Your browser is old and dusty. Try Google Chrome!

Details for slr1949

ORF slr1949
Accession NP_441937.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -75 -89 -0.885388 0.242
NP_440795.1_7 Forward -82 -75 14.6904 0.0123
NP_440795.1_7 Reverse -75 -82 14.6904 0.0123
NP_441418.1_6 Reverse -74 -93 9.63589 0.00264
NP_440897.1_6 Forward -83 -64 9.14342 0.0705
NP_440897.1_6 Reverse -246 -265 4.62021 0.134
NP_441453.1_4 Reverse -74 -82 16.539 0.00633
NP_441453.1_4 Forward -83 -75 16.539 0.00633
NP_442151.1_6 Forward -83 -69 15.7325 0.0214
NP_442151.1_6 Reverse -74 -88 6.19444 0.244
NP_441818.1_6 Forward -90 -76 8.35772 0.274
NP_441818.1_9 Reverse -315 -334 -10.6203 0.296
NP_440226.1_1 Reverse -74 -93 11.8975 0.0496
NP_441630.1_3 Reverse -66 -85 7.27595 0.122
NP_442655.1_2 Reverse -311 -330 4.52268 0.23
NP_443002.1_5 Forward -335 -317 20.5695 0.17
NP_442173.1_1 Forward -82 -74 15.4574 0.00633
NP_442173.1_1 Reverse -75 -83 15.4574 0.00633
NP_442752.1_4 Forward -83 -76 13.8055 0.0199
NP_442752.1_4 Reverse -74 -81 13.8055 0.0199
NP_443027.1_4 Reverse -174 -184 9.02648 0.18
NP_443027.1_4 Forward -85 -75 7.25653 0.24
NP_442975.1_10 Forward -271 -257 4.32555 0.245
NP_442975.1_10 Reverse -70 -84 1.47397 0.297
NP_440784.1_7 Forward -82 -75 15.9687 0.0123
NP_440784.1_7 Reverse -75 -82 15.9687 0.0123
NP_440061.1_9 Forward -85 -71 9.34041 0.148
NP_442062.1_8 Forward -83 -73 17.6796 0.00193
NP_442062.1_8 Reverse -74 -84 10.3048 0.0493
NP_441900.1_2 Forward -334 -316 -5.88141 0.288
NP_440304.1_4 Forward -85 -75 10.8948 0.051
NP_440304.1_4 Reverse -72 -82 9.91146 0.051
NP_442242.1_4 Forward -82 -75 14.3954 0.0124
NP_442242.1_4 Reverse -75 -82 14.3954 0.0124
NP_439918.1_3 Reverse -71 -90 2.45773 0.294
NP_440132.1_1 Reverse -72 -90 19.3903 0.0283
NP_441925.1_2 Forward -267 -248 4.12936 0.262
NP_440856.1_4 Forward -90 -71 1.37609 0.157
NP_441083.1_5 Forward -83 -73 19.3512 0.000718
NP_441083.1_5 Reverse -74 -84 11.2881 0.0159
NP_441434.1_6 Forward -71 -61 14.7297 0.277
NP_441738.1_2 Forward -81 -74 15.28 0.0102
NP_441738.1_2 Reverse -76 -83 15.28 0.0102
NP_441738.1_2 Forward -183 -176 6.03696 0.295
NP_440209.1_1 Reverse -74 -82 18.1123 0.00295
NP_440209.1_1 Forward -83 -75 18.1123 0.00295
NP_442889.1_8 Reverse -71 -85 9.04542 0.105
NP_440447.1_6 Reverse -66 -84 5.23069 0.154
NP_441792.1_1 Forward -337 -318 15.1424 0.117
NP_441327.1_5 Reverse -257 -266 14.356 0.192
NP_442111.1_4 Reverse -73 -87 8.55439 0.0729
NP_442111.1_4 Forward -84 -70 7.17775 0.103
NP_440906.1_5 Forward -82 -75 15.8704 0.0124
NP_440906.1_5 Reverse -75 -82 15.8704 0.0124
NP_440747.1_10 Forward -86 -74 15.2803 0.0019
NP_440747.1_10 Reverse -71 -83 5.44718 0.0137
NP_442973.1_5 Reverse -65 -84 17.6007 0.0736
NP_441486.1_1 Forward -86 -72 6.48943 0.0344
NP_441486.1_1 Reverse -71 -85 -2.16369 0.175
NP_442634.1_4 Reverse -72 -86 6.58777 0.0489
NP_440842.1_6 Reverse -72 -91 10.3234 0.285
NP_440842.1_10 Forward -78 -64 0.786239 0.299
NP_442848.1_9 Forward -341 -322 0.786102 0.265
NP_443018.1_3 Forward -82 -75 14.8871 0.0123
NP_443018.1_3 Reverse -75 -82 14.8871 0.0123
NP_441316.1_7 Reverse -72 -87 14.2379 0.0486
NP_441634.1_8 Reverse -346 -360 -1.67204 0.295
NP_441634.1_8 Reverse -223 -237 -2.06536 0.295
NP_440376.1_1 Forward -83 -74 19.4693 0.000692
NP_440376.1_1 Reverse -74 -83 19.4693 0.000692
NP_441588.1_4 Reverse -76 -86 7.05986 0.178
