Your browser is old and dusty. Try Google Chrome!

Details for slr1915

ORF slr1915
Accession NP_440459.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -375 -389 1.76955 0.183
NP_440795.1_7 Forward -382 -375 14.6904 0.0123
NP_440795.1_7 Reverse -375 -382 14.6904 0.0123
NP_442100.1_1 Forward -203 -184 8.83258 0.24
NP_441418.1_6 Reverse -374 -393 -9.24366 0.0278
NP_441418.1_6 Forward -383 -364 -11.1119 0.0445
NP_442291.1_5 Reverse -373 -389 8.41667 0.0558
NP_441453.1_4 Reverse -374 -382 16.539 0.00633
NP_441453.1_4 Forward -383 -375 16.539 0.00633
NP_441453.1_7 Reverse -253 -260 12.9205 0.23
NP_441453.1_8 Forward -317 -300 11.2486 0.217
NP_440561.1_1 Forward -327 -308 9.83173 0.284
NP_441818.1_1 Reverse -375 -386 9.79292 0.232
NP_441818.1_1 Forward -382 -371 8.90795 0.271
NP_440226.1_1 Forward -383 -364 14.1591 0.0325
NP_440226.1_1 Reverse -374 -393 12.0942 0.0476
NP_440150.1_6 Forward -386 -367 12.9791 0.106
NP_440150.1_6 Reverse -371 -390 8.84924 0.19
NP_440996.1_3 Reverse -15 -33 11.3272 0.232
NP_442287.1_1 Reverse -246 -256 15.2208 0.22
NP_442173.1_1 Forward -382 -374 15.4574 0.00633
NP_442173.1_1 Reverse -375 -383 15.4574 0.00633
NP_442752.1_4 Forward -383 -376 13.8055 0.0199
NP_442752.1_4 Reverse -374 -381 13.8055 0.0199
NP_443027.1_4 Reverse -372 -382 11.8781 0.0872
NP_443027.1_4 Forward -385 -375 11.0914 0.107
NP_441812.1_3 Forward -384 -370 6.88276 0.287
NP_442975.1_10 Reverse -370 -384 4.22722 0.245
NP_441470.1_4 Reverse -181 -200 13.4708 0.162
NP_441225.1_4 Forward -387 -368 -12.1936 0.284
NP_441675.1_4 Reverse -185 -204 4.32602 0.257
NP_440784.1_7 Forward -382 -375 15.9687 0.0123
NP_440784.1_7 Reverse -375 -382 15.9687 0.0123
NP_442861.1_1 Reverse -146 -165 9.83255 0.295
NP_441250.1_3 Reverse -183 -202 5.211 0.241
NP_440061.1_9 Reverse -372 -386 19.6651 0.00478
NP_440061.1_9 Forward -385 -371 14.7486 0.0595
NP_441054.1_4 Reverse -364 -382 12.1139 0.0619
NP_440774.1_4 Forward -299 -280 11.4058 0.279
NP_442062.1_3 Reverse -183 -202 -1.27885 0.256
NP_442062.1_8 Forward -383 -373 19.4496 0.000558
NP_442062.1_8 Reverse -374 -384 17.3846 0.00193
NP_441859.1_3 Reverse -373 -392 5.01354 0.209
NP_441859.1_7 Reverse -370 -389 3.83436 0.278
NP_441802.1_1 Reverse -256 -275 3.93269 0.298
NP_440304.1_4 Forward -385 -375 1.84832 0.299
NP_440304.1_4 Reverse -372 -382 1.84832 0.299
NP_442242.1_4 Forward -382 -375 14.3954 0.0124
NP_442242.1_4 Reverse -375 -382 14.3954 0.0124
NP_441619.1_2 Reverse -247 -266 18.5831 0.177
NP_441208.1_9 Forward -386 -372 5.99778 0.254
NP_440370.1_10 Forward -392 -373 8.06259 0.243
NP_441546.1_2 Forward -123 -104 17.3057 0.244
NP_441082.1_10 Forward -261 -248 10.344 0.236
NP_441925.1_2 Forward -117 -98 -0.0988766 0.298
NP_440769.1_8 Reverse -44 -63 11.5042 0.171
NP_441083.1_5 Reverse -374 -384 20.3345 0.00053
NP_441083.1_5 Forward -383 -373 11.3864 0.0159
NP_441434.1_1 Forward -150 -136 9.7518 0.238
NP_441434.1_3 Reverse -71 -90 18.0924 0.0436
NP_441434.1_8 Forward -163 -144 15.6058 0.122
NP_441738.1_2 Forward -381 -374 15.28 0.0102
NP_441738.1_2 Reverse -376 -383 15.28 0.0102
NP_441738.1_2 Forward -266 -259 6.23363 0.264
NP_441558.1_5 Forward -385 -366 17.699 0.0191
NP_441558.1_5 Forward -318 -299 8.25926 0.155
NP_440209.1_1 Reverse -374 -382 18.1123 0.00295
NP_440209.1_1 Forward -383 -375 18.1123 0.00295
NP_442889.1_8 Reverse -371 -385 5.89884 0.211
NP_441713.1_1 Forward -389 -370 -14.4552 0.259
NP_441713.1_1 Reverse -368 -387 -14.9469 0.26
NP_441770.1_4 Reverse -308 -327 -7.17871 0.229
NP_441716.1_1 Reverse -374 -388 8.84938 0.13
NP_441716.1_1 Forward -383 -369 5.1128 0.24
NP_441327.1_5 Reverse -71 -80 16.6177 0.111
NP_441327.1_5 Forward -346 -337 16.2243 0.164
NP_442111.1_4 Forward -384 -370 10.3243 0.0545
NP_440906.1_5 Forward -382 -375 15.8704 0.0124
NP_440906.1_5 Reverse -375 -382 15.8704 0.0124
NP_440747.1_10 Forward -386 -374 26.5883 0.000317
NP_440747.1_10 Reverse -371 -383 7.31547 0.00577
NP_441130.1_10 Forward -385 -371 16.1259 0.0261
NP_441130.1_10 Reverse -372 -386 9.43936 0.125
NP_441486.1_1 Reverse -371 -385 4.81781 0.0406
