Your browser is old and dusty. Try Google Chrome!

Details for slr1958

ORF slr1958
Accession NP_441498.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -172 -158 10.7177 0.267
NP_440557.1_1 Forward -314 -295 0.884433 0.265
NP_440795.1_7 Forward -192 -185 7.80726 0.232
NP_441418.1_6 Forward -202 -183 -22.2233 0.172
NP_443032.1_8 Forward -347 -328 1.96607 0.238
NP_441453.1_4 Reverse -163 -171 14.8674 0.00947
NP_441453.1_4 Forward -172 -164 6.80426 0.121
NP_441453.1_7 Forward -293 -286 12.9205 0.23
NP_441623.1_1 Forward -293 -275 3.16574 0.202
NP_441623.1_1 Forward -194 -176 -5.19239 0.284
NP_441818.1_9 Forward -189 -170 -10.522 0.295
NP_442173.1_1 Forward -171 -163 13.8841 0.0225
NP_442173.1_1 Reverse -164 -172 12.0158 0.0316
NP_442752.1_4 Forward -172 -165 13.8055 0.0199
NP_443027.1_4 Reverse -161 -171 6.96153 0.253
NP_442975.1_10 Reverse -159 -173 10.3237 0.056
NP_440784.1_7 Forward -171 -164 6.23397 0.241
NP_440784.1_7 Reverse -164 -171 6.13563 0.241
NP_440110.1_7 Reverse -243 -262 10.3242 0.289
NP_440110.1_8 Reverse -275 -294 -3.14714 0.288
NP_441476.1_5 Reverse -269 -288 8.06259 0.0982
NP_441476.1_5 Reverse -158 -177 -2.95047 0.231
NP_442062.1_8 Reverse -163 -173 5.09324 0.184
NP_440044.1_8 Reverse -164 -183 0.491109 0.197
NP_439918.1_2 Reverse -263 -282 8.75091 0.138
NP_440764.1_6 Forward -195 -176 20.059 0.167
NP_442110.1_7 Forward -172 -158 7.76774 0.108
NP_442726.1_1 Forward -192 -173 8.65258 0.271
NP_441083.1_5 Reverse -163 -173 9.81313 0.0224
NP_441083.1_5 Forward -172 -162 -1.10161 0.295
NP_442827.1_8 Forward -180 -161 2.16195 0.165
NP_441434.1_1 Reverse -63 -77 8.98786 0.251
NP_441738.1_2 Reverse -165 -172 15.28 0.0102
NP_441558.1_5 Reverse -161 -180 8.75091 0.141
NP_441558.1_5 Forward -174 -155 6.68596 0.206
NP_440209.1_1 Forward -172 -164 8.57422 0.0425
NP_442889.1_8 Forward -45 -31 10.6187 0.0817
NP_442889.1_8 Reverse -160 -174 6.19383 0.199
NP_440410.1_10 Reverse -170 -189 5.99764 0.199
NP_440178.1_7 Forward -173 -154 -22.6167 0.268
NP_441598.1_4 Reverse -283 -302 21.9273 0.0545
NP_442111.1_4 Reverse -162 -176 6.09611 0.138
NP_441624.1_7 Forward -294 -280 9.63603 0.218
NP_441163.1_1 Reverse -285 -302 4.56135 0.287
NP_440851.1_6 Forward -305 -288 1.21881 0.288
NP_440906.1_5 Forward -171 -164 6.23397 0.234
NP_440906.1_5 Reverse -164 -171 6.13563 0.241
NP_440747.1_10 Forward -175 -163 -4.68091 0.115
NP_441486.1_1 Reverse -160 -174 -4.81863 0.209
NP_441014.1_5 Forward -282 -264 9.85225 0.272
NP_441014.1_8 Reverse -95 -114 -4.13045 0.247
NP_442848.1_1 Reverse -157 -171 3.24451 0.139
NP_442848.1_5 Reverse -177 -195 -3.12744 0.29
NP_442848.1_5 Reverse -168 -186 -3.71743 0.297
NP_441012.1_4 Reverse -186 -199 8.57408 0.272
NP_443018.1_3 Reverse -164 -171 11.7405 0.0655
NP_443018.1_3 Forward -171 -164 5.44732 0.193
NP_440376.1_1 Forward -172 -163 5.89959 0.116
NP_440376.1_1 Reverse -163 -172 -0.0986038 0.285
