Your browser is old and dusty. Try Google Chrome!

Details for slr1951

ORF slr1951
Accession NP_441939.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -348 -334 14.9459 0.12
NP_441061.1_2 Forward -347 -333 10.6193 0.06
NP_441061.1_2 Reverse -340 -354 8.94771 0.0824
NP_440557.1_1 Forward -347 -328 -2.65548 0.297
NP_440795.1_7 Forward -347 -340 14.6904 0.0123
NP_440795.1_7 Reverse -340 -347 14.6904 0.0123
NP_440795.1_10 Forward -380 -361 16.3215 0.195
NP_441418.1_6 Forward -348 -329 -11.2103 0.0462
NP_441418.1_6 Reverse -339 -358 -19.2734 0.0867
NP_442291.1_5 Reverse -338 -354 1.82849 0.138
NP_441453.1_4 Reverse -339 -347 16.539 0.00633
NP_441453.1_4 Forward -348 -340 16.539 0.00633
NP_441623.1_1 Forward -391 -373 4.83737 0.184
NP_442151.1_6 Forward -348 -334 8.84938 0.164
NP_441465.1_8 Forward -377 -359 7.00065 0.246
NP_441630.1_3 Forward -265 -246 6.88262 0.126
NP_441630.1_3 Forward -356 -337 -0.885524 0.29
NP_440150.1_6 Reverse -336 -355 8.16093 0.214
NP_442173.1_1 Forward -347 -339 15.4574 0.00633
NP_442173.1_1 Reverse -340 -348 15.4574 0.00633
NP_442752.1_4 Forward -348 -341 13.8055 0.0199
NP_442752.1_4 Reverse -339 -346 13.8055 0.0199
NP_443027.1_4 Reverse -337 -347 13.943 0.0452
NP_443027.1_4 Forward -350 -340 11.8781 0.0872
NP_441745.1_3 Forward -300 -281 13.3716 0.282
NP_439997.1_5 Reverse -225 -244 18.0168 0.206
NP_442975.1_10 Reverse -335 -349 4.62054 0.241
NP_442975.1_10 Forward -352 -338 4.32555 0.245
NP_440784.1_7 Forward -347 -340 15.9687 0.0123
NP_440784.1_7 Reverse -340 -347 15.9687 0.0123
NP_440061.1_9 Forward -350 -336 11.4053 0.111
NP_441476.1_5 Reverse -334 -353 10.2259 0.0933
NP_441476.1_5 Forward -353 -334 0.491109 0.19
NP_442062.1_8 Forward -348 -338 19.4496 0.000558
NP_442062.1_8 Reverse -339 -349 19.4496 0.000558
NP_441900.1_2 Reverse -293 -311 -6.37307 0.293
NP_442974.1_7 Reverse -87 -105 15.5546 0.267
NP_441859.1_3 Forward -349 -330 17.2065 0.0436
NP_441859.1_3 Reverse -338 -357 3.9319 0.23
NP_441859.1_3 Reverse -58 -77 2.6536 0.258
NP_440304.1_4 Reverse -337 -347 9.91146 0.051
NP_440304.1_4 Forward -350 -340 1.84832 0.299
NP_442242.1_4 Forward -347 -340 14.3954 0.0124
NP_442242.1_4 Reverse -340 -347 14.3954 0.0124
NP_441208.1_9 Reverse -336 -350 6.98109 0.229
NP_441594.1_6 Reverse -330 -349 6.98095 0.181
NP_441594.1_6 Forward -345 -326 1.57275 0.266
NP_440370.1_10 Reverse -330 -349 10.3242 0.211
NP_442375.1_6 Forward -84 -65 14.1591 0.294
NP_442110.1_7 Forward -348 -334 10.6193 0.0644
NP_442726.1_1 Reverse -334 -353 7.66927 0.288
NP_441925.1_4 Reverse -290 -309 -9.44104 0.22
NP_440856.1_4 Reverse -332 -351 -2.85214 0.222
NP_440856.1_7 Reverse -327 -346 -7.86702 0.258
NP_441083.1_5 Forward -348 -338 11.3864 0.0159
NP_441083.1_5 Reverse -339 -349 11.3864 0.0159
NP_441738.1_2 Forward -346 -339 15.28 0.0102
NP_441738.1_2 Reverse -341 -348 15.28 0.0102
NP_441738.1_4 Reverse -329 -348 5.99764 0.203
NP_441558.1_5 Forward -350 -331 7.07928 0.195
NP_441955.1_8 Forward -354 -337 6.82368 0.281
NP_440209.1_1 Reverse -339 -347 18.1123 0.00295
NP_440209.1_1 Forward -348 -340 18.1123 0.00295
NP_442889.1_8 Forward -351 -337 4.12889 0.27
NP_440056.1_1 Forward -353 -334 9.3409 0.263
NP_441713.1_1 Reverse -333 -352 -9.047 0.164
NP_441713.1_1 Reverse -229 -248 -13.0786 0.252
NP_440178.1_7 Forward -349 -330 -19.3717 0.175
NP_442570.1_3 Forward -374 -355 0.491109 0.206
NP_442570.1_3 Forward -251 -232 -9.44032 0.299
NP_439953.1_2 Reverse -291 -309 8.27895 0.266
NP_441598.1_1 Reverse -381 -400 5.89931 0.295
NP_442111.1_3 Reverse -82 -95 15.245 0.2
NP_442111.1_4 Forward -349 -335 12.3893 0.0437
NP_442111.1_4 Reverse -338 -352 11.7993 0.048
NP_440906.1_5 Forward -347 -340 15.8704 0.0124
NP_440906.1_5 Reverse -340 -347 15.8704 0.0124
NP_440747.1_10 Reverse -336 -348 7.70879 0.00236
NP_440747.1_10 Forward -351 -339 7.21714 0.00643
NP_441130.1_8 Reverse -337 -356 13.9625 0.134
NP_441130.1_10 Reverse -337 -351 11.8976 0.104
NP_441130.1_10 Forward -350 -336 10.0294 0.117
NP_441486.1_1 Reverse -336 -350 -5.01529 0.218
NP_441486.1_1 Forward -351 -337 -5.21195 0.226
NP_442634.1_4 Forward -350 -336 6.48943 0.0498
NP_440403.1_4 Reverse -340 -359 -2.0655 0.175
NP_440403.1_4 Forward -357 -338 -4.72043 0.213
NP_440403.1_10 Reverse -381 -400 11.6025 0.177
NP_441014.1_5 Forward -200 -182 10.0489 0.269
NP_441014.1_10 Forward -304 -285 0.686995 0.239
NP_442848.1_1 Reverse -333 -347 6.58777 0.0791
NP_442848.1_9 Forward -354 -335 10.7175 0.157
NP_441012.1_4 Forward -346 -333 10.1474 0.266
NP_443018.1_3 Forward -347 -340 14.8871 0.0123
NP_443018.1_3 Reverse -340 -347 14.8871 0.0123
NP_441316.1_7 Forward -350 -335 -2.77337 0.273
NP_441634.1_8 Forward -350 -336 6.78443 0.114
NP_441634.1_8 Reverse -322 -336 5.1128 0.114
NP_440376.1_1 Forward -348 -339 19.4693 0.000692
NP_440376.1_1 Reverse -339 -348 19.4693 0.000692
NP_442687.1_7 Forward -349 -339 15.8113 0.0125