NP_441486.1_1 Forward -386 -372 -4.13031 0.189
NP_441880.2_10 Forward -382 -364 13.4905 0.111
NP_442330.1_4 Reverse -258 -277 15.8244 0.233
NP_442330.1_4 Forward -378 -359 12.5063 0.286
NP_442634.1_2 Reverse -368 -387 9.0459 0.144
NP_442634.1_4 Reverse -372 -386 -1.27871 0.149
NP_440403.1_4 Forward -392 -373 -7.86702 0.248
NP_441014.1_5 Reverse -242 -260 9.26226 0.282
NP_441014.1_8 Forward -386 -367 -3.54046 0.242
NP_442848.1_1 Forward -389 -375 -0.885388 0.263
NP_443018.1_3 Forward -382 -375 14.8871 0.0123
NP_443018.1_3 Reverse -375 -382 14.8871 0.0123
NP_443018.1_3 Reverse -308 -315 10.2655 0.107
NP_441316.1_7 Reverse -372 -387 -2.8717 0.273
NP_441634.1_8 Forward -385 -371 15.5359 0.0248
NP_440376.1_1 Forward -383 -374 19.4693 0.000692
NP_440376.1_1 Reverse -374 -383 19.4693 0.000692
NP_440376.1_1 Forward -256 -247 8.06287 0.0463
NP_441857.1_6 Forward -257 -247 14.1397 0.254
NP_442687.1_7 Reverse -373 -383 15.8113 0.0125
NP_442687.1_7 Forward -384 -374 8.92815 0.0994
NP_442191.1_4 Reverse -248 -262 13.7079 0.132
NP_442191.1_4 Reverse -365 -379 11.187 0.268
NP_441077.1_6 Reverse -125 -141 5.88689 0.244
NP_441077.1_6 Reverse -101 -117 2.12702 0.289
NP_441077.1_6 Reverse -33 -49 2.03061 0.29
NP_442958.1_3 Reverse -363 -382 -0.39387 0.267
NP_442530.1_6 Forward -56 -43 18.6813 0.14
NP_440642.1_8 Forward -381 -362 15.0712 0.171
NP_440642.1_10 Forward -77 -63 8.84875 0.198
NP_441422.1_3 Forward -388 -369 18.9655 0.103
NP_441422.1_7 Reverse -372 -389 7.61033 0.0992
NP_440533.1_6 Reverse -255 -274 10.2259 0.274
NP_441763.1_10 Reverse -363 -382 7.96345 0.225
NP_442658.1_1 Reverse -372 -382 17.0891 0.00615
NP_442658.1_1 Forward -385 -375 7.94438 0.199
NP_442198.1_3 Reverse -204 -223 3.6377 0.285
NP_442782.1_2 Reverse -182 -196 0.589577 0.288
NP_441414.1_9 Reverse -374 -393 -2.75381 0.122
NP_441414.1_9 Forward -383 -364 -5.9004 0.182
NP_441958.1_5 Forward -384 -374 12.2714 0.00183
NP_441958.1_5 Reverse -373 -383 12.2714 0.00183
NP_441127.1_1 Forward -373 -359 7.86607 0.3
NP_442836.1_5 Forward -389 -370 2.75272 0.248
NP_439905.1_1 Forward -382 -369 20.5705 0.00954
NP_440984.1_7 Reverse -369 -383 11.7993 0.122
NP_440984.1_7 Forward -388 -374 9.34103 0.127
NP_441162.1_3 Forward -267 -248 8.55425 0.258
NP_439990.1_5 Forward -388 -375 10.5407 0.128
NP_442690.1_1 Forward -162 -143 -5.99873 0.164
NP_442690.1_1 Forward -63 -44 -11.5053 0.23
NP_442690.1_1 Reverse -184 -203 -15.6352 0.28
NP_442911.1_2 Forward -393 -374 -3.63879 0.115
NP_442911.1_2 Reverse -364 -383 -4.52377 0.136
NP_440602.1_5 Forward -312 -293 16.3224 0.205
NP_441099.1_5 Forward -393 -374 6.98095 0.0429
NP_441099.1_5 Reverse -364 -383 -7.76869 0.18
NP_442002.1_9 Reverse -373 -380 10.7572 0.185
NP_440809.1_9 Reverse -365 -383 1.88744 0.118
NP_441294.1_7 Reverse -370 -384 11.5544 0.137
NP_442438.1_10 Reverse -272 -286 -0.197071 0.253
NP_442438.1_10 Reverse -308 -322 -1.08205 0.291
NP_442566.1_2 Reverse -369 -388 1.27776 0.289
NP_441000.1_6 Forward -384 -370 5.70279 0.0933
NP_441000.1_6 Reverse -373 -387 -3.93365 0.225
NP_440147.1_4 Reverse -372 -385 17.6205 0.00602
NP_440147.1_4 Forward -385 -372 15.0639 0.0197
NP_441550.1_8 Forward -385 -375 15.1225 0.0132
NP_441550.1_8 Reverse -372 -382 8.82935 0.112
NP_441916.1_7 Forward -383 -373 18.4663 0.00144
NP_441916.1_7 Reverse -374 -384 10.3048 0.0261
NP_440345.1_5 Reverse -49 -63 14.2385 0.276
NP_441041.1_4 Forward -383 -364 -3.3438 0.121
NP_441041.1_4 Reverse -374 -393 -11.1119 0.241
NP_441041.1_7 Reverse -371 -383 8.58373 0.133
NP_441041.1_7 Forward -386 -374 7.51478 0.162
NP_441725.1_4 Forward -388 -374 3.53891 0.278
NP_441725.1_5 Forward -382 -372 2.04498 0.115
NP_441725.1_5 Reverse -375 -385 2.04498 0.115
NP_439966.1_7 Reverse -372 -382 17.9741 0.00631
NP_439966.1_7 Forward -385 -375 15.3192 0.0152
NP_439966.1_9 Reverse -381 -390 4.52295 0.253
NP_439966.1_9 Reverse -372 -381 0.884706 0.253
NP_442941.1_2 Reverse -37 -56 11.3154 0.295
NP_442941.1_3 Reverse -375 -385 19.2529 0.00262
NP_442941.1_3 Forward -382 -372 10.7964 0.0116
NP_440674.1_3 Forward -379 -360 2.16274 0.267
NP_440289.1_2 Reverse -371 -384 11.229 0.021