NP_440376.1_1 Reverse -268 -277 -0.786921 0.293
NP_441588.1_4 Reverse -165 -175 15.9097 0.0369
NP_442687.1_7 Forward -173 -163 5.68323 0.189
NP_442687.1_7 Forward -203 -193 5.5849 0.194
NP_442687.1_7 Reverse -291 -301 4.0116 0.271
NP_440642.1_8 Forward -269 -250 14.1932 0.217
NP_441422.1_7 Reverse -95 -112 -1.23946 0.183
NP_441422.1_7 Forward -44 -27 -9.20427 0.294
NP_442658.1_1 Reverse -161 -171 5.38779 0.269
NP_442658.1_9 Forward -268 -249 11.8975 0.286
NP_442782.1_2 Forward -348 -334 3.8345 0.261
NP_440720.1_1 Forward -183 -164 7.86593 0.195
NP_442937.1_5 Forward -177 -158 14.6508 0.0737
NP_441958.1_5 Forward -173 -163 8.73149 0.0255
NP_441958.1_5 Reverse -162 -172 1.65166 0.0872
NP_441338.2_9 Forward -261 -242 5.30933 0.252
NP_442911.1_2 Reverse -153 -172 -9.24366 0.252
NP_442236.1_7 Forward -179 -160 9.24257 0.253
NP_440993.1_2 Reverse -158 -174 4.58176 0.252
NP_440827.1_3 Reverse -158 -177 14.5524 0.201
NP_442853.1_6 Reverse -154 -173 17.3559 0.189
NP_441129.1_6 Forward -279 -260 2.0644 0.229
NP_442002.1_9 Forward -248 -241 11.3472 0.185
NP_441294.1_7 Reverse -159 -173 10.3065 0.197
NP_442771.1_1 Forward -288 -270 -8.33898 0.189
NP_442771.1_1 Forward -302 -284 -8.92897 0.21
NP_441674.1_6 Reverse -179 -198 4.32602 0.261
NP_441674.1_10 Forward -301 -283 -0.964162 0.29
NP_440147.1_4 Forward -174 -161 16.3422 0.0113
NP_441550.1_8 Forward -174 -164 13.3526 0.0252
NP_441550.1_8 Reverse -161 -171 11.6809 0.0446
NP_441916.1_7 Forward -172 -162 7.15819 0.0745
NP_441916.1_7 Reverse -163 -173 1.35667 0.286
NP_441041.1_4 Reverse -163 -182 -10.4236 0.232
NP_441041.1_7 Reverse -160 -172 7.70913 0.162
NP_442004.1_6 Reverse -163 -177 1.37622 0.29
NP_440703.1_9 Reverse -115 -128 4.54195 0.296
NP_439966.1_7 Reverse -161 -171 4.60114 0.265
NP_439966.1_9 Forward -372 -363 3.7363 0.253
NP_442941.1_3 Reverse -164 -174 1.25834 0.15
NP_442941.1_3 Forward -171 -161 -1.29827 0.297
NP_440983.1_5 Reverse -163 -182 -2.26216 0.231
NP_442281.1_1 Reverse -158 -172 12.487 0.0369
NP_441334.1_7 Reverse -161 -180 -20.1584 0.275
NP_441079.1_7 Forward -80 -61 1.17865 0.18
NP_442982.1_5 Reverse -281 -300 -1.08219 0.263
NP_441644.1_3 Forward -135 -116 18.584 0.218
NP_441644.1_6 Reverse -163 -173 14.7292 0.0105
NP_440929.1_8 Reverse -163 -172 7.17789 0.0713
NP_442933.1_6 Reverse -55 -74 15.6125 0.237
NP_442933.1_10 Reverse -163 -172 8.06287 0.0885
NP_442933.1_10 Forward -172 -163 7.96454 0.0937
NP_442648.1_8 Reverse -128 -143 18.6628 0.122
NP_442554.1_8 Forward -171 -161 7.15819 0.0975
NP_442554.1_8 Reverse -164 -174 5.48657 0.146
NP_442554.1_9 Forward -193 -174 12.5018 0.279
NP_441762.1_7 Reverse -183 -195 -3.6976 0.127
NP_441762.1_7 Reverse -162 -174 -7.53251 0.293
NP_442292.1_1 Reverse -164 -173 8.65285 0.0335
NP_440895.1_3 Forward -272 -253 17.0403 0.237
NP_440895.1_6 Forward -178 -165 8.77074 0.246
NP_443009.1_5 Forward -173 -162 3.69644 0.282
NP_442301.1_2 Reverse -183 -202 4.12856 0.284
