Your browser is old and dusty. Try Google Chrome!

Details for slr1911

ORF slr1911
Accession NP_440452.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -52 -66 11.701 0.0507
NP_441061.1_2 Reverse -186 -200 2.16287 0.178
NP_441061.1_2 Forward -59 -45 0.88457 0.197
NP_441061.1_2 Forward -320 -306 -0.295402 0.227
NP_440795.1_7 Forward -202 -195 14.6904 0.0123
NP_440795.1_7 Reverse -195 -202 14.6904 0.0123
NP_440795.1_7 Forward -59 -52 14.6904 0.0123
NP_440795.1_7 Reverse -52 -59 14.6904 0.0123
NP_441418.1_6 Forward -60 -41 6.78429 0.00677
NP_441418.1_6 Reverse -39 -58 -20.65 0.121
NP_441418.1_6 Reverse -51 -70 -21.83 0.16
NP_441418.1_6 Forward -203 -184 -29.5982 0.23
NP_441418.1_6 Reverse -194 -213 -30.0898 0.256
NP_441418.1_6 Forward -321 -302 -30.1882 0.262
NP_441480.1_10 Forward -255 -236 6.98095 0.289
NP_442291.1_7 Forward -250 -236 11.8976 0.217
NP_441453.1_4 Reverse -194 -202 16.539 0.00633
NP_441453.1_4 Reverse -51 -59 16.539 0.00633
NP_441453.1_4 Forward -60 -52 16.539 0.00633
NP_441453.1_4 Forward -203 -195 7.8859 0.0536
NP_442151.1_6 Reverse -51 -65 16.6175 0.0139
NP_442151.1_6 Forward -60 -46 11.5043 0.0981
NP_442151.1_6 Forward -321 -307 7.27608 0.205
NP_442838.1_7 Reverse -46 -65 -11.4069 0.277
NP_441818.1_9 Forward -134 -115 -2.0655 0.201
NP_440226.1_1 Forward -60 -41 7.96426 0.0959
NP_440226.1_1 Reverse -51 -70 5.80098 0.145
NP_441342.1_2 Forward -207 -193 11.6026 0.208
NP_440150.1_6 Forward -360 -341 0.884433 0.295
NP_442744.1_8 Reverse -237 -256 3.14605 0.194
NP_442173.1_1 Forward -202 -194 15.4574 0.00633
NP_442173.1_1 Forward -59 -51 15.4574 0.00633
NP_442173.1_1 Reverse -52 -60 15.4574 0.00633
NP_442173.1_1 Reverse -195 -203 8.27922 0.101
NP_442752.1_4 Reverse -194 -201 13.8055 0.0199
NP_442752.1_4 Forward -60 -53 13.8055 0.0199
NP_442752.1_4 Reverse -51 -58 13.8055 0.0199
NP_443027.1_4 Forward -62 -52 15.3197 0.0437
NP_443027.1_4 Reverse -49 -59 13.943 0.0452
NP_443027.1_4 Reverse -192 -202 11.8781 0.0872
NP_443027.1_4 Reverse -225 -235 7.25653 0.24
NP_442975.1_10 Reverse -47 -61 20.9434 0.00133
NP_442975.1_10 Forward -64 -50 11.2087 0.0508
NP_441675.1_10 Reverse -225 -244 21.9069 0.0856
NP_440784.1_7 Forward -202 -195 15.9687 0.0123
NP_440784.1_7 Reverse -195 -202 15.9687 0.0123
NP_440784.1_7 Forward -59 -52 15.9687 0.0123
NP_440784.1_7 Reverse -52 -59 15.9687 0.0123
NP_442909.1_7 Reverse -195 -209 16.1252 0.0918
NP_441476.1_5 Reverse -46 -65 9.93088 0.0933
NP_441476.1_5 Forward -65 -46 1.76941 0.188
