGAATCGGGGCAATTGCAGTACTGCCTCTGGGCGTTACCAGTTTTTGAATACCACCTGGGCTGAAAAAGCGGGTAAATATCATCCCCAGCCCCAGAAATTTTTGCTCTGGAAAAATTACAGCTTTGAGCCGGAGTACCAGGACCAAGTGCTTTACCGTTGGCTAGCTGATACCAAAGCCTGGGGGATGGATATTGGGGCCCAATTGCGGGCAGGGCATCTAGACCAGGTTTTGCGTCACCTTTCCCCCACTTGGACTAGTTTGGGCTACGGCATTGAGGACAATGTGATTACCAGACGTTTACCGGAACTTTATCAAAAGTTGTTGCAAGAAGAATTGCTTTTGGCCCACCATCATCAGGATTGA

Protein

MIDREFLLDPNSHSPSDLSSAKSRPWLASPWPWTMAIAVLLGWGGMALWQSPWSKLKLPSFSSSVEIAPLVMEGGDPYLRALMRTISASEANTPQPYNVIYGGQHVQDLSEHPNRCVKIFMGPNRGNCSTASGRYQFLNTTWAEKAGKYHPQPQKFLLWKNYSFEPEYQDQVLYRWLADTKAWGMDIGAQLRAGHLDQVLRHLSPTWTSLGYGIEDNVITRRLPELYQKLLQEELLLAHHHQD