NP_442687.1_7 Reverse -338 -348 15.8113 0.0125
NP_442687.1_7 Reverse -74 -84 6.07655 0.179
NP_442191.1_4 Forward -347 -333 15.4531 0.0603
NP_442485.1_3 Reverse -322 -341 -0.197208 0.252
NP_442485.1_3 Forward -359 -340 -4.6221 0.285
NP_440642.1_10 Forward -268 -254 5.99717 0.238
NP_441388.1_10 Reverse -379 -396 18.3279 0.12
NP_441422.1_7 Forward -350 -333 27.0799 0.00543
NP_441422.1_8 Reverse -145 -159 19.8624 0.252
NP_441950.1_7 Forward -190 -171 -9.14533 0.293
NP_441763.1_10 Reverse -328 -347 5.01354 0.295
NP_442658.1_1 Reverse -337 -347 18.7607 0.00222
NP_442658.1_1 Forward -350 -340 17.0891 0.00615
NP_442658.1_1 Reverse -355 -365 6.86274 0.214
NP_440141.1_8 Forward -342 -323 16.1257 0.132
NP_440141.1_8 Reverse -135 -154 3.93269 0.296
NP_441855.2_4 Reverse -331 -350 9.81228 0.275
NP_442782.1_2 Forward -348 -334 1.76955 0.281
NP_441414.1_9 Reverse -339 -358 1.0811 0.0762
NP_441414.1_9 Forward -348 -329 -4.52377 0.156
NP_441256.1_1 Forward -345 -326 -6.29373 0.239
NP_442937.1_5 Forward -353 -334 14.2574 0.0802
NP_442937.1_5 Reverse -334 -353 10.6192 0.157
NP_442937.1_5 Forward -314 -295 6.4893 0.278
NP_442937.1_5 Forward -39 -20 6.39097 0.28
NP_441958.1_5 Forward -349 -339 12.2714 0.00183
NP_441958.1_5 Reverse -338 -348 12.2714 0.00183
NP_441162.1_3 Reverse -276 -295 8.55425 0.258
NP_441338.2_5 Forward -130 -111 2.45773 0.299
NP_441338.2_5 Forward -393 -374 2.3594 0.299
NP_442376.1_2 Reverse -334 -353 -12.2919 0.286
NP_442911.1_2 Reverse -329 -348 15.3391 0.0108
NP_442911.1_2 Forward -358 -339 -10.227 0.273
NP_441580.1_6 Reverse -328 -347 -6.88371 0.235
NP_440153.1_5 Reverse -340 -354 9.34103 0.127
NP_440153.1_5 Forward -347 -333 3.04785 0.219
NP_440153.1_8 Reverse -333 -346 5.42749 0.18
NP_442064.1_4 Forward -358 -339 13.3716 0.147
NP_442064.1_4 Reverse -329 -348 11.0117 0.192
NP_442064.1_4 Forward -376 -357 4.52188 0.287
NP_440993.1_2 Forward -353 -337 3.40179 0.259
NP_442210.1_5 Reverse -325 -344 12.9791 0.206
NP_441099.1_3 Forward -196 -177 3.34271 0.279
NP_441099.1_5 Reverse -329 -348 -7.76869 0.18
NP_441099.1_5 Forward -358 -339 -11.9969 0.294
NP_442002.1_9 Reverse -74 -81 12.2322 0.185
NP_442002.1_9 Forward -349 -342 10.7572 0.185
NP_442002.1_9 Reverse -338 -345 10.7572 0.185
NP_441654.1_7 Reverse -85 -104 18.2451 0.145
NP_441646.1_1 Forward -355 -336 5.50599 0.177
NP_441646.1_1 Reverse -287 -306 5.01433 0.184
NP_441646.1_1 Reverse -332 -351 1.37609 0.231
NP_442438.1_10 Reverse -334 -348 21.3374 0.01
NP_442438.1_10 Forward -338 -324 -0.885388 0.283
NP_441000.1_6 Reverse -338 -352 5.80112 0.0933
NP_441000.1_6 Forward -349 -335 -4.03198 0.225
NP_442771.1_1 Forward -350 -332 -6.37237 0.168
NP_442771.1_1 Reverse -337 -355 -9.51896 0.227
NP_440147.1_4 Forward -350 -337 18.1122 0.00478
NP_440147.1_4 Reverse -337 -350 9.75405 0.0371
NP_441550.1_8 Reverse -337 -347 10.501 0.066
NP_441550.1_8 Forward -350 -340 8.82935 0.112
NP_441916.1_7 Forward -348 -338 18.4663 0.00144
NP_441916.1_7 Reverse -339 -349 18.4663 0.00144
NP_441916.1_10 Reverse -269 -288 0.982764 0.27
NP_441041.1_4 Forward -348 -329 11.9958 0.0243
NP_441041.1_7 Reverse -336 -348 16.2608 0.0165
NP_441041.1_7 Forward -351 -339 8.48655 0.135
NP_442642.1_2 Forward -373 -354 16.6174 0.218
NP_442004.1_6 Forward -348 -334 7.57108 0.159
NP_441725.1_4 Forward -353 -339 12.0937 0.0693
NP_441725.1_4 Reverse -58 -72 8.3571 0.201
NP_441725.1_4 Reverse -334 -348 2.94893 0.279
NP_441725.1_5 Forward -347 -337 9.02648 0.0553
NP_441725.1_5 Forward -365 -355 5.09324 0.115
NP_441725.1_5 Reverse -340 -350 2.04498 0.115
NP_439966.1_7 Forward -350 -340 17.9741 0.00631
NP_439966.1_7 Reverse -337 -347 17.4824 0.00636
NP_439966.1_9 Reverse -337 -346 10.7178 0.0863
NP_439966.1_9 Forward -350 -341 0.884706 0.253
NP_442941.1_3 Reverse -340 -350 10.7964 0.0116
NP_442941.1_3 Forward -347 -337 2.53664 0.14
NP_440289.1_2 Forward -351 -338 4.44418 0.0668
NP_440289.1_2 Reverse -336 -349 3.46087 0.078
NP_440983.1_5 Reverse -251 -270 4.42435 0.19
NP_440983.1_5 Reverse -321 -340 -2.95047 0.233
NP_440983.1_5 Reverse -378 -397 -8.65367 0.295
NP_440983.1_9 Reverse -330 -349 -0.000545616 0.295
NP_442281.1_1 Reverse -334 -348 16.5185 0.00772
NP_442281.1_1 Forward -353 -339 11.307 0.0487
NP_440437.1_1 Reverse -242 -261 -2.85214 0.227
NP_442012.1_1 Forward -391 -372 8.84924 0.0986
NP_442012.1_1 Reverse -333 -352 8.06259 0.106
NP_439983.1_7 Forward -386 -368 13.2938 0.206
NP_440723.1_4 Forward -336 -317 -10.1286 0.272
NP_442288.1_3 Forward -273 -256 5.9387 0.28
NP_441556.1_10 Reverse -334 -348 11.2925 0.231
NP_440498.1_1 Reverse -330 -348 -0.570838 0.218
NP_440375.1_8 Reverse -69 -88 4.916 0.193
NP_441644.1_6 Forward -348 -338 10.1076 0.0628
NP_441644.1_6 Reverse -339 -349 10.1076 0.0628
NP_440867.1_3 Forward -346 -327 8.25926 0.266
NP_442029.1_8 Forward -392 -373 16.7157 0.129
NP_442029.1_10 Forward -356 -337 5.01433 0.29
NP_440253.1_2 Reverse -339 -357 -2.0458 0.258