NP_439979.1_2 Reverse -342 -361 11.0125 0.192
NP_439979.1_9 Reverse -353 -371 7.98396 0.27
NP_442062.1_8 Forward -60 -50 19.4496 0.000558
NP_442062.1_8 Reverse -51 -61 10.3048 0.0493
NP_442062.1_8 Forward -203 -193 9.91146 0.0554
NP_442062.1_8 Reverse -194 -204 9.41981 0.0625
NP_441900.1_1 Reverse -230 -249 11.2401 0.229
NP_442974.1_6 Reverse -347 -366 18.0915 0.293
NP_441859.1_3 Reverse -50 -69 13.2733 0.0819
NP_441859.1_3 Reverse -193 -212 10.1267 0.121
NP_441859.1_3 Forward -61 -42 10.0284 0.121
NP_440304.1_4 Forward -62 -52 18.9579 0.00406
NP_440304.1_4 Reverse -49 -59 9.91146 0.051
NP_440304.1_4 Forward -362 -352 2.7333 0.299
NP_440304.1_4 Reverse -192 -202 1.84832 0.299
NP_442242.1_4 Forward -202 -195 14.3954 0.0124
NP_442242.1_4 Reverse -195 -202 14.3954 0.0124
NP_442242.1_4 Forward -59 -52 14.3954 0.0124
NP_442242.1_4 Reverse -52 -59 14.3954 0.0124
NP_440044.1_8 Forward -59 -40 4.916 0.107
NP_440307.1_8 Reverse -178 -197 13.8641 0.177
NP_441208.1_1 Forward -303 -284 -5.01543 0.272
NP_441208.1_9 Reverse -48 -62 10.0294 0.196
NP_441208.1_9 Forward -63 -49 7.86607 0.219
NP_441208.1_9 Forward -206 -192 4.91614 0.282
NP_441594.1_6 Forward -69 -50 12.4875 0.109
NP_441594.1_6 Forward -363 -344 9.43923 0.143
NP_441594.1_6 Reverse -42 -61 2.3594 0.252
NP_441594.1_6 Reverse -292 -311 0.294447 0.289
NP_440370.1_10 Reverse -42 -61 13.7658 0.12
NP_442110.1_7 Reverse -51 -65 11.111 0.0636
NP_442110.1_7 Forward -60 -46 9.93102 0.0684
NP_442896.1_7 Reverse -294 -313 -0.295539 0.289
NP_442726.1_7 Reverse -341 -359 3.75572 0.215
NP_441925.1_4 Reverse -343 -362 -8.85106 0.212
NP_441925.1_4 Reverse -344 -363 -14.4559 0.263
NP_440014.1_6 Reverse -42 -61 11.3075 0.236
NP_441402.1_10 Reverse -185 -204 22.2223 0.0124
NP_440856.1_4 Forward -67 -48 -3.63879 0.234
NP_441083.1_5 Forward -60 -50 11.3864 0.0159
NP_441083.1_5 Reverse -51 -61 11.2881 0.0159
NP_441083.1_5 Forward -203 -193 10.1081 0.0208
NP_441083.1_5 Reverse -194 -204 9.61647 0.0243
NP_442827.1_8 Reverse -43 -62 17.5015 0.0295
NP_442827.1_8 Forward -68 -49 4.71854 0.131
NP_441434.1_7 Forward -201 -187 3.34284 0.249
NP_441738.1_2 Forward -201 -194 15.28 0.0102
NP_441738.1_2 Forward -58 -51 15.28 0.0102
NP_441738.1_2 Reverse -53 -60 15.28 0.0102
NP_441738.1_2 Reverse -314 -321 6.03696 0.295
NP_441558.1_5 Forward -62 -43 18.289 0.0146
NP_441558.1_5 Reverse -49 -68 8.65258 0.145
NP_441645.1_5 Forward -297 -278 20.5506 0.173
NP_440209.1_1 Reverse -194 -202 18.1123 0.00295
NP_440209.1_1 Reverse -51 -59 18.1123 0.00295