NP_440289.1_2 Forward -386 -373 -3.61896 0.267
NP_440983.1_9 Forward -392 -373 9.14423 0.202
NP_441514.1_1 Forward -122 -112 15.0135 0.274
NP_442281.1_1 Forward -388 -374 16.6169 0.00772
NP_442281.1_1 Reverse -369 -383 2.06395 0.278
NP_441079.1_7 Forward -152 -133 -4.1312 0.241
NP_442256.1_2 Forward -385 -367 -7.45401 0.214
NP_001035871.2_7 Forward -259 -249 17.6796 0.105
NP_442049.1_10 Reverse -366 -385 1.76941 0.289
NP_441556.1_10 Reverse -369 -383 15.6727 0.144
NP_440498.1_1 Forward -392 -374 -0.275845 0.218
NP_442982.1_5 Forward -326 -307 -0.39387 0.254
NP_441644.1_6 Reverse -374 -384 17.3841 0.00127
NP_441644.1_6 Forward -383 -373 10.1076 0.0628
NP_442215.1_2 Forward -298 -282 -2.20308 0.193
NP_442215.1_2 Reverse -372 -388 -5.84132 0.26
NP_442247.1_5 Forward -213 -199 15.3463 0.234
NP_440929.1_8 Forward -383 -374 19.2726 0.000701
NP_440929.1_8 Reverse -374 -383 19.2726 0.000701
NP_442933.1_1 Forward -155 -136 7.30471 0.253
NP_442933.1_2 Reverse -164 -182 8.78724 0.257
NP_442933.1_10 Forward -383 -374 17.601 0.00325
NP_442933.1_10 Reverse -374 -383 17.601 0.00325
NP_441310.1_9 Reverse -339 -358 5.11266 0.128
NP_441751.2_8 Reverse -375 -389 13.6676 0.0162
NP_441751.2_8 Forward -382 -368 -5.50694 0.214
NP_440096.1_3 Forward -67 -48 18.6683 0.11
NP_442554.1_8 Reverse -375 -385 16.2046 0.0065
NP_442554.1_8 Forward -382 -372 14.1397 0.0144
NP_441762.1_7 Forward -384 -372 2.98891 0.0676
NP_441762.1_7 Reverse -373 -385 2.39892 0.0676
NP_442142.1_4 Forward -386 -373 16.0466 0.0264
NP_442142.1_4 Reverse -371 -384 6.0169 0.175
NP_442292.1_1 Reverse -375 -384 18.486 0.00229
NP_442292.1_1 Forward -382 -373 9.63616 0.0183
NP_440919.1_7 Reverse -205 -223 5.45093 0.286
NP_441024.1_6 Forward -165 -146 6.92274 0.292
NP_442476.1_6 Forward -382 -368 15.3392 0.037
NP_442476.1_6 Reverse -375 -389 15.2409 0.037
NP_442381.1_8 Reverse -371 -390 -7.37537 0.188
NP_441523.1_6 Forward -387 -368 2.45773 0.291
NP_443009.1_5 Forward -384 -373 18.3477 0.00265
NP_440807.1_7 Reverse -242 -261 -0.787193 0.204
NP_440397.1_3 Reverse -192 -211 11.0125 0.273
NP_441715.1_4 Forward -382 -372 18.8596 0.00741
NP_441715.1_4 Reverse -375 -385 17.3846 0.0106
NP_440881.1_10 Reverse -375 -388 11.229 0.253
NP_441468.1_1 Forward -382 -375 15.8704 0.0124
NP_441468.1_1 Reverse -375 -382 15.8704 0.0124
NP_441673.1_1 Forward -383 -374 20.8459 0.000698
NP_441673.1_1 Reverse -374 -383 20.8459 0.000698
NP_441731.1_7 Reverse -356 -375 9.0459 0.147
NP_441826.1_2 Forward -389 -375 2.06454 0.136
NP_442043.1_1 Forward -364 -345 4.71934 0.236
NP_442868.1_6 Forward -385 -375 19.2529 0.00563
NP_442868.1_6 Reverse -372 -382 10.3048 0.038
NP_442719.1_2 Reverse -355 -373 7.29487 0.119
NP_442719.1_2 Forward -220 -202 -3.42315 0.2
NP_442719.1_2 Reverse -287 -305 -5.48809 0.219
NP_442719.1_2 Forward -221 -203 -9.12632 0.259
NP_441056.1_1 Reverse -374 -393 -8.45701 0.282
NP_440785.1_2 Reverse -161 -180 13.6675 0.203
NP_440051.1_5 Reverse -146 -160 14.3517 0.285
NP_441612.1_2 Reverse -374 -384 8.54929 0.21
NP_442808.1_1 Reverse -373 -383 18.4657 0.00201
NP_442808.1_1 Forward -384 -374 8.63269 0.0481
NP_442808.1_1 Reverse -246 -256 2.83119 0.254
NP_441101.1_10 Forward -387 -368 -0.688862 0.189
NP_440031.1_10 Forward -261 -242 3.93269 0.256
NP_442542.1_2 Reverse -372 -385 15.6539 0.0793
NP_442050.1_5 Forward -385 -375 14.3359 0.0206
NP_442050.1_5 Reverse -372 -382 6.96107 0.27
NP_440558.1_2 Forward -392 -373 -5.60541 0.262
NP_442593.1_9 Forward -127 -108 15.0073 0.278
NP_441878.1_6 Forward -384 -374 10.4031 0.0176
NP_441878.1_6 Reverse -373 -383 10.4031 0.0176
NP_441036.1_8 Reverse -373 -383 17.7779 0.000554
NP_441036.1_8 Forward -384 -374 8.33817 0.174
NP_441557.1_5 Forward -383 -374 19.9609 0.000699
NP_441557.1_5 Reverse -374 -383 19.9609 0.000699
NP_441445.1_1 Reverse -365 -384 10.0292 0.0983
NP_441590.1_4 Reverse -248 -267 4.81688 0.279
NP_442066.2_9 Reverse -370 -383 11.229 0.154
NP_442066.2_9 Forward -387 -374 10.8357 0.154
NP_441433.1_8 Reverse -247 -266 -1.7705 0.263
NP_440101.1_3 Reverse -369 -388 6.09597 0.185