NP_441588.1_4 Forward -81 -71 6.96153 0.178
NP_442687.1_7 Reverse -73 -83 18.5646 0.0028
NP_442687.1_7 Forward -84 -74 9.02648 0.0994
NP_442191.1_4 Reverse -343 -357 12.7383 0.192
NP_442485.1_3 Forward -94 -75 -5.50708 0.291
NP_440642.1_10 Reverse -65 -79 8.25877 0.208
NP_440642.1_10 Forward -264 -250 1.76896 0.289
NP_440667.1_2 Forward -384 -365 -4.52377 0.249
NP_440360.1_10 Forward -81 -67 3.8345 0.227
NP_442658.1_1 Reverse -72 -82 14.8275 0.0188
NP_442658.1_1 Forward -85 -75 13.0576 0.04
NP_442198.1_4 Forward -34 -15 19.2723 0.169
NP_440141.1_8 Forward -77 -58 5.50599 0.273
NP_441414.1_9 Forward -83 -64 7.47261 0.0344
NP_441958.1_5 Forward -84 -74 21.2195 0.000805
NP_441958.1_5 Reverse -73 -83 20.5312 0.000966
NP_440203.1_5 Reverse -77 -87 11.091 0.205
NP_439905.1_1 Forward -82 -69 8.86907 0.228
NP_440984.1_7 Reverse -69 -83 20.4524 0.00408
NP_440984.1_7 Forward -88 -74 9.43936 0.127
NP_442911.1_2 Reverse -64 -83 -4.13045 0.126
NP_441099.1_5 Forward -93 -74 -11.8986 0.291
NP_442002.1_9 Reverse -73 -80 14.1004 0.074
NP_440809.1_9 Forward -92 -74 -7.65067 0.225
NP_440147.1_4 Forward -85 -72 13.294 0.0326
NP_440147.1_4 Reverse -72 -85 12.704 0.0326
NP_441550.1_8 Reverse -72 -82 17.6791 0.00754
NP_441550.1_8 Forward -85 -75 15.3192 0.0132
NP_441916.1_7 Reverse -74 -84 18.9579 0.00144
NP_441916.1_7 Forward -83 -73 16.893 0.00407
NP_441916.1_10 Forward -77 -58 1.27776 0.268
NP_440465.1_6 Reverse -315 -334 18.6823 0.198
NP_441041.1_4 Reverse -74 -93 -3.14714 0.119
NP_441041.1_4 Reverse -342 -361 -13.3736 0.285
NP_441041.1_7 Forward -86 -74 14.4144 0.0348
NP_441041.1_7 Reverse -71 -83 11.8878 0.0689
NP_442396.1_5 Reverse -70 -83 11.9173 0.0913
NP_442004.1_6 Reverse -74 -88 2.45787 0.264
NP_441725.1_4 Forward -88 -74 3.04726 0.279
NP_441725.1_5 Forward -82 -72 11.7798 0.0247
NP_441725.1_5 Reverse -75 -85 1.94665 0.115
NP_439966.1_7 Forward -85 -75 6.27276 0.185
NP_442941.1_3 Reverse -75 -85 11.0914 0.0116
NP_442941.1_3 Forward -82 -72 2.53664 0.14
NP_440289.1_2 Forward -86 -73 -2.04567 0.251
NP_440289.1_2 Reverse -71 -84 -2.43899 0.255
NP_440260.1_8 Forward -92 -74 -3.02911 0.246
NP_442281.1_1 Forward -88 -74 17.6985 0.00542
NP_442281.1_1 Reverse -69 -83 11.7003 0.0438
NP_442256.1_2 Forward -85 -67 -6.96235 0.214
NP_442256.1_2 Reverse -72 -90 -7.25734 0.214
NP_440647.1_9 Forward -85 -67 5.03403 0.23
NP_440647.1_9 Reverse -72 -90 4.83737 0.23
NP_442012.1_1 Forward -89 -70 11.7008 0.0742
NP_442012.1_1 Forward -122 -103 -0.4922 0.259
NP_440498.1_1 Forward -92 -74 6.214 0.0897
NP_441644.1_6 Reverse -74 -84 19.0557 0.000803
NP_441644.1_6 Forward -83 -73 15.7125 0.0048
NP_442215.1_2 Forward -85 -69 8.12167 0.0666
NP_442215.1_2 Reverse -72 -88 -3.28472 0.213
NP_442215.1_2 Reverse -226 -242 -3.38305 0.214
NP_442215.1_2 Forward -264 -248 -6.92296 0.281
NP_442247.1_8 Forward -85 -71 12.1926 0.247
NP_440929.1_8 Forward -83 -74 19.2726 0.000701
NP_440929.1_8 Reverse -74 -83 19.2726 0.000701
NP_440566.1_2 Reverse -76 -95 11.2092 0.166
NP_442933.1_10 Forward -83 -74 17.601 0.00325
NP_442933.1_10 Reverse -74 -83 17.601 0.00325
NP_441751.2_8 Reverse -75 -89 6.3911 0.0354
NP_442926.1_3 Forward -254 -235 5.01433 0.245
NP_442554.1_8 Reverse -75 -85 16.4013 0.0065
NP_442554.1_8 Forward -82 -72 14.238 0.0144
NP_442970.1_1 Reverse -85 -99 8.89237 0.291
NP_441762.1_7 Reverse -73 -85 8.88877 0.0143