NP_440881.1_4 Reverse -280 -299 -0.295539 0.259
NP_440379.1_5 Forward -187 -168 -4.52377 0.215
NP_440379.1_5 Forward -352 -333 -9.34199 0.263
NP_441468.1_1 Forward -171 -164 6.13563 0.209
NP_441468.1_1 Reverse -164 -171 6.0373 0.223
NP_441020.2_6 Reverse -191 -208 7.512 0.229
NP_441673.1_1 Forward -172 -163 1.27803 0.155
NP_441673.1_1 Reverse -163 -172 1.27803 0.155
NP_442253.1_7 Forward -303 -289 13.9626 0.226
NP_440265.1_8 Reverse -119 -137 15.8504 0.216
NP_441826.1_2 Reverse -163 -177 0.982901 0.167
NP_442490.1_9 Forward -184 -165 -3.24547 0.229
NP_442868.1_6 Forward -174 -164 0.0783647 0.248
NP_442427.1_8 Reverse -154 -173 7.86593 0.203
NP_441101.1_5 Forward -188 -170 16.0182 0.246
NP_442050.1_5 Reverse -161 -171 14.1392 0.0227
NP_440558.1_2 Forward -275 -256 -5.80207 0.264
NP_441498.1_1 Forward -233 -214 18.3818 0.21
NP_441498.1_4 Forward -89 -70 17.6007 0.291
NP_441878.1_6 Reverse -268 -278 -7.98478 0.285
NP_441036.1_8 Reverse -162 -172 6.07655 0.242
NP_441557.1_4 Forward -66 -52 10.816 0.291
NP_441557.1_5 Forward -172 -163 8.94785 0.0289
NP_441557.1_5 Reverse -163 -172 0.688044 0.128
NP_441433.1_2 Reverse -166 -185 13.7658 0.265
NP_441433.1_8 Forward -227 -208 -3.93378 0.285
NP_440084.1_8 Forward -77 -63 8.89237 0.299
NP_441458.1_10 Forward -51 -32 7.66927 0.192
NP_442183.1_1 Forward -172 -158 5.80112 0.203
NP_441459.1_8 Forward -179 -166 11.1307 0.286
NP_439980.1_1 Forward -183 -164 15.4385 0.265
NP_441574.1_1 Forward -184 -165 -7.4737 0.292
NP_442347.1_2 Reverse -164 -173 10.3245 0.058
NP_442645.1_2 Reverse -161 -180 -16.0285 0.22
NP_440547.1_1 Forward -198 -179 9.24175 0.252
NP_442594.1_10 Forward -309 -290 7.96345 0.288
NP_442317.1_6 Reverse -214 -233 5.99764 0.238
NP_441633.1_3 Reverse -84 -97 1.9859 0.109
NP_440136.1_2 Forward -171 -164 6.23397 0.171
NP_440136.1_2 Reverse -164 -171 6.13563 0.193
NP_442998.1_5 Forward -262 -252 10.6981 0.206
NP_442998.1_10 Reverse -165 -172 15.5754 0.0102
NP_440899.1_8 Reverse -242 -261 -7.86702 0.246
NP_440299.1_1 Forward -176 -163 13.2934 0.0319
NP_442299.1_7 Reverse -185 -204 20.1564 0.138
NP_440256.1_1 Forward -175 -156 -5.40875 0.182
NP_441559.1_8 Reverse -38 -52 -1.8687 0.186
NP_440915.1_6 Forward -176 -162 3.04785 0.109
NP_440915.1_6 Reverse -159 -173 2.35953 0.119
NP_440733.1_2 Forward -71 -53 18.1455 0.102
NP_440717.1_2 Reverse -284 -303 -11.1119 0.271
NP_441866.1_6 Forward -381 -362 8.94676 0.253
NP_440215.1_6 Reverse -239 -258 19.3698 0.18
NP_440243.1_1 Reverse -62 -81 13.5117 0.246
NP_441113.1_3 Reverse -290 -304 15.1419 0.27
NP_441939.1_3 Forward -171 -152 13.9625 0.0811
NP_441939.1_10 Reverse -34 -53 20.944 0.131
NP_442993.1_1 Forward -172 -156 -11.3479 0.244
NP_441340.1_5 Forward -171 -164 13.5105 0.0314
NP_441340.1_5 Reverse -164 -171 5.84064 0.208
NP_442327.1_3 Reverse -59 -78 5.0129 0.281
NP_442484.1_2 Forward -183 -164 2.94938 0.217
NP_442791.1_5 Forward -291 -272 -5.60541 0.279