NP_442183.1_1 Reverse -374 -388 8.94771 0.105
NP_440979.1_3 Forward -382 -364 11.7205 0.234
NP_441638.1_8 Reverse -202 -221 14.3558 0.277
NP_442347.1_2 Reverse -375 -384 12.4878 0.056
NP_442347.1_2 Forward -382 -373 11.1111 0.056
NP_442645.1_2 Forward -391 -372 -12.9802 0.144
NP_441037.1_4 Reverse -372 -382 6.92787 0.237
NP_441633.1_3 Forward -385 -372 10.8357 0.0286
NP_441633.1_3 Reverse -372 -385 5.72248 0.0481
NP_440136.1_2 Forward -382 -375 15.9687 0.0123
NP_440136.1_2 Reverse -375 -382 15.9687 0.0123
NP_442590.1_10 Reverse -367 -386 5.50599 0.258
NP_442998.1_5 Reverse -160 -170 11.8781 0.176
NP_442998.1_5 Forward -325 -315 11.1898 0.191
NP_442998.1_5 Reverse -72 -82 10.6981 0.206
NP_442998.1_5 Reverse -71 -81 9.61647 0.238
NP_442998.1_10 Forward -381 -374 15.5754 0.0102
NP_442998.1_10 Reverse -376 -383 15.5754 0.0102
NP_440299.1_1 Forward -387 -374 10.5401 0.0569
NP_440299.1_1 Reverse -370 -383 6.0169 0.155
NP_441799.1_1 Forward -387 -373 17.9935 0.00957
NP_441799.1_1 Reverse -370 -384 16.0269 0.0153
NP_441799.1_9 Forward -384 -365 -2.45882 0.213
NP_441007.1_5 Reverse -375 -394 10.7175 0.214
NP_441007.1_10 Forward -388 -375 8.57408 0.112
NP_441449.1_8 Forward -397 -378 12.8237 0.298
NP_440256.1_1 Forward -386 -367 2.16274 0.0669
NP_440087.1_1 Reverse -365 -384 -5.01543 0.249
NP_441559.1_8 Reverse -369 -383 12.1926 0.0574
NP_441559.1_8 Forward -261 -247 -0.000409212 0.171
NP_441559.1_8 Forward -378 -364 -4.91696 0.241
NP_441559.1_8 Forward -388 -374 -6.49025 0.279
NP_440915.1_6 Forward -387 -373 0.982901 0.148
NP_440915.1_6 Forward -260 -246 -2.36035 0.268
NP_442158.1_4 Reverse -206 -216 10.7964 0.283
NP_442785.1_7 Forward -385 -371 10.816 0.228
NP_442069.1_6 Forward -398 -379 9.0459 0.165
NP_440695.1_5 Forward -383 -364 2.65439 0.254
NP_441939.1_3 Reverse -375 -394 10.4225 0.126
NP_442993.1_1 Forward -383 -367 -9.77456 0.194
NP_442386.1_9 Reverse -373 -382 15.7322 0.0144
NP_442386.1_9 Forward -384 -375 13.8639 0.0289
NP_441340.1_5 Forward -382 -375 15.6737 0.0124
NP_441340.1_5 Reverse -375 -382 15.6737 0.0124
NP_441340.1_9 Reverse -149 -159 7.29115 0.289
NP_442484.1_2 Forward -394 -375 5.50599 0.168
NP_441132.1_3 Forward -265 -246 2.26107 0.294
NP_440586.1_8 Forward -382 -375 13.2151 0.026
NP_440586.1_8 Reverse -375 -382 13.2151 0.026
NP_440586.1_8 Reverse -308 -315 9.08521 0.178
NP_440586.1_9 Forward -390 -371 9.53756 0.261
NP_442251.1_6 Forward -382 -375 15.2804 0.0124
NP_442251.1_6 Reverse -375 -382 15.2804 0.0124
NP_441262.1_3 Reverse -374 -381 14.7888 0.0223
NP_441262.1_3 Forward -383 -376 14.7888 0.0223
NP_443051.1_1 Reverse -373 -382 10.4228 0.00754
NP_443051.1_1 Forward -384 -375 10.4228 0.00754
NP_439937.1_9 Forward -384 -367 -6.64833 0.157
NP_440439.1_1 Reverse -371 -384 12.5073 0.0244
NP_440439.1_1 Forward -386 -373 9.16406 0.0465
NP_440372.1_2 Forward -382 -375 16.3621 0.0124
NP_440372.1_2 Reverse -375 -382 16.3621 0.0124
NP_440819.1_5 Reverse -71 -79 7.68924 0.266
NP_441572.1_7 Reverse -368 -387 -5.60541 0.265
NP_442384.1_10 Reverse -374 -387 18.9972 0.00338
NP_442384.1_10 Forward -383 -370 18.8988 0.00338
NP_442384.1_10 Reverse -247 -260 0.60927 0.286
NP_442114.1_4 Forward -383 -372 9.20345 0.17
NP_442262.1_10 Forward -382 -375 14.1988 0.0123
NP_442262.1_10 Reverse -375 -382 14.1988 0.0123
NP_442262.1_10 Reverse -308 -315 9.18389 0.211
NP_441689.1_5 Forward -385 -375 5.78111 0.197
NP_440344.1_10 Reverse -367 -384 -6.05768 0.111
NP_440282.1_10 Forward -393 -374 -6.09707 0.25
NP_440531.1_6 Forward -391 -372 10.0292 0.0694
NP_440531.1_6 Reverse -366 -385 1.17943 0.179
NP_442910.1_1 Forward -390 -371 -4.52377 0.254
NP_441965.1_10 Reverse -371 -387 19.9214 0.0179
NP_441965.1_10 Forward -386 -370 6.15506 0.185
NP_442693.1_7 Reverse -373 -392 7.66927 0.282
NP_440297.1_9 Forward -315 -305 0.0783647 0.282
NP_440297.1_9 Forward -382 -372 -0.118297 0.282
NP_440297.1_9 Reverse -375 -385 -0.118297 0.282
NP_441896.1_3 Reverse -365 -384 -2.65548 0.287
NP_442378.1_10 Forward -157 -138 20.1006 0.165
NP_440894.1_4 Reverse -85 -104 2.3594 0.224
NP_440999.1_9 Reverse -370 -384 15.9292 0.0222