NP_441762.1_7 Forward -84 -72 0.432302 0.0747
NP_442142.1_4 Forward -86 -73 4.93527 0.206
NP_442142.1_4 Reverse -243 -256 4.64028 0.214
NP_442142.1_4 Reverse -71 -84 3.26365 0.262
NP_442142.1_4 Reverse -204 -217 2.57534 0.286
NP_442292.1_1 Reverse -75 -84 17.5026 0.00435
NP_442292.1_1 Forward -82 -73 9.53783 0.0183
NP_442476.1_6 Forward -82 -68 3.53951 0.156
NP_443009.1_5 Forward -84 -73 17.0694 0.00659
NP_443009.1_5 Reverse -73 -84 16.7744 0.00677
NP_441726.1_4 Forward -257 -243 14.3559 0.288
NP_442408.2_1 Reverse -74 -93 -3.04881 0.241
NP_442741.1_8 Forward -93 -75 14.1788 0.276
NP_441715.1_4 Reverse -75 -85 7.35486 0.108
NP_440357.1_3 Reverse -72 -91 9.3409 0.203
NP_441198.1_8 Forward -85 -75 12.783 0.116
NP_441198.1_8 Reverse -72 -82 12.5877 0.12
NP_440379.1_5 Forward -399 -380 -11.5053 0.297
NP_440379.1_6 Reverse -307 -326 7.07928 0.241
NP_441468.1_1 Forward -82 -75 15.8704 0.0124
NP_441468.1_1 Reverse -75 -82 15.8704 0.0124
NP_441020.2_6 Reverse -72 -89 18.2301 0.0133
NP_441020.2_6 Forward -85 -68 16.3618 0.0299
NP_441015.1_10 Forward -251 -232 -11.6036 0.298
NP_441015.1_10 Forward -248 -229 -11.6036 0.298
NP_441673.1_1 Forward -83 -74 20.8459 0.000698
NP_441673.1_1 Reverse -74 -83 20.8459 0.000698
NP_441637.1_9 Forward -217 -199 -1.25915 0.292
NP_442063.1_5 Reverse -289 -308 6.68596 0.273
NP_442868.1_6 Reverse -72 -82 9.12481 0.0539
NP_442868.1_6 Forward -85 -75 0.963343 0.205
NP_442719.1_2 Forward -309 -291 -10.3063 0.272
NP_442719.1_2 Forward -342 -324 -10.4046 0.273
NP_442808.1_1 Reverse -73 -83 8.73102 0.0481
NP_442808.1_1 Forward -84 -74 8.73102 0.0481
NP_442542.1_9 Reverse -285 -299 7.3738 0.198
NP_442050.1_5 Forward -85 -75 9.22267 0.193
NP_442050.1_5 Reverse -72 -82 6.96107 0.27
NP_441937.1_1 Forward -257 -238 21.1406 0.0108
NP_442789.1_4 Reverse -72 -91 -6.39206 0.285
NP_441878.1_6 Reverse -73 -83 20.2362 0.0046
NP_441878.1_6 Forward -84 -74 10.5014 0.0176
NP_441036.1_8 Forward -84 -74 15.713 0.00724
NP_441036.1_8 Reverse -73 -83 8.4365 0.174
NP_441557.1_5 Forward -83 -74 19.9609 0.000699
NP_441557.1_5 Reverse -74 -83 19.9609 0.000699
NP_441557.1_8 Reverse -108 -118 10.9926 0.269
NP_441445.1_1 Forward -92 -73 3.04771 0.22
NP_441590.1_4 Reverse -278 -297 7.57013 0.249
NP_441433.1_8 Reverse -247 -266 13.1758 0.147
NP_440738.1_5 Forward -79 -60 11.8975 0.111
NP_442183.1_1 Reverse -74 -88 10.9143 0.078
NP_442183.1_1 Forward -83 -69 4.03116 0.282
NP_440979.1_3 Reverse -75 -93 12.1139 0.234
NP_441459.1_8 Reverse -67 -80 16.8339 0.286
NP_441574.1_1 Reverse -321 -340 -3.73712 0.243
NP_442347.1_2 Forward -82 -73 3.34298 0.284
NP_442347.1_2 Reverse -75 -84 3.34298 0.284
NP_441037.1_4 Reverse -72 -82 17.3558 0.0127
NP_441037.1_4 Forward -85 -75 15.0168 0.028
NP_441633.1_3 Forward -85 -72 3.46087 0.0699
NP_441633.1_3 Reverse -72 -85 -6.07724 0.236
NP_440136.1_2 Forward -82 -75 15.9687 0.0123
NP_440136.1_2 Reverse -75 -82 15.9687 0.0123
NP_442998.1_5 Reverse -258 -268 14.7297 0.149
NP_442998.1_10 Forward -81 -74 15.5754 0.0102
NP_442998.1_10 Reverse -76 -83 15.5754 0.0102
NP_440299.1_1 Reverse -70 -83 9.75346 0.0661
NP_440299.1_1 Forward -355 -342 3.65697 0.237
NP_440299.1_1 Forward -87 -74 3.46031 0.243
NP_441799.1_1 Reverse -70 -84 17.7968 0.0105
NP_441799.1_1 Forward -87 -73 12.2903 0.0441
NP_441007.1_10 Forward -88 -75 10.5407 0.0656