NP_440209.1_1 Forward -60 -52 18.1123 0.00295
NP_440209.1_1 Forward -203 -195 15.1624 0.00583
NP_440447.1_1 Reverse -189 -207 5.91901 0.194
NP_441713.1_1 Forward -66 -47 -16.5201 0.284
NP_441713.1_1 Reverse -275 -294 -16.7168 0.286
NP_440178.1_7 Forward -61 -42 -20.945 0.204
NP_442570.1_3 Forward -131 -112 -9.53865 0.299
NP_441716.1_1 Forward -60 -46 4.22782 0.256
NP_442111.1_4 Forward -61 -47 16.5192 0.0145
NP_442111.1_4 Reverse -50 -64 12.0943 0.0451
NP_442111.1_4 Forward -204 -190 11.0127 0.0518
NP_441163.1_1 Forward -211 -194 9.5762 0.225
NP_441163.1_1 Reverse -43 -60 8.19958 0.232
NP_440906.1_5 Forward -202 -195 15.8704 0.0124
NP_440906.1_5 Reverse -195 -202 15.8704 0.0124
NP_440906.1_5 Forward -59 -52 15.8704 0.0124
NP_440906.1_5 Reverse -52 -59 15.8704 0.0124
NP_440747.1_10 Reverse -191 -203 7.31547 0.00577
NP_440747.1_10 Forward -63 -51 -2.02597 0.0196
NP_440747.1_10 Reverse -48 -60 -2.02597 0.0196
NP_440747.1_10 Forward -206 -194 -4.28759 0.0903
NP_440747.1_10 Forward -324 -312 -11.9574 0.178
NP_440747.1_10 Reverse -182 -194 -11.9574 0.178
NP_441130.1_10 Forward -62 -48 11.111 0.107
NP_441130.1_10 Reverse -49 -63 9.73436 0.12
NP_441486.1_1 Reverse -191 -205 -2.26202 0.175
NP_441486.1_1 Reverse -48 -62 -3.54032 0.179
NP_441486.1_1 Forward -206 -192 -4.7203 0.205
NP_442634.1_4 Reverse -49 -63 4.62115 0.0764
NP_442634.1_4 Forward -62 -48 4.22782 0.0819
NP_440403.1_4 Reverse -42 -61 -7.17871 0.237
NP_440403.1_10 Reverse -348 -367 9.73422 0.186
NP_440403.1_10 Forward -361 -342 5.01433 0.251
NP_442848.1_1 Reverse -45 -59 7.57108 0.0791
NP_442848.1_1 Forward -66 -52 -2.75368 0.263
NP_442848.1_1 Forward -209 -195 -3.34366 0.265
NP_442848.1_1 Reverse -306 -320 -4.52363 0.294
NP_442848.1_5 Reverse -341 -359 1.59244 0.276
NP_442848.1_9 Forward -66 -47 4.32602 0.206
NP_442848.1_9 Forward -360 -341 2.0644 0.255
NP_441012.1_4 Reverse -344 -357 11.524 0.252
NP_443018.1_3 Forward -202 -195 14.8871 0.0123
NP_443018.1_3 Reverse -195 -202 14.8871 0.0123
NP_443018.1_3 Forward -59 -52 14.8871 0.0123
NP_443018.1_3 Reverse -52 -59 14.8871 0.0123
NP_443018.1_3 Reverse -307 -314 8.39725 0.147
NP_443018.1_3 Reverse -282 -289 5.34899 0.212
NP_441316.1_7 Reverse -49 -64 4.01147 0.137
NP_441634.1_8 Forward -62 -48 6.29277 0.114
NP_441634.1_8 Reverse -192 -206 -3.83532 0.295
NP_441634.1_8 Reverse -346 -360 -4.03198 0.295
NP_441634.1_8 Forward -287 -273 -4.03198 0.295
NP_441634.1_8 Reverse -183 -197 -4.7203 0.295
NP_440376.1_1 Forward -60 -51 19.4693 0.000692