NP_440999.1_9 Forward -387 -373 -1.96703 0.254
NP_440888.1_2 Forward -383 -369 13.5686 0.027
NP_440888.1_2 Reverse -374 -388 11.5037 0.0657
NP_442892.1_9 Forward -186 -172 11.7987 0.296
NP_442454.1_2 Reverse -324 -343 8.83258 0.291
NP_439969.1_1 Reverse -246 -265 -5.80207 0.288
NP_442033.1_10 Reverse -362 -381 -5.01543 0.179
NP_442033.1_10 Reverse -372 -391 -9.24366 0.212
NP_441949.1_5 Reverse -135 -154 10.8728 0.28
NP_440575.1_8 Reverse -134 -153 -6.49039 0.283
NP_442077.1_9 Reverse -325 -344 1.37609 0.218
NP_441543.1_2 Forward -382 -373 18.486 0.00236
NP_441543.1_2 Reverse -375 -384 16.9127 0.00359
NP_441551.1_5 Reverse -370 -386 9.10428 0.218
NP_441469.1_8 Reverse -373 -382 16.126 0.00797
NP_441469.1_8 Forward -384 -375 6.48957 0.227
NP_442315.1_3 Reverse -182 -201 14.4541 0.148
NP_443064.1_6 Reverse -374 -384 12.5669 0.0796
NP_442578.1_7 Forward -382 -375 14.5921 0.026
NP_442578.1_7 Reverse -375 -382 14.5921 0.026
NP_441462.1_2 Forward -383 -373 11.5831 0.00406
NP_441462.1_2 Reverse -374 -384 11.5831 0.00406
NP_441621.1_7 Reverse -372 -386 -3.24533 0.188
NP_440668.1_9 Forward -317 -298 10.4225 0.249
NP_443062.1_1 Forward -383 -365 7.18082 0.182
NP_443062.1_1 Reverse -374 -392 4.93815 0.244
NP_443062.1_6 Forward -391 -372 16.9124 0.0638
NP_443062.1_6 Reverse -366 -385 10.0292 0.119
NP_440936.1_2 Forward -115 -96 15.2408 0.162
NP_441423.1_5 Reverse -337 -350 18.5049 0.18
NP_442204.1_1 Forward -134 -123 4.97522 0.225
NP_442204.1_1 Forward -260 -249 3.40192 0.266
NP_442204.1_1 Forward -387 -376 1.7303 0.266
NP_442204.1_1 Reverse -370 -381 -0.0396598 0.285
NP_442204.1_2 Forward -266 -247 5.80098 0.292
NP_440255.1_5 Reverse -127 -141 15.8633 0.246
NP_440516.1_2 Reverse -368 -386 14.9655 0.0514
NP_440516.1_2 Forward -389 -371 13.2938 0.0588
NP_440516.1_8 Forward -383 -374 16.9127 0.00442
NP_440516.1_8 Reverse -374 -383 16.9127 0.00442
NP_442428.1_5 Forward -382 -375 15.8704 0.0124
NP_442428.1_5 Reverse -375 -382 15.8704 0.0124
NP_442120.1_10 Forward -363 -344 -6.29373 0.208
NP_440673.1_3 Forward -381 -374 12.4288 0.0426
NP_440673.1_3 Reverse -376 -383 12.4288 0.0426
NP_441052.1_2 Reverse -374 -384 19.9412 0.00106
NP_441052.1_2 Forward -383 -373 10.5014 0.0285
NP_442219.1_9 Reverse -375 -384 17.7976 0.00718
NP_442219.1_9 Forward -382 -373 8.35786 0.0681
NP_440436.1_4 Forward -382 -373 18.1905 0.00233
NP_440436.1_4 Reverse -375 -384 17.2072 0.00233
NP_441884.1_8 Reverse -373 -392 -7.67036 0.254
NP_441884.1_9 Reverse -371 -390 -15.9302 0.138
NP_442864.1_7 Reverse -253 -271 5.62401 0.274
NP_440314.1_9 Forward -382 -363 0.982764 0.0947
NP_440314.1_9 Forward -221 -202 -4.72043 0.213
NP_441719.1_4 Forward -382 -375 16.3621 0.0124
NP_441719.1_4 Reverse -375 -382 16.3621 0.0124
NP_441733.1_10 Forward -386 -373 7.39411 0.153
NP_441004.1_1 Reverse -254 -273 -9.047 0.206
NP_442873.1_5 Reverse -253 -272 11.11 0.246
NP_442694.1_4 Reverse -203 -212 15.536 0.164
NP_442694.1_4 Forward -283 -274 12.6844 0.248
NP_442206.1_10 Reverse -374 -389 13.3529 0.0799
NP_440328.1_4 Forward -389 -370 -0.0988766 0.267
NP_443054.1_2 Forward -385 -371 1.08123 0.251
NP_441851.1_10 Reverse -373 -383 16.008 0.00552
NP_441851.1_10 Forward -384 -374 15.8113 0.00552
NP_442208.1_5 Reverse -245 -264 -10.4236 0.299
NP_442939.1_7 Reverse -283 -302 9.73422 0.292
NP_442622.1_8 Reverse -374 -392 -18.7621 0.268
NP_442856.1_6 Forward -313 -295 14.5713 0.238
NP_442515.1_1 Forward -384 -370 11.406 0.0412
NP_442515.1_1 Reverse -373 -387 2.35953 0.137
NP_441982.1_6 Forward -347 -338 13.2493 0.274
NP_441982.1_6 Reverse -192 -201 11.3395 0.288
NP_442709.1_3 Forward -390 -371 8.35759 0.121
NP_442709.1_3 Reverse -240 -259 2.85105 0.288
NP_442689.1_8 Forward -158 -141 0.432165 0.191
NP_442689.1_8 Reverse -145 -162 -8.41762 0.294
NP_441349.1_10 Forward -393 -374 -8.35868 0.274
NP_441409.1_6 Reverse -368 -387 2.0644 0.0584
NP_441409.1_8 Reverse -169 -188 7.88415 0.277
NP_440432.1_9 Reverse -375 -390 -3.26502 0.179
NP_442843.1_1 Reverse -375 -394 -3.73712 0.228
NP_439960.1_10 Forward -390 -372 3.3624 0.163
NP_441124.1_5 Reverse -131 -141 15.5864 0.188