NP_441007.1_10 Reverse -69 -82 8.86907 0.108
NP_442201.1_10 Reverse -63 -82 -7.76869 0.202
NP_442333.2_5 Reverse -242 -261 -15.1435 0.289
NP_440256.1_1 Forward -86 -67 -0.983855 0.0988
NP_440087.1_1 Forward -92 -73 -8.06369 0.278
NP_440915.1_6 Reverse -70 -84 4.71948 0.0953
NP_440915.1_6 Forward -87 -73 1.86788 0.131
NP_440134.1_2 Reverse -298 -317 3.73603 0.298
NP_441464.1_8 Forward -83 -69 5.89945 0.248
NP_440695.1_5 Reverse -74 -93 -0.590531 0.284
NP_441939.1_3 Forward -82 -63 8.35759 0.175
NP_440677.1_1 Forward -92 -73 12.4875 0.136
NP_440677.1_6 Forward -126 -107 13.2741 0.185
NP_442386.1_9 Forward -84 -75 6.39082 0.219
NP_442386.1_9 Reverse -73 -82 6.39082 0.219
NP_441340.1_5 Forward -82 -75 15.6737 0.0124
NP_441340.1_5 Reverse -75 -82 15.6737 0.0124
NP_439909.1_6 Reverse -248 -267 17.0107 0.234
NP_442484.1_2 Forward -94 -75 3.44104 0.208
NP_440168.1_9 Reverse -72 -91 -2.26216 0.28
NP_440586.1_8 Forward -82 -75 13.2151 0.026
NP_440586.1_8 Reverse -75 -82 13.2151 0.026
NP_442251.1_6 Forward -82 -75 15.2804 0.0124
NP_442251.1_6 Reverse -75 -82 15.2804 0.0124
NP_441262.1_3 Reverse -74 -81 14.7888 0.0223
NP_441262.1_3 Forward -83 -76 14.7888 0.0223
NP_443051.1_1 Forward -84 -75 19.5676 0.00335
NP_443051.1_1 Reverse -73 -82 18.0926 0.00402
NP_441232.1_10 Forward -94 -75 1.76941 0.27
NP_443039.1_7 Forward -335 -321 4.91554 0.248
NP_440439.1_1 Forward -86 -73 11.229 0.0339
NP_440372.1_2 Forward -82 -75 16.3621 0.0124
NP_440372.1_2 Reverse -75 -82 16.3621 0.0124
NP_441803.1_2 Forward -88 -69 2.16274 0.217
NP_441803.1_10 Forward -83 -69 13.2743 0.295
NP_442384.1_10 Forward -83 -70 16.4406 0.00838
NP_442384.1_10 Reverse -74 -87 13.589 0.0195
NP_442790.1_4 Reverse -65 -84 -8.94866 0.176
NP_442262.1_10 Forward -82 -75 14.1988 0.0123
NP_442262.1_10 Reverse -75 -82 14.1988 0.0123
NP_441689.1_5 Forward -85 -75 8.3377 0.132
NP_440344.1_10 Reverse -67 -84 -11.0726 0.2
NP_440344.1_10 Forward -90 -73 -12.9408 0.269
NP_440282.1_10 Forward -93 -74 11.0125 0.0802
NP_440531.1_6 Forward -91 -72 8.45592 0.0844
NP_441060.1_2 Reverse -310 -329 15.5357 0.126
NP_442910.1_1 Forward -90 -71 5.01433 0.118
NP_440189.1_10 Reverse -63 -82 14.9458 0.13
NP_441965.1_10 Reverse -71 -87 12.8416 0.105
NP_442065.1_2 Reverse -103 -116 14.965 0.293
NP_442529.1_4 Forward -92 -73 8.84924 0.255
NP_440297.1_9 Forward -82 -72 9.61647 0.0917
NP_440297.1_9 Reverse -75 -85 -0.216628 0.282
NP_441592.1_4 Forward -83 -64 -4.22878 0.297
NP_440999.1_9 Forward -87 -73 -1.96703 0.254
NP_442892.1_9 Reverse -59 -73 11.5037 0.296
NP_440600.1_4 Reverse -66 -84 -1.35749 0.163
NP_440179.1_6 Reverse -75 -94 9.14423 0.191
NP_440491.1_1 Forward -249 -230 7.01447 0.28
NP_440052.1_5 Reverse -63 -82 2.85105 0.165
NP_441543.1_2 Reverse -75 -84 15.9293 0.00518
NP_441543.1_2 Forward -82 -73 9.34117 0.0818
NP_442845.1_2 Forward -89 -75 4.12949 0.267
NP_441178.1_6 Reverse -243 -262 2.85027 0.27
NP_441469.1_8 Reverse -73 -82 13.3727 0.073
NP_441469.1_8 Forward -84 -75 6.5879 0.227
NP_443064.1_6 Forward -83 -73 13.8273 0.0796
NP_443064.1_6 Reverse -74 -84 10.8217 0.13
NP_442578.1_7 Forward -82 -75 14.5921 0.026
NP_442578.1_7 Reverse -75 -82 14.5921 0.026
NP_440710.1_1 Forward -91 -73 -8.33898 0.262
NP_441462.1_2 Reverse -74 -84 20.2362 0.000805
NP_441462.1_2 Forward -83 -73 20.1379 0.000967
NP_441621.1_7 Reverse -72 -86 2.65453 0.123
NP_443062.1_1 Reverse -74 -92 7.18082 0.182