NP_440376.1_1 Reverse -51 -60 19.4693 0.000692
NP_440376.1_1 Reverse -194 -203 9.73449 0.0365
NP_440376.1_1 Forward -203 -194 9.63616 0.0385
NP_441857.1_5 Reverse -44 -62 4.44404 0.222
NP_441857.1_5 Forward -210 -192 3.46073 0.244
NP_441857.1_6 Reverse -235 -245 13.5497 0.269
NP_442687.1_7 Forward -204 -194 15.8113 0.0125
NP_442687.1_7 Reverse -50 -60 15.8113 0.0125
NP_442687.1_7 Forward -61 -51 9.02648 0.0994
NP_442687.1_7 Reverse -193 -203 6.76487 0.154
NP_442687.1_7 Reverse -347 -357 4.3066 0.255
NP_442191.1_4 Forward -59 -45 14.0957 0.115
NP_442191.1_7 Forward -360 -341 11.9958 0.225
NP_442485.1_3 Reverse -183 -202 11.7992 0.105
NP_442485.1_3 Forward -356 -337 -1.47551 0.259
NP_442485.1_3 Reverse -46 -65 -2.65548 0.264
NP_442485.1_3 Reverse -337 -356 -4.72043 0.285
NP_441846.1_10 Reverse -1 -20 -15.5368 0.252
NP_442958.1_3 Reverse -40 -59 3.6377 0.253
NP_442766.1_6 Reverse -346 -360 22.615 0.0411
NP_441422.1_7 Reverse -49 -66 5.9387 0.0992
NP_441422.1_7 Forward -62 -45 -4.18939 0.238
NP_442296.1_9 Reverse -295 -314 -1.47551 0.204
NP_440360.1_10 Reverse -53 -67 4.71948 0.227
NP_440360.1_10 Reverse -294 -308 3.73617 0.227
NP_442658.1_1 Reverse -49 -59 18.7607 0.00222
NP_442658.1_1 Reverse -192 -202 17.0891 0.00615
NP_442658.1_1 Forward -62 -52 15.9091 0.00966
NP_442658.1_1 Forward -205 -195 12.6642 0.0497
NP_441971.1_5 Forward -361 -342 9.24257 0.288
NP_442205.1_9 Forward -66 -50 1.04184 0.255
NP_442205.1_9 Reverse -45 -61 -1.61309 0.264
NP_440656.1_8 Reverse -183 -202 -9.73531 0.295
NP_442544.1_2 Reverse -255 -269 -0.000409212 0.217
NP_441414.1_9 Reverse -194 -213 5.50599 0.0471
NP_441256.1_8 Reverse -229 -248 2.0644 0.285
NP_439959.1_3 Forward -366 -347 13.0775 0.215
NP_439959.1_3 Reverse -182 -201 12.1925 0.229
NP_442937.1_5 Forward -65 -46 10.9142 0.151
NP_441958.1_5 Forward -61 -51 21.2195 0.000805
NP_441958.1_5 Reverse -50 -60 12.2714 0.00183
NP_441958.1_5 Forward -204 -194 10.6981 0.0112
NP_441958.1_5 Reverse -193 -203 3.12662 0.0364
NP_440950.1_6 Forward -70 -51 8.84924 0.254
NP_441754.1_1 Forward -338 -319 21.2389 0.021
NP_442816.1_2 Reverse -336 -355 18.6823 0.249
NP_439905.1_1 Forward -59 -46 11.819 0.204
NP_439905.1_1 Reverse -52 -65 6.90245 0.272
NP_440984.1_7 Reverse -189 -203 15.6342 0.0511
NP_440984.1_7 Reverse -46 -60 13.1759 0.117
NP_440984.1_7 Reverse -183 -197 4.81781 0.287
NP_441097.1_2 Reverse -302 -319 5.44704 0.259
NP_439990.1_5 Forward -65 -52 9.65572 0.136
NP_442376.1_2 Forward -208 -189 -12.9802 0.286
NP_442911.1_2 Forward -70 -51 13.6675 0.0118