NP_441124.1_5 Reverse -160 -170 14.345 0.215
NP_441124.1_5 Forward -146 -136 12.3397 0.225
NP_440431.1_7 Forward -120 -101 10.9142 0.0785
NP_440588.1_2 Forward -392 -373 -2.26216 0.163
NP_440483.1_1 Forward -261 -242 -0.787193 0.208
NP_440483.1_4 Reverse -368 -387 7.47261 0.271
NP_441570.1_1 Reverse -374 -392 2.87075 0.023
NP_441078.1_4 Forward -383 -374 19.6659 0.0007
NP_441078.1_4 Reverse -374 -383 19.6659 0.0007
NP_442729.1_5 Reverse -306 -316 7.74818 0.271
NP_441539.1_1 Forward -340 -326 14.4536 0.284
NP_441663.1_8 Forward -262 -243 3.24438 0.187
NP_441663.1_8 Reverse -368 -387 -2.65548 0.271
NP_442348.1_2 Forward -284 -275 11.8978 0.225
NP_442348.1_2 Reverse -202 -211 7.37455 0.28
NP_440526.1_3 Reverse -375 -386 8.02298 0.126
NP_441432.1_8 Forward -384 -375 16.8143 0.00595
NP_441432.1_8 Reverse -373 -382 8.25953 0.0755
NP_441732.1_2 Forward -387 -371 -16.0677 0.164
NP_441732.1_2 Reverse -370 -386 -16.3627 0.165
NP_442003.1_4 Forward -382 -363 12.0942 0.272
NP_440685.1_6 Forward -386 -367 21.0414 0.0454
NP_440760.1_1 Reverse -374 -393 -5.31042 0.0493
NP_442353.1_4 Reverse -368 -387 6.88182 0.17
NP_440913.1_1 Reverse -372 -390 6.214 0.229
NP_440713.1_4 Forward -393 -374 5.89931 0.2
NP_442489.1_7 Forward -383 -374 20.1576 0.000695
NP_442489.1_7 Reverse -374 -383 20.1576 0.000695
NP_442079.1_6 Forward -263 -244 14.2574 0.273
NP_442079.1_7 Reverse -375 -394 -0.295539 0.29
NP_440559.1_1 Reverse -375 -384 17.4043 0.00658
NP_440559.1_1 Forward -382 -373 8.75118 0.0586
NP_441659.2_8 Reverse -374 -384 18.1713 0.00133
NP_441659.2_8 Forward -383 -373 11.9764 0.0147
NP_441022.1_1 Reverse -152 -161 12.8891 0.222
NP_441040.1_2 Forward -265 -246 -9.93197 0.241
NP_439956.1_7 Reverse -378 -397 4.916 0.257
NP_442008.1_2 Reverse -256 -275 10.2259 0.15
NP_442008.1_2 Reverse -244 -263 2.3594 0.289
NP_442346.1_5 Forward -384 -374 16.6963 0.00248
NP_442346.1_5 Reverse -373 -383 9.02648 0.118
NP_440352.1_5 Forward -132 -113 9.63828 0.294
NP_440545.1_3 Forward -387 -370 3.87375 0.0775
NP_440545.1_3 Reverse -212 -229 -6.746 0.287
NP_440545.1_3 Forward -35 -18 -6.94266 0.293
NP_441856.1_3 Forward -386 -367 -0.000545616 0.216
NP_440250.1_4 Forward -183 -164 3.63691 0.265
NP_440459.1_1 Forward -367 -348 23.7955 0.00961
NP_440459.1_2 Forward -318 -301 8.10198 0.27
NP_440459.1_3 Forward -131 -112 22.1239 0.00896
NP_441653.1_2 Forward -394 -375 12.5166 0.0959
NP_440010.1_3 Forward -268 -249 -6.29373 0.25
NP_441943.1_10 Reverse -142 -156 18.7801 0.197
NP_442603.1_7 Reverse -374 -388 13.6669 0.0819
NP_442603.1_7 Forward -383 -369 8.55376 0.171
NP_442603.1_10 Reverse -382 -399 16.4036 0.244
NP_441888.1_7 Reverse -369 -383 4.03116 0.225
NP_441888.1_7 Forward -388 -374 3.44117 0.225
NP_441888.1_7 Forward -378 -364 0.88457 0.276
NP_441050.1_5 Reverse -13 -31 -0.275845 0.256
NP_441948.1_4 Forward -390 -372 -1.16082 0.143
NP_442732.1_2 Forward -63 -44 16.4701 0.249
NP_441833.1_4 Forward -382 -375 15.9687 0.0124
NP_441833.1_4 Reverse -375 -382 15.9687 0.0124
NP_441329.1_6 Reverse -172 -191 0.524783 0.253
NP_441329.1_6 Reverse -19 -38 -1.67153 0.293
NP_442436.1_4 Forward -157 -143 12.9793 0.218
NP_442162.1_9 Forward -382 -375 16.2637 0.0124
NP_442162.1_9 Reverse -375 -382 16.2637 0.0124
NP_440671.1_1 Forward -165 -146 5.84395 0.26
NP_442140.1_3 Forward -382 -372 14.238 0.0486
NP_442140.1_3 Reverse -375 -385 10.3048 0.0902
NP_440875.1_9 Forward -381 -371 14.3096 0.0453
NP_440875.1_9 Reverse -376 -386 8.37203 0.233
NP_441813.1_5 Reverse -372 -382 19.4496 0.00647
NP_441813.1_5 Forward -385 -375 18.1713 0.00743
NP_440594.1_8 Forward -382 -369 11.2284 0.153
NP_442028.1_1 Forward -117 -104 9.32449 0.251
NP_440590.1_4 Forward -382 -369 14.2773 0.011
NP_440590.1_4 Reverse -375 -388 -4.01229 0.257
NP_440567.1_1 Forward -382 -368 2.85119 0.16
NP_442497.1_10 Forward -382 -373 10.4228 0.0087
NP_442497.1_10 Reverse -375 -384 10.4228 0.0087
NP_440821.1_4 Reverse -372 -382 10.2065 0.0163
NP_440821.1_4 Forward -385 -375 9.41981 0.0286
NP_440227.1_4 Forward -66 -49 13.2144 0.235
NP_441239.1_9 Reverse -372 -384 14.1986 0.0288