NP_441952.1_9 Forward -83 -64 15.8366 0.263
NP_442240.1_1 Forward -279 -260 8.25844 0.238
NP_440161.1_3 Forward -377 -358 7.86593 0.285
NP_440586.1_8 Reverse -164 -171 9.47853 0.146
NP_440586.1_8 Forward -171 -164 5.74197 0.283
NP_441262.1_3 Forward -172 -165 14.7888 0.0223
NP_443051.1_1 Forward -173 -164 7.47288 0.0571
NP_443051.1_1 Reverse -162 -171 0.393051 0.169
NP_441595.1_3 Reverse -189 -199 18.8596 0.202
NP_440372.1_2 Forward -171 -164 13.8055 0.0214
NP_440372.1_2 Reverse -164 -171 6.52896 0.188
NP_441789.1_7 Reverse -92 -111 -5.01617 0.293
NP_439977.1_5 Reverse -157 -176 2.3594 0.174
NP_442384.1_10 Reverse -163 -176 14.0806 0.0169
NP_441877.1_5 Reverse -249 -268 5.89931 0.195
NP_441877.1_7 Reverse -104 -123 1.57197 0.242
NP_441018.1_7 Forward -182 -163 9.53756 0.223
NP_441018.1_7 Forward -176 -157 7.07928 0.277
NP_441018.1_7 Forward -128 -109 6.19431 0.297
NP_442790.1_4 Forward -181 -162 -14.4552 0.277
NP_442262.1_3 Forward -109 -90 25.0739 0.0148
NP_442262.1_10 Reverse -164 -171 13.2155 0.0213
NP_442262.1_10 Forward -87 -80 8.20058 0.25
NP_441689.1_5 Reverse -161 -171 8.43603 0.132
NP_441814.1_5 Reverse -138 -157 8.55425 0.249
NP_440163.1_10 Reverse -187 -197 13.648 0.118
NP_440163.1_10 Reverse -130 -140 9.02648 0.25
NP_440350.1_5 Reverse -228 -247 -3.93378 0.272
NP_442280.1_10 Forward -182 -164 9.35044 0.233
NP_440999.1_2 Reverse -185 -204 18.1907 0.0981
NP_440999.1_9 Reverse -159 -173 4.42448 0.116
NP_440888.1_2 Reverse -163 -177 7.76712 0.184
NP_440052.1_5 Forward -183 -164 6.19431 0.107
NP_440052.1_5 Forward -300 -281 -1.96717 0.21
NP_442277.1_2 Reverse -237 -251 10.4227 0.287
NP_442033.1_10 Forward -288 -269 -13.6686 0.287
NP_441543.1_2 Reverse -164 -173 7.07956 0.131
NP_442845.1_2 Forward -178 -164 15.6342 0.0694
NP_442845.1_2 Reverse -127 -141 3.53951 0.287
NP_441918.1_7 Reverse -193 -212 -1.86883 0.297
NP_442710.1_7 Forward -70 -51 -1.84059 0.228
NP_442578.1_7 Forward -171 -164 6.0373 0.18
NP_442286.1_7 Forward -159 -140 16.8132 0.133
NP_441462.1_2 Forward -172 -162 17.4829 0.00406
NP_441621.1_7 Reverse -182 -196 5.01447 0.0934
NP_441621.1_7 Forward -108 -94 -4.13031 0.208
NP_441621.1_7 Reverse -98 -112 -6.09693 0.275
NP_442204.1_1 Reverse -39 -50 8.7118 0.0852
NP_441560.1_8 Forward -207 -188 11.5127 0.294
NP_440544.1_5 Reverse -209 -216 13.8024 0.28
NP_441351.1_8 Forward -195 -176 1.76941 0.267
NP_441351.1_8 Reverse -191 -210 1.67108 0.267
NP_440516.1_8 Forward -172 -163 9.4395 0.0183
NP_440516.1_8 Reverse -163 -172 5.11294 0.118
NP_442428.1_5 Forward -171 -164 6.13563 0.209
NP_442428.1_5 Reverse -164 -171 6.0373 0.212
NP_441443.1_2 Forward -309 -290 -2.75381 0.26
NP_442823.1_8 Reverse -158 -177 10.0292 0.299
NP_440673.1_2 Forward -188 -169 9.02386 0.259
NP_440673.1_2 Forward -296 -277 8.04834 0.284
NP_440673.1_3 Reverse -165 -172 12.4288 0.0426
NP_441052.1_2 Reverse -163 -173 1.65166 0.233