NP_443062.1_6 Forward -91 -72 1.86774 0.266
NP_442204.1_1 Forward -87 -76 8.4168 0.0945
NP_442204.1_5 Reverse -64 -83 7.86593 0.125
NP_440516.1_8 Forward -83 -74 16.9127 0.00442
NP_440516.1_8 Reverse -74 -83 16.9127 0.00442
NP_442428.1_5 Forward -82 -75 15.8704 0.0124
NP_442428.1_5 Reverse -75 -82 15.8704 0.0124
NP_440673.1_3 Forward -81 -74 12.4288 0.0426
NP_440673.1_3 Reverse -76 -83 12.4288 0.0426
NP_441052.1_2 Forward -83 -73 10.4031 0.0285
NP_441052.1_2 Reverse -74 -84 10.4031 0.0285
NP_442219.1_9 Forward -82 -73 8.25953 0.0681
NP_442219.1_9 Reverse -75 -84 8.25953 0.0681
NP_440436.1_4 Forward -82 -73 15.9289 0.00508
NP_440436.1_4 Reverse -75 -84 9.24241 0.0871
NP_441884.1_9 Reverse -71 -90 -16.7168 0.138
NP_441719.1_4 Forward -82 -75 16.3621 0.0124
NP_441719.1_4 Reverse -75 -82 16.3621 0.0124
NP_441733.1_10 Forward -86 -73 4.05085 0.276
NP_441004.1_1 Reverse -68 -87 -13.0786 0.253
NP_441004.1_1 Reverse -321 -340 -14.7502 0.27
NP_442813.1_4 Forward -303 -284 -2.16383 0.262
NP_442813.1_4 Reverse -58 -77 -4.81876 0.299
NP_442813.1_4 Forward -264 -245 -5.60541 0.299
NP_442366.1_3 Forward -38 -20 -4.70074 0.275
NP_442366.1_3 Reverse -73 -91 -5.58572 0.289
NP_442366.1_5 Reverse -71 -81 15.4175 0.0374
NP_442366.1_5 Forward -86 -76 14.0409 0.0497
NP_440296.1_10 Reverse -71 -90 -5.21209 0.223
NP_440296.1_10 Forward -86 -67 -14.6519 0.27
NP_441115.1_4 Forward -84 -66 14.8663 0.0484
NP_442206.1_10 Reverse -74 -89 16.0078 0.0799
NP_440328.1_4 Reverse -68 -87 12.6841 0.0513
NP_440328.1_4 Forward -89 -70 -0.688862 0.286
NP_443054.1_2 Forward -85 -71 -0.492064 0.295
NP_442430.1_7 Forward -152 -133 15.8814 0.273
NP_441851.1_10 Reverse -73 -83 17.4829 0.0027
NP_441851.1_10 Forward -84 -74 8.53483 0.114
NP_441668.1_4 Reverse -64 -83 -0.197208 0.249
NP_442515.1_1 Forward -84 -70 7.57108 0.0906
NP_442515.1_1 Reverse -73 -87 -2.75368 0.279
NP_441396.1_2 Forward -313 -296 9.5762 0.107
NP_441396.1_5 Reverse -319 -328 8.25953 0.224
NP_441982.1_6 Reverse -88 -97 14.1087 0.274
NP_440432.1_9 Reverse -75 -90 -0.315096 0.164
NP_440432.1_9 Forward -82 -67 -0.413427 0.164
NP_442843.1_1 Forward -254 -235 -10.3253 0.277
NP_442450.1_5 Reverse -72 -82 17.3846 0.0267
NP_442450.1_5 Forward -85 -75 7.64985 0.13
NP_440588.1_2 Reverse -65 -84 -0.4922 0.15
NP_442006.1_2 Reverse -333 -350 -8.12263 0.192
NP_442006.1_2 Reverse -252 -269 -18.644 0.294
NP_441570.1_1 Reverse -74 -92 0.0191479 0.0424
NP_440078.1_4 Reverse -63 -82 12.9791 0.19
NP_441078.1_4 Forward -83 -74 19.6659 0.0007
NP_441078.1_4 Reverse -74 -83 19.6659 0.0007
NP_442729.1_7 Reverse -7 -25 8.18062 0.276
NP_442729.1_8 Reverse -70 -83 10.934 0.125
NP_442388.1_4 Forward -328 -309 11.7 0.23
NP_441528.1_2 Forward -345 -326 9.34008 0.258
NP_441663.1_8 Forward -89 -70 4.81767 0.158
NP_441663.1_8 Reverse -68 -87 -3.73712 0.295
NP_440526.1_3 Forward -82 -71 1.72983 0.267
NP_441432.1_8 Forward -84 -75 16.8143 0.00595
NP_441432.1_8 Reverse -73 -82 8.35786 0.0755
NP_442344.1_7 Forward -82 -63 -7.4737 0.183
NP_442344.1_7 Reverse -75 -94 -9.34199 0.249
NP_441732.1_2 Forward -87 -71 -7.80794 0.0935
NP_440760.1_1 Forward -83 -64 -12.3902 0.0929
NP_441805.1_1 Forward -74 -55 -3.93378 0.227
NP_442727.1_1 Reverse -314 -328 16.3225 0.195
NP_442489.1_7 Forward -83 -74 20.1576 0.000695
NP_442489.1_7 Reverse -74 -83 20.1576 0.000695