NP_441239.1_9 Forward -385 -373 7.80712 0.148
NP_440665.1_1 Reverse -377 -396 -14.2585 0.261
NP_442044.1_9 Forward -99 -80 5.70265 0.202
NP_440573.1_3 Reverse -43 -56 15.9134 0.216
NP_442216.1_4 Forward -267 -259 8.1805 0.255
NP_442138.1_10 Reverse -374 -393 -8.16202 0.299
NP_440546.1_4 Forward -383 -373 11.8882 0.0679
NP_440546.1_4 Reverse -374 -384 10.046 0.109
NP_440462.1_4 Reverse -382 -396 9.63603 0.243
NP_440462.1_6 Reverse -372 -382 17.2863 0.00752
NP_440462.1_6 Forward -385 -375 9.61647 0.0429
NP_442611.1_1 Reverse -247 -266 -3.24547 0.3
NP_440868.1_4 Reverse -370 -382 22.1634 0.00629
NP_440868.1_4 Forward -387 -375 17.0502 0.0124
NP_440868.1_8 Reverse -370 -389 -4.52377 0.263
NP_442499.1_1 Forward -388 -369 2.0644 0.294
NP_441474.1_1 Forward -393 -374 -0.39464 0.255
NP_442402.1_10 Forward -266 -256 11.8776 0.231
NP_442402.1_10 Reverse -357 -367 11.6809 0.241
NP_442402.1_10 Forward -169 -159 10.206 0.299
NP_441848.1_4 Reverse -155 -171 11.3703 0.224
NP_441848.1_4 Reverse -66 -82 8.50558 0.288
NP_441848.1_7 Forward -196 -177 -3.73788 0.284
NP_442039.1_4 Forward -382 -375 15.1821 0.0124
NP_442039.1_4 Reverse -375 -382 15.1821 0.0124
NP_442039.1_7 Reverse -254 -264 10.8948 0.257
NP_441811.1_8 Forward -253 -239 6.19444 0.283
NP_442679.1_3 Reverse -156 -174 1.98577 0.239
NP_442829.1_2 Reverse -172 -188 8.43099 0.287
NP_442837.1_3 Forward -382 -375 15.7721 0.0124
NP_442837.1_3 Reverse -375 -382 15.7721 0.0124
NP_442053.1_1 Forward -383 -374 18.3876 0.0007
NP_442053.1_1 Reverse -374 -383 18.3876 0.0007
NP_440505.1_3 Forward -385 -375 18.3679 0.00213
NP_440505.1_3 Reverse -372 -382 15.9097 0.00857
NP_442532.1_1 Reverse -46 -60 9.82208 0.266
NP_442174.1_9 Reverse -180 -199 6.09597 0.292
NP_440914.1_1 Reverse -374 -384 17.5935 0.000537
NP_440914.1_1 Forward -383 -373 8.6151 0.186
NP_441011.1_8 Forward -382 -373 16.9127 0.00602
NP_441011.1_8 Reverse -375 -384 8.25953 0.144
NP_442533.1_6 Forward -383 -374 17.2076 0.00137
NP_442533.1_6 Reverse -374 -383 17.2076 0.00137
NP_442533.1_6 Reverse -247 -256 4.62128 0.179
NP_442322.1_4 Reverse -244 -261 -10.1882 0.298
NP_442535.1_2 Forward -379 -360 6.78429 0.253
NP_441482.1_7 Forward -389 -375 6.58777 0.0271
NP_439944.1_9 Reverse -375 -385 10.5014 0.0887
NP_441697.1_5 Reverse -35 -54 -6.35064 0.232
NP_440816.1_2 Forward -155 -136 8.37121 0.246
NP_441028.1_6 Forward -187 -177 5.19112 0.265
NP_441028.1_6 Reverse -116 -126 5.19112 0.265
NP_441028.1_6 Forward -78 -68 4.7978 0.277
NP_442664.1_3 Reverse -218 -232 12.6843 0.246
NP_440115.1_6 Forward -386 -376 16.008 0.0325
NP_440115.1_6 Reverse -371 -381 6.66654 0.172
NP_441059.1_2 Reverse -248 -267 3.24438 0.14
NP_441972.1_5 Reverse -375 -394 -9.83364 0.293
NP_441106.1_1 Reverse -373 -382 18.191 0.0028
NP_441106.1_1 Forward -384 -375 9.63616 0.0311
NP_441106.1_6 Forward -34 -15 21.0414 0.189
NP_442928.1_3 Reverse -245 -264 20.4405 0.0881
NP_442306.1_10 Reverse -369 -388 -19.2734 0.197
NP_441286.1_1 Forward -384 -372 6.03717 0.0258
NP_441286.1_1 Reverse -373 -385 3.38223 0.0467
NP_440670.1_8 Forward -383 -374 18.3876 0.000699
NP_440670.1_8 Reverse -374 -383 18.3876 0.000699
NP_442463.1_1 Reverse -258 -277 17.404 0.21
NP_441705.1_3 Forward -379 -360 -4.13045 0.291
NP_440886.1_7 Reverse -373 -383 17.7774 0.0011
NP_440886.1_7 Forward -384 -374 7.94438 0.0805
NP_442614.1_2 Reverse -374 -388 9.83269 0.242
NP_442614.1_2 Forward -383 -369 8.35772 0.255
NP_442072.1_9 Forward -384 -366 -21.8103 0.212
NP_440907.2_8 Forward -382 -372 7.94438 0.117
NP_441463.1_3 Reverse -364 -383 -7.96535 0.262
NP_441463.1_3 Forward -393 -374 -9.14533 0.277
NP_441626.1_2 Forward -382 -375 15.7721 0.0124
NP_441626.1_2 Reverse -375 -382 15.7721 0.0124
NP_441901.1_9 Reverse -305 -324 19.2723 0.0247
NP_442365.1_7 Reverse -370 -389 1.76941 0.168
NP_442365.1_7 Forward -387 -368 -0.0988766 0.177
NP_442794.1_1 Forward -387 -375 10.1671 0.0721
NP_442615.1_1 Reverse -365 -383 -3.02911 0.154
NP_440387.1_1 Reverse -374 -390 2.51681 0.0784
NP_440387.1_1 Forward -383 -367 -2.5964 0.148
NP_441431.1_2 Reverse -371 -385 10.1271 0.169