NP_442219.1_9 Reverse -164 -173 7.96454 0.0696
NP_440436.1_4 Reverse -164 -173 7.57079 0.124
NP_440648.1_10 Forward -266 -248 11.5239 0.118
NP_442414.1_8 Forward -297 -278 12.0942 0.226
NP_442577.1_1 Forward -189 -170 -1.37718 0.27
NP_441719.1_4 Forward -171 -164 6.82395 0.0855
NP_441719.1_4 Reverse -164 -171 6.52896 0.188
NP_441004.1_1 Forward -208 -189 -10.522 0.221
NP_442366.1_5 Forward -175 -165 15.4175 0.0374
NP_441034.1_4 Reverse -158 -177 18.6078 0.0873
NP_441115.1_4 Reverse -120 -138 12.998 0.0921
NP_441115.1_4 Forward -53 -35 10.4414 0.179
NP_442694.1_4 Reverse -139 -148 15.536 0.164
NP_440094.1_2 Reverse -158 -177 -3.3438 0.281
NP_440864.1_9 Forward -188 -169 -5.60541 0.231
NP_441851.1_10 Forward -173 -163 7.35486 0.142
NP_442515.1_1 Reverse -290 -304 -4.13031 0.298
NP_440593.1_3 Reverse -158 -177 10.2259 0.107
NP_440593.1_3 Forward -177 -158 -7.4737 0.295
NP_441982.1_6 Forward -152 -143 13.8222 0.274
NP_441124.1_5 Reverse -67 -77 11.3848 0.257
NP_440431.1_3 Forward -272 -253 -9.34199 0.244
NP_440431.1_4 Forward -84 -65 -9.88384 0.294
NP_441031.1_1 Forward -79 -60 15.4993 0.086
NP_440040.1_3 Forward -265 -255 17.3846 0.25
NP_440954.1_1 Reverse -134 -153 -4.72043 0.289
NP_442006.1_2 Reverse -284 -301 -9.3026 0.197
NP_442006.1_2 Reverse -184 -201 -15.1041 0.215
NP_443047.1_5 Forward -194 -176 20.177 0.167
NP_441570.1_2 Reverse -287 -305 15.2604 0.0826
NP_440078.1_4 Forward -183 -164 9.63589 0.285
NP_441078.1_4 Reverse -163 -172 0.0980582 0.205
NP_441078.1_4 Forward -172 -163 0.0980582 0.205
NP_442348.1_2 Reverse -138 -147 7.37455 0.28
NP_441432.1_8 Forward -173 -164 14.0611 0.0258
NP_441432.1_8 Forward -125 -116 3.14632 0.259
NP_442320.1_8 Forward -178 -164 5.99778 0.0309
NP_442320.1_8 Reverse -157 -171 -2.45868 0.0894
NP_440760.1_1 Reverse -163 -182 -17.1101 0.192
NP_440760.1_1 Reverse -193 -212 -21.7317 0.243
NP_442797.1_7 Reverse -284 -302 1.59244 0.257
NP_441057.1_4 Forward -287 -269 -3.91409 0.299
NP_440913.1_1 Forward -174 -156 3.3624 0.299
NP_442400.1_2 Forward -246 -227 7.47261 0.271
NP_442400.1_10 Reverse -253 -266 8.56056 0.278
NP_442400.1_10 Forward -68 -55 7.79662 0.282
NP_442489.1_7 Reverse -163 -172 0.786375 0.152
NP_442489.1_7 Forward -172 -163 0.589713 0.17
NP_440559.1_1 Reverse -164 -173 7.76787 0.0918
NP_440559.1_1 Forward -171 -162 5.99792 0.135
NP_441659.2_8 Reverse -163 -173 12.7631 0.0147
NP_441659.2_8 Forward -172 -162 1.74999 0.227
NP_441022.1_1 Forward -71 -62 11.0666 0.284
NP_439956.1_7 Reverse -256 -275 1.47442 0.292
NP_442346.1_5 Forward -173 -163 7.05986 0.183
NP_442346.1_5 Reverse -162 -172 4.3066 0.291
NP_442346.1_10 Forward -189 -170 0.392778 0.242
NP_442934.1_9 Forward -246 -228 12.9005 0.282
NP_441943.1_8 Reverse -283 -302 -4.52377 0.219
NP_442027.1_4 Reverse -222 -241 17.6178 0.144
NP_442311.1_6 Forward -254 -235 7.27595 0.298
NP_441833.1_4 Reverse -164 -171 6.52896 0.0924
NP_441833.1_4 Forward -171 -164 6.23397 0.163