NP_440253.1_2 Forward -348 -330 -3.6191 0.297
NP_440929.1_8 Forward -348 -339 19.2726 0.000701
NP_440929.1_8 Reverse -339 -348 19.2726 0.000701
NP_442933.1_10 Forward -348 -339 17.601 0.00325
NP_442933.1_10 Reverse -339 -348 17.601 0.00325
NP_441751.2_8 Reverse -340 -354 -1.27871 0.129
NP_441751.2_8 Forward -347 -333 -3.04867 0.134
NP_442554.1_8 Forward -347 -337 16.008 0.0065
NP_442554.1_8 Reverse -340 -350 14.1397 0.0144
NP_441762.1_7 Forward -349 -337 21.5735 0.00342
NP_441762.1_7 Reverse -338 -350 12.1337 0.0142
NP_442142.1_4 Reverse -336 -349 17.7182 0.0255
NP_442142.1_4 Forward -351 -338 8.47516 0.113
NP_442292.1_1 Forward -347 -338 9.63616 0.0183
NP_442292.1_1 Reverse -340 -349 9.63616 0.0183
NP_440919.1_7 Forward -277 -259 12.9707 0.148
NP_441024.1_5 Reverse -243 -262 20.9431 0.0975
NP_442476.1_6 Forward -347 -333 10.4227 0.0704
NP_442476.1_6 Reverse -340 -354 1.67122 0.207
NP_442381.1_8 Reverse -336 -355 -5.9004 0.151
NP_443009.1_5 Reverse -338 -349 11.6612 0.0602
NP_443009.1_5 Forward -349 -338 11.6612 0.0602
NP_441715.1_4 Reverse -340 -350 18.8596 0.00741
NP_441715.1_4 Forward -347 -337 9.32148 0.097
NP_440357.1_3 Reverse -346 -365 0.294447 0.285
NP_441448.1_1 Reverse -346 -365 4.22769 0.279
NP_440379.1_5 Reverse -330 -349 -9.53865 0.264
NP_440379.1_5 Forward -342 -323 -11.6036 0.299
NP_441468.1_1 Forward -347 -340 15.8704 0.0124
NP_441468.1_1 Reverse -340 -347 15.8704 0.0124
NP_441020.2_6 Forward -350 -333 12.4285 0.0949
NP_441020.2_6 Reverse -337 -354 11.9369 0.107
NP_441015.1_10 Reverse -334 -353 5.11266 0.116
NP_441673.1_1 Forward -348 -339 20.8459 0.000698
NP_441673.1_1 Reverse -339 -348 20.8459 0.000698
NP_441320.1_4 Forward -343 -324 18.9773 0.194
NP_441956.1_9 Forward -203 -184 5.40766 0.274
NP_441826.1_2 Reverse -333 -347 11.8976 0.0334
NP_441826.1_2 Forward -354 -340 2.94952 0.117
NP_441330.1_1 Forward -353 -334 -3.3438 0.0791
NP_441637.1_9 Forward -92 -74 5.91901 0.245
NP_441637.1_9 Forward -160 -142 -1.94747 0.292
NP_442490.1_9 Forward -348 -329 -1.08219 0.179
NP_442490.1_9 Reverse -327 -346 -8.06369 0.282
NP_442490.1_10 Forward -400 -382 10.0489 0.234
NP_442868.1_6 Forward -350 -340 10.3048 0.038
NP_442868.1_6 Reverse -337 -347 8.53483 0.0555
NP_441612.1_2 Reverse -8 -18 8.83972 0.21
NP_441612.1_2 Reverse -362 -372 6.61303 0.283
NP_442559.1_3 Reverse -298 -317 7.17762 0.296
NP_442808.1_1 Forward -349 -339 18.4657 0.00201
NP_442808.1_1 Reverse -338 -348 18.4657 0.00201
NP_442808.1_1 Reverse -326 -336 3.8145 0.222
NP_442808.1_1 Reverse -186 -196 2.92952 0.252
NP_440145.1_3 Reverse -329 -348 -6.1954 0.292
NP_442542.1_2 Reverse -337 -350 10.4424 0.126
NP_442050.1_5 Reverse -337 -347 8.23937 0.234
NP_442050.1_5 Forward -350 -340 6.96107 0.27
NP_442342.1_9 Forward -350 -334 5.6634 0.233
NP_441048.1_6 Reverse -86 -100 15.5768 0.296
NP_441518.1_3 Reverse -267 -286 -15.3402 0.291
NP_442792.1_5 Forward -207 -190 8.49531 0.296
NP_441878.1_6 Forward -349 -339 10.4031 0.0176
NP_441878.1_6 Reverse -338 -348 10.4031 0.0176
NP_441036.1_8 Forward -349 -339 17.7779 0.000554
NP_441036.1_8 Reverse -338 -348 17.7779 0.000554
NP_442650.1_2 Forward -348 -334 7.17775 0.13
NP_441557.1_5 Forward -348 -339 19.9609 0.000699
NP_441557.1_5 Reverse -339 -348 19.9609 0.000699
NP_441445.1_1 Reverse -330 -349 -0.000545616 0.283
NP_442066.2_4 Reverse -339 -358 -0.0988766 0.172
NP_442066.2_4 Forward -348 -329 -9.047 0.296
NP_442066.2_9 Forward -352 -339 10.8357 0.154
NP_441433.1_8 Forward -271 -252 -1.67217 0.263
NP_442419.1_2 Forward -353 -334 8.55425 0.141
NP_442419.1_2 Reverse -334 -353 2.55606 0.229
NP_441308.1_8 Reverse -337 -347 9.22315 0.226
NP_440101.1_3 Forward -338 -319 2.85105 0.244
NP_440101.1_3 Reverse -334 -353 0.491109 0.298
NP_440101.1_5 Reverse -241 -260 4.42435 0.196
NP_441458.1_10 Forward -357 -338 2.3594 0.269
NP_442183.1_1 Forward -348 -334 16.3225 0.0151
NP_442183.1_1 Reverse -339 -353 12.8809 0.05
NP_441574.1_1 Forward -348 -329 -1.18052 0.215
NP_441574.1_1 Forward -360 -341 -6.58872 0.277
NP_440276.1_8 Forward -374 -355 8.25926 0.27
NP_441549.1_9 Forward -301 -283 -10.6006 0.281
NP_442347.1_2 Forward -347 -338 11.1111 0.056
NP_442347.1_2 Reverse -340 -349 11.1111 0.056
NP_442645.1_2 Reverse -331 -350 -21.3384 0.29
NP_442645.1_4 Reverse -324 -343 4.03102 0.259
NP_442888.1_9 Reverse -327 -346 14.6508 0.206
NP_442888.1_9 Forward -348 -329 13.6675 0.246
NP_441037.1_4 Reverse -337 -347 16.2838 0.0168
NP_441037.1_4 Forward -350 -340 6.92787 0.237
NP_442594.1_8 Forward -114 -95 7.17762 0.214
NP_441633.1_3 Forward -350 -337 22.8321 0.00371
NP_441633.1_3 Reverse -337 -350 3.65753 0.0699
NP_440136.1_2 Forward -347 -340 15.9687 0.0123
NP_440136.1_2 Reverse -340 -347 15.9687 0.0123
NP_442590.1_9 Forward -392 -373 5.11266 0.273
NP_442998.1_5 Forward -98 -88 9.51814 0.238
NP_442998.1_5 Reverse -140 -150 9.41981 0.241
NP_442998.1_5 Forward -260 -250 8.1415 0.271