NP_441836.1_2 Reverse -368 -387 25.9588 0.00274
NP_441836.1_2 Reverse -210 -229 -5.9004 0.288
NP_440114.1_10 Forward -383 -369 11.701 0.106
NP_441425.1_4 Reverse -70 -84 14.9459 0.282
NP_441853.1_6 Forward -196 -177 21.1873 0.0813
NP_440458.1_2 Reverse -350 -369 27.4338 0.000821
NP_440458.1_10 Reverse -270 -288 18.3087 0.239
NP_439910.1_2 Reverse -366 -383 -2.91109 0.0305
NP_440457.1_1 Reverse -303 -315 1.90727 0.223
NP_440457.1_1 Reverse -370 -382 1.12062 0.245
NP_440457.1_1 Forward -387 -375 0.530633 0.25
NP_442680.1_5 Reverse -259 -278 0.658372 0.26
NP_440473.1_1 Forward -386 -367 16.4634 0.106
NP_442509.1_9 Forward -383 -373 16.2041 0.00739
NP_442509.1_9 Reverse -374 -384 8.14104 0.192
NP_442582.1_3 Reverse -154 -168 16.1498 0.144
NP_440554.1_4 Forward -382 -372 16.4996 0.0189
NP_440554.1_4 Reverse -375 -385 8.92815 0.0646
NP_441885.1_1 Reverse -176 -190 16.7406 0.282
NP_441885.1_5 Reverse -374 -384 20.9245 0.000538
NP_441885.1_5 Forward -383 -373 11.4848 0.00668
NP_440478.1_10 Reverse -372 -386 15.7325 0.107
NP_442341.1_7 Forward -384 -370 8.75105 0.0848
NP_442341.1_7 Reverse -373 -387 5.50613 0.154
NP_442341.1_9 Reverse -372 -386 11.2087 0.129
NP_441173.1_9 Forward -166 -158 9.95045 0.266
NP_441173.1_9 Reverse -147 -155 9.85212 0.275
NP_440750.1_5 Reverse -153 -167 4.81781 0.294
NP_440423.1_6 Forward -391 -372 -15.6352 0.229
NP_440423.1_10 Forward -390 -371 11.7008 0.218
NP_443000.1_7 Forward -385 -375 19.9412 0.00223
NP_443000.1_7 Reverse -372 -382 11.5831 0.0344
NP_441842.1_1 Forward -381 -368 19.9798 0.0111
NP_440275.1_3 Reverse -372 -382 15.418 0.0178
NP_440275.1_3 Forward -385 -375 15.123 0.0182
NP_440091.1_1 Reverse -370 -382 0.727295 0.233
NP_442275.1_1 Forward -383 -364 1.47442 0.284
NP_443010.1_10 Reverse -371 -388 3.9304 0.246
NP_442638.1_3 Reverse -137 -156 17.8088 0.209
NP_441207.1_7 Reverse -163 -177 12.3534 0.241
NP_442495.1_4 Forward -312 -302 12.0747 0.25
NP_440804.1_4 Forward -50 -41 15.4377 0.267
NP_440149.1_8 Reverse -374 -393 7.57094 0.0628
NP_442373.1_2 Reverse -210 -229 -4.13045 0.205
NP_440216.1_1 Forward -383 -369 8.65272 0.00592
NP_440216.1_1 Reverse -374 -388 -0.590395 0.0284
NP_440216.1_9 Reverse -323 -332 6.09625 0.289
NP_440216.1_9 Forward -314 -305 5.89959 0.289
NP_440172.1_1 Reverse -374 -384 15.0247 0.00945
NP_440172.1_1 Forward -383 -373 8.73149 0.0586
NP_442418.1_4 Forward -208 -190 12.7979 0.217
NP_442015.1_10 Reverse -370 -383 12.0157 0.0372
NP_442015.1_10 Forward -387 -374 11.3273 0.0372
NP_441226.1_7 Forward -382 -375 14.4934 0.0123
NP_441226.1_7 Reverse -375 -382 14.4934 0.0123
NP_441226.1_7 Reverse -248 -255 5.34865 0.289
NP_442222.1_3 Forward -266 -247 13.0775 0.228
NP_441111.1_7 Forward -382 -374 18.7023 0.00294
NP_441111.1_7 Reverse -375 -383 18.7023 0.00294
NP_440244.1_8 Forward -163 -144 3.34271 0.27
NP_441766.1_2 Forward -383 -374 17.5026 0.00297
NP_441766.1_2 Reverse -374 -383 17.5026 0.00297
NP_440416.1_9 Forward -390 -371 -6.98204 0.0951
NP_440416.1_9 Forward -275 -256 -19.3717 0.274
NP_443052.1_8 Reverse -364 -383 -7.76869 0.164
NP_441135.1_4 Reverse -367 -386 1.57275 0.284
NP_440261.1_5 Forward -382 -369 12.8023 0.0244
NP_440261.1_5 Reverse -375 -388 6.80412 0.0316
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGCCAACCACAATCCTGGCGATCGCCGGCAAATTCGGGAAACCGTATTTTGCTAGGCAAAAATAAGTTTTACAATGGGAAGAACTCCATGGCACGGGGTCTTCTGTCAATACAGAGGGTCTTTGTGCCCCTTTAGTTCCCCCAGGGGTTGGGCACGATTCGACTGAGGCACCCAAGCTAAGGTCTCCCAAAAATCCCATTTTCAACAAATCTTTTGCCTCTATTATTTTAGATTTTCACAAACTTTTGCTAAATTACTAAATTTTCATAGTTGATCGAGGTAAATTATTGGTTTTTAATTGGTTACTGAACTGGGTTACATTTTTCCCTTGTGTCCAATAACTTTAATTAAATAATTAGATTTTACTTGACCATATCATTCACCCTAGATGTCATAGTT

CDS

ATGAGTTTTTTTGATTCAGATATTATCCAACAAGAAGCCAAACAATTGTTTGAAGACTATCAATCCCTAACCAAATTGGGTGGTGACTATGGAAAATTTGATCGGGATGGCAAAGTGATTTTCATCGAGCAAATGGAGGCTTTGATGGAACGCTACAAAATCTTTATGAAGCGCTTTGAGCTTTCCGATGACTTCATGGCCAAGATGACTGTTGAGCAAATGAAAACCCAACTGGGCCAGTTTGGCATCTCCCCTCAGCAAATGTTCGACCAAATGAATTTGACACTGGAAAGAATGAAAGCCGAAATCAAGTAG

Protein

MSFFDSDIIQQEAKQLFEDYQSLTKLGGDYGKFDRDGKVIFIEQMEALMERYKIFMKRFELSDDFMAKMTVEQMKTQLGQFGISPQQMFDQMNLTLERMKAEIK