NP_441329.1_6 Forward -72 -53 6.44528 0.179
NP_441895.1_3 Reverse -105 -124 -17.2085 0.298
NP_441895.1_10 Forward -76 -57 -19.0768 0.282
NP_442162.1_9 Forward -171 -164 12.9205 0.0282
NP_442162.1_9 Reverse -164 -171 12.9205 0.0282
NP_443015.1_8 Reverse -286 -300 18.3027 0.235
NP_440671.1_4 Forward -33 -19 9.83269 0.17
NP_440204.1_1 Forward -183 -164 5.40766 0.278
NP_442140.1_3 Reverse -164 -174 10.2065 0.0902
NP_442021.1_3 Forward -178 -159 5.11266 0.126
NP_441609.1_1 Forward -385 -366 -2.95047 0.298
NP_441813.1_3 Reverse -278 -297 13.2677 0.296
NP_441813.1_5 Reverse -161 -171 4.79825 0.144
NP_441813.1_7 Reverse -108 -122 7.96378 0.298
NP_440590.1_4 Reverse -164 -177 7.98409 0.0491
NP_440590.1_4 Forward -171 -158 2.47756 0.0879
NP_440567.1_1 Reverse -164 -178 4.81781 0.111
NP_440567.1_1 Forward -171 -157 0.196253 0.254
NP_442497.1_4 Forward -82 -63 11.1244 0.271
NP_442497.1_10 Forward -171 -162 5.99792 0.095
NP_442497.1_10 Reverse -164 -173 0.589713 0.153
NP_440821.1_4 Forward -174 -164 -0.314959 0.251
NP_441239.1_9 Reverse -161 -173 12.0354 0.0512
NP_441951.1_4 Forward -178 -159 7.96426 0.266
NP_440706.1_1 Reverse -29 -48 10.4225 0.0818
NP_441892.1_1 Reverse -154 -171 -5.56602 0.283
NP_442643.1_1 Forward -178 -159 -4.42544 0.231
NP_442643.1_7 Forward -381 -362 1.96607 0.288
NP_440876.1_5 Reverse -165 -184 7.96426 0.277
NP_440354.1_5 Reverse -259 -278 3.83436 0.236
NP_440546.1_4 Forward -172 -162 16.1543 0.0459
NP_440546.1_4 Reverse -163 -173 8.20381 0.199
NP_441230.1_5 Reverse -158 -177 12.7825 0.067
NP_440462.1_6 Reverse -161 -171 15.8113 0.0142
NP_442465.1_1 Reverse -206 -225 8.45592 0.163
NP_442465.1_1 Forward -186 -167 3.83436 0.229
NP_442144.1_1 Forward -175 -159 12.3499 0.275
NP_441879.1_10 Forward -261 -242 17.699 0.0852
NP_442479.1_9 Reverse -250 -269 16.0274 0.103
NP_441084.1_6 Reverse -119 -133 11.2833 0.208
NP_442039.1_4 Forward -171 -164 11.6422 0.0747
NP_442679.1_1 Forward -249 -230 8.94757 0.147
NP_441926.1_3 Reverse -219 -235 4.28677 0.193
NP_440825.1_7 Reverse -164 -174 10.9578 0.278
NP_442837.1_3 Forward -171 -164 6.0373 0.25
NP_442837.1_3 Reverse -164 -171 6.0373 0.25
NP_442053.1_1 Reverse -163 -172 7.17789 0.104
NP_440505.1_3 Forward -174 -164 7.64985 0.151
NP_441701.1_3 Forward -292 -275 7.41366 0.261
NP_441536.1_1 Forward -87 -68 16.4207 0.148
NP_441408.2_7 Reverse -161 -180 12.6841 0.0693
NP_440914.1_1 Reverse -163 -173 14.373 0.0158
NP_441011.1_8 Forward -171 -162 14.356 0.0249
NP_442533.1_6 Forward -172 -163 5.40793 0.14
NP_442533.1_6 Reverse -163 -172 4.52295 0.179
NP_442533.1_6 Forward -271 -262 2.55633 0.25
NP_442232.1_4 Reverse -146 -165 14.5524 0.17
NP_442322.1_4 Reverse -332 -349 -6.05834 0.275
NP_441482.1_7 Reverse -157 -171 -2.55701 0.0968
NP_441482.1_7 Forward -178 -164 -10.7185 0.213
NP_439944.1_9 Forward -171 -161 6.76487 0.168
NP_442203.1_3 Reverse -61 -80 6.70429 0.266