NP_442911.1_2 Reverse -41 -60 5.211 0.0344
NP_442911.1_2 Forward -213 -194 4.22769 0.0392
NP_442911.1_2 Reverse -302 -321 -8.35868 0.233
NP_441580.1_6 Reverse -40 -59 1.86774 0.117
NP_441580.1_6 Forward -71 -52 -8.26035 0.254
NP_440153.1_5 Forward -59 -45 22.4191 0.0128
NP_440153.1_5 Forward -202 -188 12.291 0.0656
NP_440153.1_5 Reverse -52 -66 4.22782 0.199
NP_440153.1_8 Reverse -348 -361 -2.24233 0.235
NP_440153.1_8 Reverse -295 -308 -2.83231 0.266
NP_441591.1_10 Forward -363 -344 9.73422 0.199
NP_440369.1_5 Forward -374 -355 9.63589 0.272
NP_442064.1_1 Reverse -276 -295 -5.31042 0.21
NP_440993.1_2 Forward -65 -49 15.2998 0.0631
NP_440993.1_2 Reverse -46 -62 12.9399 0.0665
NP_440993.1_3 Reverse -41 -60 -1.77127 0.292
NP_440993.1_3 Forward -70 -51 -2.26292 0.299
NP_442210.1_5 Reverse -49 -68 12.2908 0.212
NP_440138.1_6 Reverse -195 -214 8.25844 0.199
NP_441099.1_5 Forward -70 -51 -9.83364 0.234
NP_441099.1_5 Reverse -282 -301 -11.4069 0.28
NP_442002.1_9 Reverse -193 -200 10.7572 0.185
NP_442002.1_9 Reverse -50 -57 10.7572 0.185
NP_440809.1_9 Reverse -42 -60 -6.27403 0.225
NP_441294.1_7 Reverse -47 -61 12.9942 0.0767
NP_441646.1_1 Forward -67 -48 9.3409 0.132
NP_441646.1_1 Reverse -44 -63 4.12936 0.199
NP_441646.1_1 Forward -374 -355 -0.885524 0.273
NP_442438.1_10 Reverse -46 -60 19.6658 0.0132
NP_442438.1_10 Forward -65 -51 3.04785 0.166
NP_441563.1_7 Reverse -69 -88 17.699 0.278
NP_441000.1_6 Forward -204 -190 16.8142 0.0385
NP_441000.1_6 Reverse -226 -240 1.47456 0.168
NP_441000.1_6 Forward -61 -47 -4.03198 0.225
NP_440605.1_4 Forward -70 -51 15.5124 0.179
NP_442771.1_1 Reverse -49 -67 1.19912 0.081
NP_440147.1_4 Reverse -49 -62 12.2123 0.0326
NP_440147.1_4 Forward -62 -49 11.819 0.0326
NP_440147.1_4 Forward -205 -192 10.1474 0.0355
NP_440147.1_4 Reverse -192 -205 1.00259 0.242
NP_440147.1_4 Reverse -61 -74 0.707601 0.247
NP_441550.1_8 Forward -62 -52 17.4824 0.00754
NP_441550.1_8 Forward -205 -195 14.0409 0.0194
NP_441550.1_8 Reverse -49 -59 10.501 0.066
NP_441550.1_8 Reverse -192 -202 8.82935 0.112
NP_441916.1_7 Reverse -51 -61 18.9579 0.00144
NP_441916.1_7 Forward -60 -50 18.4663 0.00144
NP_441916.1_7 Forward -203 -193 10.2065 0.0266
NP_441916.1_7 Reverse -194 -204 7.55152 0.0639
NP_441916.1_7 Forward -357 -347 3.91327 0.198
NP_440206.1_4 Reverse -347 -366 1.76863 0.289
NP_440465.1_10 Forward -63 -44 -0.885524 0.29
NP_440465.1_10 Reverse -48 -67 -0.983855 0.29
NP_441041.1_4 Reverse -306 -325 0.786102 0.0837