NP_442998.1_10 Forward -346 -339 15.5754 0.0102
NP_442998.1_10 Reverse -341 -348 15.5754 0.0102
NP_440299.1_1 Reverse -335 -348 19.6848 0.00185
NP_440299.1_1 Forward -352 -339 18.5049 0.00393
NP_441799.1_1 Reverse -335 -349 6.88214 0.158
NP_441799.1_1 Forward -352 -338 5.99717 0.187
NP_441007.1_10 Reverse -334 -347 4.14919 0.182
NP_442334.1_1 Forward -396 -377 -2.75381 0.186
NP_442201.1_10 Forward -359 -340 14.6508 0.0406
NP_440256.1_1 Reverse -336 -355 0.392778 0.0847
NP_440256.1_1 Forward -351 -332 -7.17871 0.231
NP_440087.1_1 Forward -357 -338 -6.58872 0.253
NP_441559.1_8 Forward -353 -339 3.44117 0.143
NP_441559.1_8 Reverse -334 -348 2.5562 0.143
NP_441559.1_8 Forward -328 -314 -7.67023 0.297
NP_441270.1_5 Forward -319 -300 12.4087 0.237
NP_442302.1_6 Forward -396 -377 14.5524 0.27
NP_440915.1_6 Reverse -335 -349 15.2409 0.0183
NP_440915.1_6 Forward -352 -338 12.1926 0.0218
NP_441866.1_6 Forward -274 -255 15.2399 0.159
NP_441704.1_8 Reverse -328 -347 10.0284 0.166
NP_442069.1_7 Reverse -182 -201 14.1583 0.201
NP_440134.1_3 Reverse -13 -32 5.70265 0.263
NP_440748.1_5 Reverse -330 -349 -0.000545616 0.252
NP_440695.1_5 Forward -348 -329 7.66927 0.15
NP_440695.1_5 Reverse -339 -358 -2.0655 0.296
NP_440695.1_6 Reverse -100 -114 10.0235 0.272
NP_441939.1_3 Forward -347 -328 22.5172 0.00342
NP_441939.1_4 Forward -155 -136 17.0449 0.151
NP_441939.1_6 Forward -268 -249 16.1249 0.28
NP_441199.1_6 Reverse -335 -354 8.16093 0.111
NP_441494.1_6 Reverse -334 -347 11.0324 0.225
NP_442386.1_9 Reverse -338 -347 15.7322 0.0144
NP_442386.1_9 Forward -349 -340 15.7322 0.0144
NP_441340.1_5 Forward -347 -340 15.6737 0.0124
NP_441340.1_5 Reverse -340 -347 15.6737 0.0124
NP_441271.1_8 Forward -200 -190 13.7464 0.272
NP_442240.1_2 Reverse -340 -359 -20.8467 0.297
NP_440586.1_1 Forward -355 -336 -3.93378 0.275
NP_440586.1_8 Forward -347 -340 13.2151 0.026
NP_440586.1_8 Reverse -340 -347 13.2151 0.026
NP_440586.1_8 Reverse -325 -332 7.51192 0.239
NP_442251.1_6 Forward -347 -340 15.2804 0.0124
NP_442251.1_6 Reverse -340 -347 15.2804 0.0124
NP_440684.1_9 Forward -354 -340 11.5043 0.173
NP_441262.1_3 Reverse -339 -346 14.7888 0.0223
NP_441262.1_3 Forward -348 -341 14.7888 0.0223
NP_443051.1_1 Reverse -338 -347 10.4228 0.00754
NP_443051.1_1 Forward -349 -340 10.4228 0.00754
NP_439996.1_6 Forward -367 -348 12.4806 0.174
NP_439996.1_6 Forward -319 -300 8.98225 0.242
NP_439937.1_8 Reverse -337 -356 2.26107 0.217
NP_439937.1_8 Forward -350 -331 0.687771 0.235
NP_439937.1_8 Forward -341 -322 -4.03212 0.276
NP_439937.1_9 Forward -349 -332 -0.551837 0.122
NP_439937.1_9 Reverse -338 -355 -10.2866 0.227
NP_440439.1_1 Reverse -336 -349 16.8339 0.0117
NP_440439.1_1 Forward -351 -338 10.1474 0.0374
NP_439943.1_4 Forward -84 -65 3.53937 0.298
NP_440372.1_2 Forward -347 -340 16.3621 0.0124
NP_440372.1_2 Reverse -340 -347 16.3621 0.0124
NP_440819.1_5 Reverse -268 -276 7.8859 0.266
NP_440316.1_10 Forward -393 -383 8.1415 0.24
NP_441803.1_2 Reverse -334 -353 1.57275 0.229
NP_441803.1_2 Forward -353 -334 -1.27885 0.297
NP_439977.1_5 Reverse -333 -352 9.24257 0.0937
NP_439977.1_5 Forward -354 -335 -2.36049 0.277
NP_440139.1_1 Forward -354 -335 12.0933 0.0797
NP_442384.1_10 Reverse -339 -352 19.4888 0.00338
NP_442384.1_10 Forward -348 -335 9.65572 0.0508
NP_442114.1_4 Forward -348 -337 12.1534 0.107
NP_442114.1_4 Reverse -339 -350 9.20345 0.17
NP_441877.1_5 Forward -96 -77 3.73603 0.234
NP_441877.1_7 Forward -353 -334 29.1045 0.000267
NP_442572.1_6 Forward -357 -338 13.3725 0.229
NP_441018.1_7 Forward -352 -333 7.57094 0.269
NP_442790.1_4 Forward -357 -338 20.2556 0.0145
NP_442262.1_10 Forward -347 -340 14.1988 0.0123
NP_442262.1_10 Reverse -340 -347 14.1988 0.0123
NP_440163.1_10 Reverse -330 -340 10.0098 0.213
NP_440344.1_10 Reverse -332 -349 9.67528 0.00822
NP_440344.1_10 Forward -355 -338 0.92382 0.033
NP_440344.1_10 Reverse -241 -258 -12.7442 0.264
NP_442123.1_3 Forward -348 -329 10.0292 0.294
NP_440487.1_1 Forward -260 -241 -4.52377 0.214
NP_442832.1_3 Forward -291 -272 11.6025 0.293
NP_441965.1_10 Forward -351 -335 3.30346 0.266
NP_440297.1_9 Reverse -340 -350 -0.118297 0.282
NP_440297.1_9 Forward -347 -337 -0.216628 0.282
NP_442280.1_10 Forward -87 -69 6.72063 0.268
NP_441896.1_3 Reverse -330 -349 2.45773 0.194
NP_440894.1_10 Forward -353 -334 10.4225 0.155
NP_440894.1_10 Reverse -322 -341 5.99764 0.227
NP_440937.1_5 Reverse -333 -352 9.0459 0.275
NP_442078.1_3 Reverse -364 -383 4.32522 0.189
NP_440999.1_9 Reverse -335 -349 13.6676 0.0299
NP_440999.1_9 Forward -352 -338 3.04785 0.137
NP_440999.1_9 Forward -337 -323 2.2612 0.152
NP_440888.1_2 Forward -348 -334 16.9119 0.00511
NP_440888.1_2 Reverse -339 -353 16.9119 0.00511
NP_440600.1_4 Forward -356 -338 1.59244 0.128
NP_440491.1_1 Reverse -336 -355 7.89159 0.256
NP_440052.1_5 Forward -359 -340 -4.32711 0.254