NP_442079.1_7 Reverse -75 -94 0.0977854 0.287
NP_440559.1_1 Forward -82 -73 17.306 0.00658
NP_440559.1_1 Reverse -75 -84 8.65285 0.0586
NP_441659.2_8 Reverse -74 -84 20.9245 0.000805
NP_441659.2_8 Forward -83 -73 19.3512 0.000966
NP_440426.1_7 Reverse -229 -248 3.53937 0.207
NP_442913.1_10 Reverse -65 -84 2.45773 0.125
NP_441040.1_2 Reverse -65 -84 -14.8485 0.286
NP_442776.1_1 Forward -329 -310 3.6377 0.279
NP_442776.1_6 Forward -85 -66 15.4374 0.11
NP_440779.1_5 Forward -83 -66 -5.46769 0.149
NP_442346.1_5 Reverse -73 -83 17.9746 0.00128
NP_442346.1_5 Forward -84 -74 16.303 0.00248
NP_440352.1_5 Reverse -248 -267 19.372 0.0454
NP_440352.1_5 Forward -81 -62 14.1158 0.16
NP_440545.1_2 Forward -185 -166 12.8055 0.296
NP_440545.1_3 Forward -87 -70 -2.12444 0.179
NP_440545.1_3 Reverse -70 -87 -2.22277 0.181
NP_441856.1_3 Reverse -71 -90 -2.95047 0.272
NP_440025.1_3 Reverse -273 -287 11.0948 0.29
NP_440010.1_10 Forward -95 -76 1.86774 0.292
NP_442603.1_7 Forward -83 -69 8.75042 0.166
NP_441585.1_5 Forward -325 -306 0.195343 0.291
NP_440449.1_6 Reverse -66 -84 21.0946 0.0221
NP_441948.1_4 Reverse -67 -85 -4.01242 0.214
NP_439970.1_4 Reverse -25 -44 3.53937 0.205
NP_441358.1_2 Forward -121 -102 10.2259 0.244
NP_441833.1_4 Forward -82 -75 15.9687 0.0124
NP_441833.1_4 Reverse -75 -82 15.9687 0.0124
NP_443040.1_1 Forward -70 -56 9.60413 0.3
NP_441895.1_10 Reverse -294 -313 -27.8282 0.299
NP_442162.1_9 Forward -82 -75 16.2637 0.0124
NP_442162.1_9 Reverse -75 -82 16.2637 0.0124
NP_443026.1_5 Forward -110 -91 -0.983855 0.283
NP_442943.1_1 Forward -139 -124 12.7717 0.124
NP_440772.1_6 Reverse -75 -94 11.4058 0.212
NP_442140.1_3 Forward -82 -72 13.5497 0.0542
NP_442140.1_3 Reverse -75 -85 6.66654 0.159
NP_440875.1_9 Reverse -76 -86 8.37203 0.233
NP_441813.1_5 Reverse -72 -82 8.82982 0.0367
NP_441813.1_5 Forward -85 -75 8.63316 0.0367
NP_440594.1_6 Forward -342 -323 4.91521 0.286
NP_442254.1_1 Forward -267 -248 0.786102 0.249
NP_440590.1_4 Forward -82 -69 -0.472371 0.189
NP_440567.1_1 Forward -82 -68 11.7993 0.0267
NP_440567.1_1 Reverse -75 -89 11.0127 0.0305
NP_442497.1_10 Forward -82 -73 19.8626 0.00532
NP_442497.1_10 Reverse -75 -84 17.601 0.00813
NP_440821.1_4 Reverse -72 -82 10.9931 0.0146
NP_440821.1_4 Forward -85 -75 2.24165 0.131
NP_441239.1_9 Forward -85 -73 14.6903 0.0258
NP_441239.1_9 Reverse -72 -84 10.7571 0.0723
NP_440156.1_4 Forward -269 -259 13.2542 0.176
NP_441892.1_1 Forward -92 -75 1.02215 0.158
NP_440604.1_6 Forward -83 -64 3.14605 0.133
NP_442193.1_1 Reverse -309 -327 15.7521 0.177
NP_442629.1_5 Reverse -316 -330 17.4042 0.156
NP_442216.1_4 Reverse -279 -287 8.1805 0.255
NP_441936.1_1 Reverse -79 -98 17.994 0.105
NP_441936.1_3 Reverse -148 -167 18.7798 0.048
NP_442138.1_10 Reverse -74 -93 2.26107 0.12
NP_442052.1_8 Reverse -72 -82 12.7631 0.253
NP_440546.1_4 Reverse -74 -84 13.5365 0.0459
NP_440546.1_4 Forward -83 -73 12.8578 0.0572
NP_440462.1_4 Reverse -314 -328 7.37441 0.278
NP_440462.1_6 Forward -85 -75 10.5014 0.0396
NP_440462.1_6 Reverse -174 -184 3.22496 0.255
NP_440462.1_6 Reverse -72 -82 1.455 0.294
NP_440868.1_4 Forward -87 -75 15.1819 0.0164
NP_440868.1_4 Reverse -70 -82 1.41561 0.183
NP_441474.1_1 Forward -93 -74 6.48849 0.212
NP_441848.1_7 Forward -272 -253 -4.62285 0.296
NP_442882.1_7 Reverse -67 -81 16.9119 0.24
NP_442023.1_3 Reverse -294 -313 15.3382 0.159