NP_441697.1_5 Forward -80 -61 -4.72727 0.222
NP_440816.1_2 Forward -73 -54 10.5979 0.202
NP_440816.1_2 Forward -84 -65 8.66165 0.238
NP_441028.1_6 Forward -297 -287 10.9926 0.193
NP_441028.1_6 Forward -298 -288 7.94438 0.217
NP_441028.1_6 Forward -299 -289 5.38779 0.255
NP_441527.1_4 Forward -71 -52 -10.9342 0.277
NP_441602.1_3 Forward -177 -158 16.0274 0.0522
NP_441602.1_3 Reverse -257 -276 -3.44213 0.246
NP_441972.1_5 Reverse -164 -183 -3.54046 0.2
NP_441106.1_1 Reverse -162 -171 7.96454 0.0647
NP_439903.1_6 Reverse -160 -179 9.43841 0.124
NP_439903.1_6 Forward -231 -212 0.195343 0.268
NP_442588.1_8 Reverse -183 -202 4.916 0.289
NP_001035870.1_3 Reverse -328 -347 -4.03212 0.278
NP_442306.1_10 Reverse -38 -57 -21.7317 0.286
NP_441286.1_1 Forward -173 -161 -3.99259 0.148
NP_440670.1_8 Forward -172 -163 8.65285 0.0627
NP_440670.1_8 Reverse -163 -172 6.29291 0.124
NP_442072.1_9 Forward -173 -155 3.26407 0.0287
NP_442213.1_6 Reverse -254 -273 4.62101 0.285
NP_440907.2_8 Forward -171 -161 6.76441 0.15
NP_440907.2_8 Reverse -164 -174 5.87944 0.184
NP_441463.1_3 Forward -152 -133 -8.16202 0.266
NP_441626.1_2 Forward -171 -164 12.2322 0.0511
NP_441626.1_2 Reverse -164 -171 5.93897 0.231
NP_442912.1_9 Forward -270 -251 19.174 0.101
NP_442794.1_1 Forward -176 -164 9.38042 0.0795
NP_442615.1_1 Forward -181 -163 -5.58572 0.217
NP_441962.1_4 Forward -207 -188 -5.99873 0.175
NP_441962.1_4 Reverse -158 -177 -12.7836 0.265
NP_440387.1_1 Forward -172 -156 -3.97304 0.171
NP_441431.1_2 Reverse -160 -174 12.5853 0.114
NP_441488.1_8 Forward -177 -163 9.93039 0.146
NP_441836.1_1 Forward -183 -164 11.6941 0.294
NP_441993.1_1 Forward -178 -159 14.1289 0.0786
NP_440143.1_1 Reverse -106 -125 15.2408 0.246
NP_440114.1_10 Reverse -133 -147 9.34103 0.177
NP_440114.1_10 Forward -172 -158 9.2427 0.179
NP_440114.1_10 Reverse -339 -353 8.84938 0.192
NP_441425.1_6 Reverse -142 -152 16.008 0.252
NP_442698.1_10 Reverse -165 -184 2.0644 0.285
NP_442698.1_10 Forward -86 -67 -0.787193 0.297
NP_442324.1_7 Forward -63 -44 6.82273 0.268
NP_442087.1_7 Reverse -51 -70 -4.1312 0.292
NP_440293.1_3 Forward -126 -107 -1.37718 0.239
NP_440293.1_3 Forward -295 -276 -3.73712 0.252
NP_440293.1_3 Forward -195 -176 -6.39206 0.288
NP_441133.1_1 Forward -300 -281 13.5691 0.243
NP_439910.1_2 Reverse -155 -172 -13.9242 0.171
NP_440457.1_1 Forward -176 -164 0.530633 0.25
NP_442680.1_5 Forward -249 -230 6.71518 0.207
NP_442680.1_5 Forward -85 -66 1.63528 0.24
NP_441984.1_3 Reverse -174 -192 6.80398 0.264
NP_441984.1_3 Reverse -159 -177 5.91901 0.276
NP_442509.1_9 Reverse -86 -96 7.0594 0.24
NP_442582.1_3 Forward -69 -55 16.4362 0.137
NP_442582.1_3 Forward -78 -64 12.8075 0.284
NP_440554.1_4 Forward -171 -161 7.74818 0.096
NP_440554.1_4 Reverse -34 -44 4.89658 0.171
NP_442862.1_3 Reverse -253 -270 4.56207 0.29
NP_442737.1_10 Reverse -193 -212 15.6412 0.268
NP_441885.1_5 Forward -172 -162 7.84651 0.0419