NP_439969.1_1 Forward -400 -381 -2.95047 0.288
NP_439969.1_7 Forward -336 -318 12.9988 0.253
NP_439969.1_9 Reverse -373 -385 17.4436 0.25
NP_442948.1_2 Forward -349 -330 3.24438 0.292
NP_442033.1_10 Forward -350 -331 -7.08038 0.186
NP_442033.1_10 Reverse -337 -356 -12.6852 0.274
NP_441543.1_2 Forward -347 -338 18.486 0.00236
NP_441543.1_2 Reverse -340 -349 18.486 0.00236
NP_441304.1_10 Forward -175 -166 13.0777 0.255
NP_441918.1_7 Forward -197 -178 -0.787193 0.297
NP_441469.1_4 Forward -312 -293 6.4893 0.286
NP_441469.1_8 Reverse -338 -347 16.126 0.00797
NP_441469.1_8 Forward -349 -340 16.126 0.00797
NP_442578.1_7 Forward -347 -340 14.5921 0.026
NP_442578.1_7 Reverse -340 -347 14.5921 0.026
NP_441462.1_2 Forward -348 -338 11.5831 0.00406
NP_441462.1_2 Reverse -339 -349 11.5831 0.00406
NP_441621.1_7 Forward -350 -336 15.8309 0.0266
NP_441621.1_7 Reverse -337 -351 6.19444 0.068
NP_441621.1_7 Reverse -325 -339 2.65453 0.123
NP_441929.1_7 Forward -121 -102 16.1257 0.166
NP_443062.1_1 Reverse -339 -357 16.3465 0.031
NP_443062.1_1 Forward -348 -330 13.1288 0.0663
NP_443062.1_6 Reverse -331 -350 3.14605 0.243
NP_440349.1_3 Forward -347 -328 13.175 0.25
NP_442204.1_1 Reverse -335 -346 2.41861 0.266
NP_442204.1_1 Forward -352 -341 2.12362 0.266
NP_442204.1_1 Forward -76 -65 0.0586712 0.284
NP_442204.1_5 Reverse -329 -348 5.40766 0.156
NP_440544.1_5 Forward -15 -8 14.5681 0.264
NP_442780.1_2 Reverse -234 -253 15.3391 0.256
NP_440516.1_2 Reverse -229 -247 -1.65248 0.289
NP_440516.1_8 Forward -348 -339 16.9127 0.00442
NP_440516.1_8 Reverse -339 -348 16.9127 0.00442
NP_442428.1_4 Forward -349 -330 5.30933 0.218
NP_442428.1_5 Forward -347 -340 15.8704 0.0124
NP_442428.1_5 Reverse -340 -347 15.8704 0.0124
NP_442823.1_9 Forward -382 -363 13.711 0.277
NP_440673.1_2 Forward -376 -357 12.1455 0.153
NP_440673.1_2 Forward -328 -309 8.1459 0.28
NP_440673.1_3 Forward -346 -339 12.4288 0.0426
NP_440673.1_3 Reverse -341 -348 12.4288 0.0426
NP_440865.1_9 Reverse -333 -352 -8.06369 0.257
NP_441052.1_2 Forward -348 -338 10.5014 0.0285
NP_441052.1_2 Reverse -339 -349 10.5014 0.0285
NP_442219.1_9 Forward -347 -338 8.35786 0.0681
NP_442219.1_9 Reverse -340 -349 8.35786 0.0681
NP_440436.1_4 Forward -347 -338 18.1905 0.00233
NP_440436.1_4 Reverse -340 -349 18.1905 0.00233
NP_441884.1_8 Forward -349 -330 10.4225 0.0541
NP_441884.1_8 Reverse -338 -357 -8.752 0.262
NP_441884.1_9 Reverse -245 -264 -12.6852 0.138
NP_441884.1_9 Reverse -336 -355 -24.0916 0.284
NP_440314.1_9 Reverse -340 -359 3.14605 0.0849
NP_442414.1_2 Forward -315 -296 11.8975 0.22
NP_441719.1_4 Forward -347 -340 16.3621 0.0124
NP_441719.1_4 Reverse -340 -347 16.3621 0.0124
NP_441733.1_10 Reverse -336 -349 17.5222 0.0382
NP_441733.1_10 Forward -351 -338 7.39411 0.153
NP_441004.1_1 Forward -354 -335 -7.17871 0.197
NP_441004.1_2 Forward -395 -376 -2.45882 0.264
NP_441004.1_2 Reverse -346 -365 -4.52377 0.291
NP_441004.1_4 Forward -79 -69 9.61647 0.259
NP_442366.1_3 Reverse -338 -356 2.87075 0.121
NP_442366.1_3 Forward -349 -331 -0.0791831 0.183
NP_442366.1_3 Forward -319 -301 -3.6191 0.253
NP_439949.1_7 Forward -98 -84 13.8643 0.242
NP_440129.1_10 Forward -355 -341 4.32615 0.185
NP_442873.1_3 Reverse -329 -348 3.44025 0.287
NP_440296.1_10 Reverse -336 -355 -9.63698 0.269
NP_441115.1_4 Forward -349 -331 12.4081 0.105
NP_441115.1_4 Reverse -338 -356 9.6548 0.206
NP_442206.1_10 Forward -348 -333 0.0782283 0.274
NP_443054.1_2 Forward -350 -336 10.6193 0.0761
NP_442430.1_10 Reverse -329 -348 10.6184 0.262
NP_440864.1_3 Reverse -381 -400 9.53756 0.297
NP_441851.1_10 Forward -349 -339 16.008 0.00552
NP_441851.1_10 Reverse -338 -348 16.008 0.00552
NP_442622.1_8 Reverse -339 -357 -18.6637 0.243
NP_441542.1_4 Forward -388 -374 3.14618 0.291
NP_442011.1_1 Reverse -338 -357 14.2574 0.16
NP_442856.1_7 Forward -342 -323 9.63589 0.0931
NP_442515.1_1 Reverse -293 -307 -2.55701 0.277
NP_442515.1_1 Reverse -338 -352 -4.03198 0.298
NP_441396.1_5 Forward -104 -95 8.45619 0.224
NP_440593.1_3 Forward -353 -334 -3.04881 0.231
NP_440593.1_3 Forward -365 -346 -6.88371 0.282
NP_440593.1_9 Forward -396 -382 9.63603 0.245
NP_440165.1_5 Reverse -338 -357 3.04771 0.103
NP_440940.1_7 Reverse -329 -347 10.7364 0.128
NP_441349.1_10 Forward -358 -339 -5.9004 0.215
NP_441409.1_7 Forward -124 -105 9.0459 0.274
NP_440389.1_3 Forward -351 -332 12.8808 0.254
NP_442843.1_1 Reverse -340 -359 -4.72043 0.239
NP_442168.1_5 Reverse -124 -143 2.0644 0.232
NP_440588.1_2 Reverse -330 -349 -1.57384 0.155
NP_440588.1_2 Forward -357 -338 -1.67217 0.156
NP_440954.1_1 Forward -190 -171 -11.2103 0.289
NP_440943.1_4 Reverse -67 -79 15.4769 0.181
NP_442006.1_2 Reverse -382 -399 -7.04099 0.169
NP_441570.1_1 Forward -348 -330 -8.33898 0.109
NP_441570.1_1 Reverse -339 -357 -16.2055 0.24
NP_440078.1_10 Forward -348 -329 14.1591 0.147
NP_440078.1_10 Reverse -339 -358 8.55425 0.208
NP_441078.1_4 Forward -348 -339 19.6659 0.0007