NP_442039.1_4 Forward -82 -75 15.1821 0.0124
NP_442039.1_4 Reverse -75 -82 15.1821 0.0124
NP_440753.1_5 Forward -318 -299 11.8975 0.147
NP_442679.1_1 Reverse -287 -306 -1.18052 0.226
NP_440825.1_7 Forward -82 -72 11.8361 0.2
NP_442837.1_3 Forward -82 -75 15.7721 0.0124
NP_442837.1_3 Reverse -75 -82 15.7721 0.0124
NP_440160.1_3 Reverse -240 -259 8.4551 0.282
NP_442053.1_1 Forward -83 -74 18.3876 0.0007
NP_442053.1_1 Reverse -74 -83 18.3876 0.0007
NP_440505.1_3 Forward -85 -75 8.04317 0.147
NP_440505.1_7 Reverse -67 -86 2.0644 0.237
NP_442360.1_5 Reverse -68 -78 12.7631 0.298
NP_440914.1_1 Reverse -74 -84 16.3248 0.00196
NP_440914.1_1 Forward -83 -73 8.51751 0.186
NP_440914.1_2 Reverse -321 -340 17.6007 0.255
NP_441011.1_8 Reverse -75 -84 16.6177 0.00602
NP_441011.1_8 Forward -82 -73 14.356 0.0249
NP_442533.1_6 Forward -83 -74 17.2076 0.00137
NP_442533.1_6 Reverse -74 -83 17.2076 0.00137
NP_441089.1_10 Forward -94 -75 6.39097 0.214
NP_442322.1_4 Reverse -222 -239 -9.69657 0.296
NP_442229.1_1 Forward -85 -71 7.57046 0.196
NP_443016.1_1 Forward -89 -70 5.211 0.13
NP_441482.1_7 Forward -89 -75 -3.24533 0.115
NP_441482.1_7 Reverse -68 -82 -10.8168 0.216
NP_439944.1_9 Reverse -75 -85 9.12481 0.1
NP_439944.1_9 Forward -82 -72 8.82982 0.101
NP_441028.1_4 Forward -216 -202 13.0776 0.274
NP_441028.1_6 Forward -265 -255 5.38779 0.255
NP_441028.1_6 Forward -264 -254 3.71617 0.281
NP_441527.1_4 Reverse -186 -205 -8.26048 0.242
NP_441527.1_4 Reverse -293 -312 -9.02441 0.254
NP_440115.1_6 Forward -86 -76 7.35486 0.147
NP_441680.1_4 Reverse -244 -263 8.16093 0.16
NP_441106.1_1 Forward -84 -75 18.486 0.0028
NP_441106.1_1 Reverse -73 -82 9.73449 0.0311
NP_439903.1_6 Forward -86 -67 1.96529 0.236
NP_439903.1_6 Reverse -71 -90 -0.689632 0.284
NP_439903.1_6 Reverse -92 -111 -1.08295 0.292
NP_442306.1_10 Forward -88 -69 -21.1417 0.247
NP_441286.1_1 Forward -84 -72 6.03717 0.0258
NP_441286.1_1 Reverse -73 -85 -3.50094 0.145
NP_440670.1_8 Forward -83 -74 18.3876 0.000699
NP_440670.1_8 Reverse -74 -83 18.3876 0.000699
NP_442477.1_7 Forward -26 -7 17.6007 0.061
NP_440886.1_7 Forward -84 -74 8.04271 0.0805
NP_440886.1_7 Reverse -73 -83 8.04271 0.0805
NP_440083.1_2 Reverse -78 -97 0.58944 0.246
NP_442614.1_2 Forward -83 -69 9.14437 0.242
NP_442072.1_9 Reverse -73 -91 -20.7287 0.204
NP_440907.2_8 Forward -82 -72 16.2041 0.0161
NP_440907.2_8 Reverse -75 -85 15.9091 0.0161
NP_440907.2_8 Forward -334 -324 4.99446 0.228
NP_441463.1_3 Forward -93 -74 -1.57384 0.143
NP_442842.1_10 Forward -312 -293 6.87253 0.207
NP_441626.1_2 Forward -82 -75 15.7721 0.0124
NP_441626.1_2 Reverse -75 -82 15.7721 0.0124
NP_442209.1_1 Forward -53 -34 7.47261 0.182
NP_442794.1_1 Forward -87 -75 2.69391 0.286
NP_442615.1_1 Reverse -65 -83 22.8319 0.00292
NP_442615.1_1 Forward -92 -74 11.1305 0.0184
NP_440387.1_1 Reverse -74 -90 13.4315 0.00865
NP_440387.1_1 Forward -83 -67 -2.5964 0.148
NP_440387.1_1 Forward -291 -275 -5.448 0.232
NP_441431.1_2 Forward -86 -72 14.1586 0.0714
NP_441431.1_2 Reverse -71 -85 6.58715 0.266
NP_441836.1_1 Forward -94 -75 14.5187 0.185
NP_440114.1_10 Forward -83 -69 13.0776 0.0662
NP_440114.1_10 Reverse -74 -88 8.84938 0.192
NP_441510.2_9 Reverse -75 -94 21.1406 0.0295
NP_439988.1_7 Forward -81 -67 12.487 0.292
NP_441237.1_6 Forward -285 -268 3.87375 0.262
NP_441237.1_9 Forward -82 -72 17.188 0.00445