NP_441885.1_5 Reverse -163 -173 1.35667 0.11
NP_440628.1_1 Forward -239 -229 14.5491 0.258
NP_442703.1_4 Reverse -163 -182 0.981987 0.284
NP_442341.1_9 Forward -280 -266 5.30886 0.274
NP_441756.1_5 Forward -292 -273 0.196116 0.24
NP_441173.1_9 Reverse -255 -263 9.85212 0.275
NP_442395.2_4 Reverse -157 -176 5.70185 0.155
NP_440423.1_10 Forward -179 -160 9.14423 0.26
NP_443000.1_7 Forward -174 -164 0.57002 0.294
NP_441842.1_10 Forward -179 -165 11.3077 0.134
NP_440275.1_3 Forward -174 -164 5.48657 0.145
NP_442932.1_9 Forward -85 -66 11.0125 0.18
NP_442275.1_1 Forward -271 -252 11.8975 0.222
NP_442275.1_1 Forward -287 -268 4.62101 0.274
NP_441902.1_3 Reverse -146 -156 13.7591 0.226
NP_440679.1_10 Forward -290 -271 -20.7484 0.286
NP_441359.1_5 Reverse -259 -278 2.94938 0.259
NP_442638.1_3 Forward -84 -65 17.3314 0.209
NP_442638.1_3 Forward -75 -56 13.2252 0.298
NP_441207.1_7 Forward -81 -67 8.19046 0.293
NP_440149.1_8 Reverse -178 -197 -3.93378 0.201
NP_441105.1_3 Reverse -152 -171 -3.83545 0.185
NP_440172.1_1 Forward -172 -162 10.1081 0.0551
NP_440172.1_1 Reverse -163 -173 2.33998 0.279
NP_441226.1_7 Forward -171 -164 12.7234 0.0312
NP_441226.1_7 Reverse -164 -171 11.5435 0.0757
NP_441111.1_7 Reverse -164 -172 8.86921 0.0589
NP_441766.1_2 Forward -172 -163 8.1612 0.0645
NP_441766.1_2 Reverse -163 -172 5.89959 0.103
NP_440416.1_9 Reverse -272 -291 -19.6667 0.276
NP_442116.1_6 Forward -80 -63 6.92756 0.271
NP_442154.1_1 Forward -195 -177 -16.5988 0.243
NP_442154.1_1 Forward -186 -168 -17.2871 0.251
NP_442226.1_8 Reverse -253 -263 14.4347 0.256
NP_441430.1_6 Reverse -104 -123 10.8159 0.263
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATACCTAAACATGAGACATTTTTGCGACGCTTGGATTGAAGAATGGTGTGAAGCCAATGGTTGGACGGATTTGTTCATGGAAAGACTCAATTACTATTGGGCTTTTCCCCCTGGGGCTGTCATGCCGGAGCCCATTCCTGGCAAAATTCTCCGGGCAATTAAACTAGAAAAAGGTCTTTGCGAAGAAGAAAAAGCTTGGTTAACCGCCGCTGTGGCTGTTTCTGCTTTGGCGATCGGTTCTGCTTTTCTGCTCAAAAATCCCATGCCTGTAGTACTGGCTTTTGCTTTTGACGCTGTAACAGCGGGGCGTTTAGAGATGGAAGAAATTTAAAAAATTTGAGAAGATTAATCCATTACCTGCGATATCAAACACTCTGATTGGAGTAACTAAGCAACATTT

CDS

ATGGCTGATTCCATCACCCCAGACTCCAATGAACACAATTATGCTGAGCTGGCTCAACAATGCCAGAATTTGGCCAGCCAAGTCCAGAGCCTCAGCCAACGGGTGGAAAATCTGGAAAGCAAACTGACCTTAATCCCGGACATTGAGCGCTATGGTAGGTTGCAGGAATGCTTAATTGCGGGGGATTTTAAGACGGCGGACCACGAAACCACCCGCATTATTCTCGAAACCCTCAATCGTAATCGGGATAACCTCAGCCCAGAAACTTTATCTGCTTTGCCCTGTACAGTTTTAACGGTAATTGATCGCCTGTGGCGTACCTACAGCGAAGATCGTTTTGGCTTTAGCCGGCAATTGGAAGCCTATCAAAAGGTAGGTGGTAACACCGATACTTTGCGTACCCAAGACCGGAAAGTGATGGGGGCCTTTGCCCAGGAAGTGGGTTGGGTGCAGGAAGGAAAGGTTCGTTTTGATGAGTATGACCAATGGGATTTTTCCCTCAATGCTCCGGTGGGTAGTTTCCCTGCCATTTGGTGGAAGTCTCCCTATGGTTTGAAAATGGTGACTTTTTTCTTCATTCGTTTGTTTGAATGTAACGGCTAG

Protein

MADSITPDSNEHNYAELAQQCQNLASQVQSLSQRVENLESKLTLIPDIERYGRLQECLIAGDFKTADHETTRIILETLNRNRDNLSPETLSALPCTVLTVIDRLWRTYSEDRFGFSRQLEAYQKVGGNTDTLRTQDRKVMGAFAQEVGWVQEGKVRFDEYDQWDFSLNAPVGSFPAIWWKSPYGLKMVTFFFIRLFECNG