NP_441078.1_4 Reverse -339 -348 19.6659 0.0007
NP_442729.1_5 Forward -197 -187 7.74818 0.271
NP_442729.1_8 Forward -352 -339 9.06573 0.125
NP_442729.1_8 Reverse -335 -348 8.37742 0.125
NP_441663.1_8 Forward -354 -335 1.37609 0.212
NP_442348.1_2 Forward -385 -376 6.8829 0.298
NP_440526.1_3 Forward -347 -336 9.49793 0.0826
NP_441432.1_8 Reverse -338 -347 8.25953 0.0755
NP_441432.1_8 Forward -349 -340 8.25953 0.0755
NP_442320.1_8 Reverse -333 -347 8.25939 0.0184
NP_442320.1_8 Forward -354 -340 5.30946 0.0394
NP_442344.1_7 Forward -347 -328 0.392778 0.0945
NP_441732.1_2 Forward -352 -336 -15.0844 0.145
NP_441732.1_2 Reverse -335 -351 -15.8711 0.163
NP_442343.1_8 Reverse -5 -21 17.2657 0.293
NP_440760.1_1 Forward -348 -329 -11.4069 0.0851
NP_440760.1_1 Reverse -339 -358 -20.7484 0.225
NP_440131.1_4 Forward -298 -279 4.81767 0.275
NP_440199.1_10 Reverse -321 -331 6.96153 0.251
NP_440713.1_4 Reverse -329 -348 9.3409 0.15
NP_442489.1_7 Forward -348 -339 20.1576 0.000695
NP_442489.1_7 Reverse -339 -348 20.1576 0.000695
NP_442079.1_7 Forward -347 -328 1.47442 0.251
NP_440559.1_1 Reverse -340 -349 8.75118 0.0586
NP_440559.1_1 Forward -347 -338 8.75118 0.0586
NP_441659.2_8 Forward -348 -338 11.9764 0.0147
NP_441659.2_8 Reverse -339 -349 11.9764 0.0147
NP_442913.1_1 Reverse -357 -376 6.19431 0.247
NP_442913.1_10 Forward -342 -323 -1.7705 0.176
NP_442008.1_2 Reverse -336 -355 6.58763 0.219
NP_442346.1_5 Reverse -323 -333 9.51814 0.118
NP_442346.1_5 Forward -349 -339 9.02648 0.118
NP_442346.1_5 Reverse -338 -348 9.02648 0.118
NP_440352.1_5 Forward -107 -88 16.2572 0.0992
NP_440545.1_3 Reverse -335 -352 7.11867 0.0518
NP_440545.1_3 Forward -352 -335 -0.354483 0.152
NP_440831.1_3 Forward -357 -338 7.55207 0.248
NP_441923.1_8 Forward -373 -359 18.4858 0.148
NP_440486.1_6 Forward -349 -330 5.60432 0.293
NP_441653.1_2 Reverse -328 -347 10.8738 0.119
NP_441653.1_2 Forward -359 -340 5.84883 0.235
NP_440010.1_4 Reverse -329 -348 1.96529 0.227
NP_440010.1_4 Forward -352 -333 -0.689632 0.26
NP_440010.1_4 Reverse -320 -339 -1.47628 0.267
NP_440010.1_4 Forward -343 -324 -1.57461 0.267
NP_442311.1_5 Reverse -370 -389 12.0942 0.201
NP_440847.1_3 Reverse -60 -74 14.6503 0.198
NP_442603.1_7 Reverse -339 -353 8.3571 0.176
NP_441585.1_5 Reverse -366 -385 3.9319 0.252
NP_441888.1_7 Forward -353 -339 22.4191 0.0094
NP_441888.1_7 Reverse -334 -348 3.93283 0.225
NP_441948.1_4 Reverse -332 -350 -1.06249 0.14
NP_441948.1_4 Forward -355 -337 -1.35749 0.146
NP_441047.1_2 Reverse -334 -353 -2.26216 0.273
NP_440170.1_5 Forward -358 -339 16.9124 0.0442
NP_441833.1_4 Forward -347 -340 15.9687 0.0124
NP_441833.1_4 Reverse -340 -347 15.9687 0.0124
NP_442699.1_8 Reverse -133 -152 -11.9969 0.238
NP_442699.1_8 Forward -344 -325 -13.1769 0.284
NP_442162.1_9 Forward -347 -340 16.2637 0.0124
NP_442162.1_9 Reverse -340 -347 16.2637 0.0124
NP_440671.1_4 Reverse -333 -347 11.8976 0.123
NP_442404.1_9 Forward -345 -331 9.6354 0.265
NP_440772.1_8 Forward -354 -335 7.7676 0.269
NP_442073.1_6 Reverse -330 -349 0.196116 0.25
NP_442199.1_5 Reverse -331 -350 -0.688862 0.177
NP_442140.1_3 Forward -347 -337 17.4829 0.0159
NP_442140.1_3 Reverse -340 -350 14.238 0.0486
NP_442140.1_3 Reverse -325 -335 3.42162 0.297
NP_442021.1_3 Forward -354 -335 -6.1954 0.257
NP_441609.1_1 Reverse -239 -258 -1.47551 0.269
NP_440875.1_9 Forward -346 -336 18.3004 0.0104
NP_440875.1_9 Reverse -341 -351 8.46937 0.233
NP_440875.1_9 Reverse -65 -75 7.10665 0.283
NP_441813.1_5 Forward -350 -340 19.4496 0.00647
NP_441813.1_5 Reverse -337 -347 10.0098 0.0208
NP_440594.1_6 Reverse -294 -313 9.7334 0.203
NP_439901.1_1 Forward -76 -57 3.24438 0.268
NP_440590.1_4 Forward -347 -334 13.4906 0.013
NP_440590.1_4 Reverse -340 -353 13.0973 0.013
NP_440590.1_4 Reverse -188 -201 -2.04567 0.235
NP_440567.1_1 Forward -347 -333 11.111 0.0302
NP_440567.1_1 Reverse -340 -354 4.12949 0.129
NP_442497.1_10 Forward -347 -338 10.4228 0.0087
NP_442497.1_10 Reverse -340 -349 10.4228 0.0087
NP_440821.1_4 Reverse -337 -347 18.7612 0.00422
NP_440821.1_4 Forward -350 -340 10.2065 0.0163
NP_441239.1_9 Reverse -337 -349 18.6235 0.0114
NP_441239.1_9 Forward -350 -338 16.7552 0.0157
NP_440156.1_4 Reverse -87 -97 13.5492 0.176
NP_442568.1_5 Reverse -109 -128 16.2241 0.154
NP_440400.1_1 Reverse -300 -319 -3.34455 0.294
NP_441892.1_1 Reverse -330 -347 1.21881 0.155
NP_441892.1_1 Forward -357 -340 -4.77938 0.268
NP_440604.1_6 Forward -348 -329 -5.70374 0.285
NP_441017.1_5 Reverse -106 -125 17.9932 0.293
NP_440354.1_7 Reverse -333 -351 8.08229 0.251
NP_442138.1_10 Reverse -339 -358 -0.590531 0.159
NP_442809.1_6 Reverse -282 -301 3.93269 0.256
NP_440546.1_4 Forward -348 -338 11.8882 0.0679
NP_440546.1_4 Reverse -339 -349 11.8882 0.0679
NP_440546.1_4 Forward -392 -382 7.71902 0.224
NP_440546.1_6 Reverse -329 -348 20.7473 0.0493
NP_440546.1_6 Forward -201 -182 8.25926 0.26