NP_441311.1_2 Forward -89 -75 13.6669 0.229
NP_441311.1_2 Reverse -68 -82 13.077 0.23
NP_442930.1_1 Forward -269 -259 10.6976 0.276
NP_440457.1_1 Reverse -322 -334 4.8572 0.151
NP_440457.1_1 Reverse -70 -82 1.02229 0.248
NP_440798.1_6 Forward -82 -69 5.32916 0.14
NP_440798.1_6 Reverse -75 -88 1.39592 0.217
NP_441801.1_4 Reverse -280 -290 3.12662 0.231
NP_442509.1_9 Forward -83 -73 17.3841 0.00128
NP_442509.1_9 Reverse -74 -84 8.04271 0.192
NP_440554.1_4 Reverse -75 -85 8.82982 0.0646
NP_441885.1_5 Forward -83 -73 11.3864 0.00668
NP_441885.1_5 Reverse -74 -84 11.3864 0.00668
NP_442341.1_7 Forward -84 -70 3.93283 0.208
NP_442341.1_7 Reverse -73 -87 2.5562 0.252
NP_442341.1_9 Forward -85 -71 11.602 0.122
NP_442341.1_9 Reverse -72 -86 8.55376 0.168
NP_443000.1_7 Forward -85 -75 10.6981 0.0345
NP_443000.1_7 Reverse -72 -82 2.04498 0.226
NP_440507.2_1 Reverse -271 -290 23.9922 0.0291
NP_441842.1_10 Reverse -67 -81 16.3225 0.0311
NP_441842.1_10 Forward -90 -76 6.19444 0.297
NP_440275.1_3 Reverse -72 -82 9.91146 0.046
NP_440275.1_3 Forward -85 -75 9.02648 0.0563
NP_440679.1_10 Reverse -76 -95 -17.7985 0.275
NP_440216.1_1 Forward -83 -69 7.37441 0.00942
NP_440216.1_1 Reverse -74 -88 -2.45868 0.0513
NP_440216.1_9 Forward -73 -64 5.80125 0.289
NP_440172.1_1 Reverse -74 -84 17.5813 0.00421
NP_440172.1_1 Forward -83 -73 16.303 0.00854
NP_442015.1_10 Forward -87 -74 2.37923 0.193
NP_442015.1_10 Reverse -70 -83 2.2809 0.196
NP_441226.1_7 Forward -82 -75 14.4934 0.0123
NP_441226.1_7 Reverse -75 -82 14.4934 0.0123
NP_441757.1_3 Reverse -73 -92 11.7008 0.08
NP_441111.1_7 Forward -82 -74 18.7023 0.00294
NP_441111.1_7 Reverse -75 -83 18.7023 0.00294
NP_442379.1_10 Forward -90 -73 -2.12444 0.224
NP_441766.1_2 Forward -83 -74 17.5026 0.00297
NP_441766.1_2 Reverse -74 -83 17.5026 0.00297
NP_442417.1_5 Reverse -74 -88 7.17775 0.195
NP_440416.1_9 Reverse -67 -86 -16.7168 0.22
NP_442564.1_10 Reverse -283 -297 9.14437 0.296
NP_440261.1_5 Forward -82 -69 8.86907 0.0244
NP_440261.1_5 Reverse -75 -88 -1.06236 0.0655
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGCTGGAACTAGAATGGCGGCTAGGTAACCTTCGTTAAAGGACTCCACGTCCATATCTGCTTTGTCCGATTCCACCACCAAGACAGTTTCACCTTTTTCCACTTTGTCGCCGGGGGACTTAGTCCAAGAAACAATTTTCCCCTCGGTCATGGTGGAACTCAGGGCGGGCATGAAAATGTCGTAAATCATGGTGGTTTTATCTCTTAAATCTCTTGTAGATCCCTTGGAATACAGCGGATTAGGACTGCGGAAGACCGTTCAAATTCTATCAGATTTCTGCCGGGGGGTTAGTTAAGGAGCACTTTTCGACCATCTAGGCGATCGCCCAAAGGAAAATGTCAAAATGGGTTAGGATTATCCAGATCCATTGTTGATCAGTCAAGAAAATAGCAAACTGCC

CDS

ATGACCTCCTATTCCTCTGCAACGGCCCGCGCTGAAATGAGTGAACTGCGGCGCTTGAAAAGTTTACTGCCGCCGGAACTCCAAAGTTGGGTAATGGTGGAAGGCAGTACCGAAGTTAATCCCCCTCTGATCCGTTCGGAAGAATTGGGGCGGGATGAGATTGAAATTCAGGTGGATTTGGCCAAATGGGAAAACCTGGCCATTGACCAGCGGAATTTACTCTTTTGGCACGAAGTGGCCCGCATTCAGAGTGATACCATTCCCCGGGAAGGTTGGGAAATGGCTGCCTTGGCGATCGGTTTGGGGGGTGCAGTGGGGGAACTGTGGGTGCAAGATGGATTGCTCTTACTTTTAGCCCTGGGATTATGTGGCATTTCTGGCTACCGGCTCTGGCAAAAAAATAACGGTGAAAAACGGATCAAAGAGGCGATCGAGGCGGATGAAAAGGCCATTACCCTGGCTACCCGTTTCGGCTATACCTTGCCTAATGCCTACAAAAGTCTTGGCAGTGCTTTCAAAACATTAATCGAACAAACCCCCAACCGTCGTCAACGCAAACAGTATGAAACCCGTCTCCAAGCCCTGCGCCAAAGTGCAGCCAAAATGAAAGCTAAAACCCAAAAGGCCAAGGCTCTCTAA

Protein

MTSYSSATARAEMSELRRLKSLLPPELQSWVMVEGSTEVNPPLIRSEELGRDEIEIQVDLAKWENLAIDQRNLLFWHEVARIQSDTIPREGWEMAALAIGLGGAVGELWVQDGLLLLLALGLCGISGYRLWQKNNGEKRIKEAIEADEKAITLATRFGYTLPNAYKSLGSAFKTLIEQTPNRRQRKQYETRLQALRQSAAKMKAKTQKAKAL