NP_440546.1_6 Forward -343 -324 7.7676 0.267
NP_441230.1_5 Forward -353 -334 4.62101 0.187
NP_441230.1_5 Reverse -378 -397 4.03102 0.188
NP_440462.1_6 Reverse -337 -347 17.9746 0.00578
NP_440462.1_6 Forward -350 -340 17.2863 0.00752
NP_442611.1_1 Reverse -334 -353 -0.000545616 0.265
NP_442611.1_1 Forward -348 -329 -3.04881 0.297
NP_440868.1_4 Reverse -335 -347 9.97041 0.0405
NP_440868.1_4 Forward -352 -340 3.48056 0.135
NP_440812.1_4 Reverse -368 -387 13.9592 0.25
NP_442402.1_2 Forward -18 -4 11.012 0.291
NP_441848.1_7 Reverse -85 -104 5.50519 0.209
NP_441848.1_7 Forward -23 -4 -1.08295 0.245
NP_440653.1_10 Forward -83 -64 3.93269 0.259
NP_442039.1_4 Forward -347 -340 15.1821 0.0124
NP_442039.1_4 Reverse -340 -347 15.1821 0.0124
NP_442039.1_7 Reverse -359 -369 13.943 0.211
NP_441811.1_4 Forward -350 -331 2.16274 0.29
NP_441811.1_8 Forward -309 -295 8.84938 0.228
NP_441811.1_8 Forward -339 -325 5.60446 0.294
NP_440825.1_2 Reverse -230 -249 11.0125 0.107
NP_442837.1_3 Forward -347 -340 15.7721 0.0124
NP_442837.1_3 Reverse -340 -347 15.7721 0.0124
NP_442053.1_1 Forward -348 -339 18.3876 0.0007
NP_442053.1_1 Reverse -339 -348 18.3876 0.0007
NP_440505.1_3 Forward -350 -340 15.9097 0.00857
NP_440505.1_3 Reverse -337 -347 14.1397 0.0235
NP_442360.1_5 Forward -290 -280 12.9597 0.298
NP_441959.1_1 Reverse -112 -130 16.3413 0.228
NP_442532.1_7 Forward -348 -334 8.55439 0.171
NP_442532.1_7 Reverse -339 -353 5.89945 0.171
NP_440914.1_1 Forward -348 -338 8.6151 0.186
NP_440914.1_1 Reverse -339 -349 8.6151 0.186
NP_440914.1_1 Reverse -357 -367 8.12715 0.207
NP_441011.1_8 Forward -347 -338 16.9127 0.00602
NP_441011.1_8 Reverse -340 -349 16.9127 0.00602
NP_442533.1_6 Forward -348 -339 17.2076 0.00137
NP_442533.1_6 Reverse -339 -348 17.2076 0.00137
NP_442232.1_3 Reverse -331 -350 5.60432 0.0823
NP_442232.1_3 Forward -356 -337 -15.9302 0.299
NP_441482.1_7 Reverse -333 -347 10.521 0.0135
NP_441482.1_7 Forward -354 -340 5.1128 0.0417
NP_441482.1_7 Reverse -288 -302 -11.6035 0.275
NP_439944.1_9 Forward -347 -337 10.4031 0.0887
NP_442269.1_10 Forward -365 -346 4.12936 0.248
NP_441028.1_6 Reverse -91 -101 7.35439 0.229
NP_441028.1_6 Forward -13 -3 5.97777 0.234
NP_441028.1_6 Forward -14 -4 3.71617 0.281
NP_442202.1_4 Forward -350 -336 13.417 0.252
NP_440116.1_5 Reverse -336 -353 3.67709 0.225
NP_441527.1_7 Forward -377 -358 7.27514 0.29
NP_440115.1_6 Reverse -336 -346 10.5998 0.115
NP_440115.1_6 Reverse -120 -130 9.12481 0.121
NP_439965.1_1 Reverse -330 -349 -6.68705 0.218
NP_441602.1_3 Forward -353 -334 15.0441 0.054
NP_441602.1_3 Reverse -334 -353 6.39097 0.132
NP_441972.1_5 Forward -359 -340 1.86774 0.125
NP_441972.1_5 Forward -347 -328 -4.32711 0.21
NP_441106.1_1 Reverse -338 -347 18.191 0.0028
NP_441106.1_1 Forward -349 -340 18.191 0.0028
NP_441815.1_2 Reverse -337 -356 11.8967 0.261
NP_442306.1_10 Forward -353 -334 -18.7818 0.197
NP_441286.1_1 Forward -349 -337 5.25052 0.0259
NP_441286.1_1 Forward -367 -355 -0.551008 0.135
NP_441286.1_1 Reverse -338 -350 -3.50094 0.145
NP_440670.1_8 Forward -348 -339 18.3876 0.000699
NP_440670.1_8 Reverse -339 -348 18.3876 0.000699
NP_439955.1_10 Reverse -164 -183 16.1249 0.258
NP_440886.1_7 Forward -349 -339 17.7774 0.0011
NP_440886.1_7 Reverse -338 -348 17.7774 0.0011
NP_440828.1_4 Reverse -323 -342 -7.17944 0.285
NP_441001.1_10 Forward -343 -324 7.37428 0.249
NP_442072.1_9 Forward -349 -331 -5.48739 0.065
NP_442072.1_9 Reverse -338 -356 -23.3836 0.292
NP_440513.1_4 Reverse -339 -358 7.57094 0.295
NP_440907.2_8 Forward -347 -337 17.4824 0.00685
NP_440907.2_8 Reverse -340 -350 7.94438 0.117
NP_442264.1_2 Reverse -329 -346 9.57695 0.196
NP_441021.1_1 Reverse -340 -359 -6.88371 0.181
NP_441463.1_2 Forward -117 -99 7.38667 0.143
NP_441463.1_3 Reverse -329 -348 8.84924 0.0481
NP_441463.1_3 Forward -358 -339 0.392778 0.132
NP_441626.1_2 Forward -347 -340 15.7721 0.0124
NP_441626.1_2 Reverse -340 -347 15.7721 0.0124
NP_442365.1_5 Reverse -340 -359 10.1275 0.192
NP_442365.1_7 Reverse -335 -354 -3.04881 0.21
NP_440107.1_5 Forward -355 -336 -6.68705 0.262
NP_442794.1_1 Forward -352 -340 7.61046 0.136
NP_442794.1_1 Reverse -335 -347 3.48056 0.286
NP_442794.1_5 Reverse -336 -350 12.4876 0.275
NP_442615.1_1 Reverse -330 -348 7.88563 0.0304
NP_442615.1_1 Reverse -66 -84 -6.76569 0.26
NP_441962.1_4 Reverse -334 -353 10.4225 0.0495
NP_441962.1_4 Forward -353 -334 -11.2103 0.238
NP_441962.1_4 Reverse -295 -314 -11.8003 0.245
NP_441962.1_4 Forward -347 -328 -12.1936 0.253
NP_441796.1_8 Forward -325 -307 12.5072 0.199
NP_440387.1_1 Forward -348 -332 13.2349 0.00903
NP_440387.1_1 Reverse -339 -355 9.59664 0.0266
NP_440855.1_3 Forward -90 -71 6.29183 0.274
NP_441431.1_2 Reverse -336 -350 11.7987 0.132
NP_441431.1_2 Forward -351 -337 8.16044 0.222
NP_442020.1_1 Reverse -367 -386 -0.00131823 0.262
NP_441488.1_7 Forward -354 -335 5.80098 0.155
NP_441836.1_2 Forward -354 -335 -1.57384 0.221
NP_441836.1_2 Forward -339 -320 -5.21209 0.275
NP_441993.1_1 Reverse -333 -352 2.23906 0.261
NP_440293.1_3 Reverse -331 -350 -1.96717 0.239
NP_440766.1_4 Reverse -335 -349 17.6992 0.0255
NP_440766.1_4 Forward -352 -338 0.982901 0.259
NP_439988.1_7 Forward -349 -335 12.2903 0.292
NP_440422.1_10 Forward -385 -366 4.11145 0.298
NP_441979.1_5 Forward -354 -335 -2.75381 0.147
NP_442103.1_2 Forward -342 -324 9.35981 0.246
NP_442930.1_1 Reverse -86 -96 10.1076 0.278
NP_442930.1_1 Forward -279 -269 9.71433 0.28
NP_440457.1_1 Reverse -335 -347 6.62715 0.116
NP_440457.1_1 Forward -352 -340 6.33216 0.123
NP_440798.1_6 Forward -347 -334 1.29759 0.224
NP_442680.1_5 Reverse -6 -25 4.56599 0.227
NP_442680.1_5 Reverse -5 -24 -1.19775 0.299
NP_440942.1_3 Forward -265 -246 3.83436 0.298
NP_442509.1_9 Forward -348 -338 16.2041 0.00739
NP_442509.1_9 Reverse -339 -349 16.2041 0.00739
NP_442509.1_9 Forward -257 -247 7.35439 0.225
NP_440554.1_4 Reverse -340 -350 16.4996 0.0189
NP_440554.1_4 Forward -347 -337 13.943 0.0218
NP_442862.1_3 Forward -382 -365 7.41366 0.255
NP_441885.1_5 Forward -348 -338 11.4848 0.00668
NP_441885.1_5 Reverse -339 -349 11.4848 0.00668
NP_440478.1_10 Reverse -337 -351 8.94771 0.257
NP_442341.1_7 Forward -349 -335 20.0591 0.00702
NP_442341.1_7 Reverse -338 -352 12.1926 0.0467
NP_441756.1_5 Reverse -335 -354 -1.18052 0.253
NP_440119.1_1 Reverse -300 -316 2.02515 0.232
NP_442395.2_4 Forward -349 -330 13.0766 0.0711
NP_442395.2_4 Reverse -338 -357 11.2084 0.0919
NP_443000.1_7 Forward -350 -340 11.5831 0.0344
NP_443000.1_7 Reverse -337 -347 2.04498 0.226
NP_440507.2_3 Reverse -330 -349 16.0265 0.0807
NP_440275.1_3 Reverse -337 -347 17.9746 0.0082
NP_440275.1_3 Forward -350 -340 15.418 0.0178
NP_442932.1_9 Reverse -360 -379 7.66927 0.241
NP_440091.1_1 Reverse -335 -347 3.2839 0.163
NP_442275.1_1 Forward -375 -356 2.94938 0.284
NP_441397.1_8 Reverse -4 -17 13.5261 0.245
NP_441122.1_1 Forward -370 -355 4.99478 0.28
NP_441207.1_7 Reverse -269 -283 8.96496 0.282
NP_439962.1_4 Reverse -331 -350 -5.70374 0.28
NP_439962.1_4 Forward -356 -337 -8.94866 0.298
NP_439962.1_4 Forward -341 -322 -9.047 0.298
NP_440804.1_7 Forward -180 -163 13.1161 0.175
NP_442591.1_7 Forward -353 -334 9.63589 0.169
NP_440149.1_8 Forward -348 -329 -1.57384 0.162
NP_441105.1_3 Reverse -328 -347 12.5858 0.033
NP_441105.1_3 Forward -359 -340 5.40766 0.0685
NP_442127.1_5 Forward -396 -377 17.109 0.227
NP_440216.1_1 Reverse -339 -353 7.27608 0.00942
NP_440216.1_1 Forward -348 -334 -2.26202 0.0484
NP_440216.1_9 Reverse -359 -368 7.17789 0.286
NP_440172.1_1 Forward -348 -338 8.73149 0.0586
NP_440172.1_1 Reverse -339 -349 8.73149 0.0586
NP_440249.1_2 Reverse -83 -93 16.4008 0.194
NP_442015.1_10 Forward -352 -339 12.8023 0.0365
NP_442015.1_10 Reverse -335 -348 12.5073 0.0368
NP_442015.1_10 Forward -337 -324 0.510939 0.224
NP_441045.1_6 Reverse -299 -317 14.5713 0.295
NP_441226.1_7 Forward -347 -340 14.4934 0.0123
NP_441226.1_7 Reverse -340 -347 14.4934 0.0123
NP_441111.1_7 Forward -347 -339 18.7023 0.00294
NP_441111.1_7 Reverse -340 -348 18.7023 0.00294
NP_441766.1_2 Forward -348 -339 17.5026 0.00297
NP_441766.1_2 Reverse -339 -348 17.5026 0.00297
NP_441766.1_9 Forward -398 -379 0.392778 0.246
NP_442417.1_5 Reverse -339 -353 19.7641 0.0165
NP_442417.1_5 Forward -237 -223 4.71948 0.291
NP_440416.1_9 Reverse -332 -351 6.09597 0.0331
NP_440416.1_9 Forward -355 -336 -7.37537 0.0996
NP_443052.1_9 Reverse -183 -202 -5.50708 0.271
NP_440591.1_9 Forward -355 -337 16.3421 0.0752
NP_440591.1_9 Reverse -332 -350 12.8022 0.0931
NP_442154.1_1 Forward -317 -299 -18.2704 0.279
NP_440261.1_5 Forward -347 -334 -1.06236 0.0655
NP_440261.1_5 Reverse -340 -353 -11.9771 0.268
NP_440261.1_10 Reverse -2 -16 14.4542 0.207
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTCCCCTGGCCGCTGGGGCATTCTTGCCTAGTTTTGCCATTGTGCTGACTCCGGCGATCGCCGCGGCTATGATGGCCAGTAGTTCCATTGTGGTGGTGTTGAATGCCCTAGCTTTGCGGTATCAATTTTCCCGTTCCCTTGGTCAAGATCCCGGTTAAGGTTCGGCGGGCAAAGAAGTGAACTACCTAAGCTATTTAAATCTCTGGCGAAGCTGGAGGCTTTTTTAGGCGGAATTAGGTTGATTTACCGTCAATTTAGCCCCTGATTTAAGGATTGCTTGGTTAGTTTGGTTAAGATTGATGAGGGTAAATTTTTGATCGTTTGCCCATTGGATCGATTGGGAACTAAACTTCGTCCAGTCTATTTGTCCGTTACCATCCGCTTTTTTTCTCCCCCGGCC

CDS

ATGTCTGATCCCTCGGCAAAACCCCTGCAAGAGCACATTTTGATCATCTTAGATGACGCTGGCCGTCGAGAAGTTTTACTCACTGAAACCTTCTACACCATCGGGCGATCGCCGAGGGCTGATATCCGCATCAAATCCCAATTTGTTTCCCGTATCCATGCGGTGCTGGTGCGTAAATCCTCCGACGATGTACAAGCCGCTTACCGAATTATTGACGGCGATGAAGATGGACAGAGTAGTGTCAATGGACTGATGATTAATGGCAAAAAAGTGCAAGAGCATATCATCCAAACCGGAGACGAAATTGTCATGGGTCCCCAGGTGTCTGTGCGCTACGAGTACCGTCGCCGGGACCAATTTGGTACTATGCCGGGCAACGAACAATTTGATATCACCCTCATTGACCCTGGCATGATTGACGATGAGGAGGAAATTCCTACCTCTGTTTCTTCCTCTCCCCCAGAAATGGAATAA

Protein

MSDPSAKPLQEHILIILDDAGRREVLLTETFYTIGRSPRADIRIKSQFVSRIHAVLVRKSSDDVQAAYRIIDGDEDGQSSVNGLMINGKKVQEHIIQTGDEIVMGPQVSVRYEYRRRDQFGTMPGNEQFDITLIDPGMIDDEEEIPTSVSSSPPEME