NP_441041.1_4 Forward -72 -53 -8.94866 0.209
NP_441041.1_4 Forward -60 -41 -11.2103 0.242
NP_441041.1_4 Reverse -45 -64 -12.8819 0.276
NP_441041.1_4 Forward -296 -277 -13.5702 0.291
NP_441041.1_4 Reverse -352 -371 -13.9635 0.299
NP_441041.1_7 Reverse -191 -203 13.637 0.0485
NP_441041.1_7 Reverse -48 -60 10.2357 0.1
NP_441041.1_7 Forward -206 -194 9.36115 0.114
NP_441041.1_7 Forward -63 -51 8.87526 0.128
NP_442642.1_9 Forward -67 -50 5.05372 0.192
NP_442004.1_6 Reverse -51 -65 7.27608 0.161
NP_441725.1_4 Forward -65 -51 11.012 0.0977
NP_441725.1_5 Reverse -195 -205 9.81313 0.0462
NP_441725.1_5 Forward -59 -49 9.02648 0.0553
NP_441725.1_5 Reverse -52 -62 8.92815 0.0553
NP_441725.1_5 Forward -202 -192 2.04498 0.115
NP_439966.1_7 Reverse -192 -202 17.9741 0.00631
NP_439966.1_7 Reverse -49 -59 17.4824 0.00636
NP_439966.1_7 Forward -62 -52 13.8442 0.0234
NP_439966.1_7 Forward -17 -7 8.23937 0.14
NP_439966.1_9 Reverse -49 -58 10.7178 0.0863
NP_439966.1_9 Forward -50 -41 7.27622 0.253
NP_439966.1_9 Forward -62 -53 0.983037 0.253
NP_439966.1_9 Reverse -192 -201 0.884706 0.253
NP_442941.1_3 Reverse -52 -62 10.9931 0.0116
NP_442941.1_3 Forward -202 -192 10.7964 0.0116
NP_442941.1_3 Forward -59 -49 2.53664 0.14
NP_442941.1_3 Forward -320 -310 0.963343 0.16
NP_440289.1_2 Reverse -191 -204 12.704 0.0139
NP_440289.1_2 Reverse -48 -61 3.46087 0.078
NP_440289.1_2 Forward -206 -193 -2.63565 0.261
NP_440289.1_2 Forward -63 -50 -4.50394 0.288
NP_440983.1_5 Reverse -336 -355 -7.4737 0.291
NP_440260.1_8 Reverse -348 -366 -1.35749 0.233
NP_440260.1_8 Forward -132 -114 -6.4707 0.291
NP_442281.1_1 Reverse -189 -203 10.5204 0.0576
NP_442281.1_1 Reverse -46 -60 9.14375 0.0736
NP_442281.1_1 Forward -65 -51 4.91554 0.176
NP_442281.1_1 Forward -208 -194 4.12889 0.206
NP_442281.1_1 Reverse -121 -135 2.75226 0.257
NP_442281.1_1 Forward -97 -83 2.06395 0.278
NP_441334.1_7 Forward -62 -43 -11.2103 0.12
NP_441334.1_7 Reverse -49 -68 -18.4868 0.275
NP_442256.1_2 Reverse -192 -210 -1.45582 0.174
NP_442256.1_2 Forward -323 -305 -6.37237 0.214
NP_440437.1_1 Reverse -188 -207 -4.03212 0.248
NP_442012.1_1 Reverse -45 -64 9.24257 0.0955
NP_442012.1_1 Forward -66 -47 5.11266 0.154
NP_441087.1_6 Reverse -351 -369 -3.91481 0.296
NP_441457.1_7 Forward -62 -43 10.1275 0.126
NP_441556.1_10 Reverse -46 -60 14.894 0.154
NP_441556.1_10 Forward -208 -194 9.44312 0.298
NP_440498.1_1 Forward -330 -312 4.54237 0.121
NP_440498.1_1 Forward -212 -194 -4.01242 0.285
NP_440375.1_8 Forward -202 -183 4.71934 0.193
NP_441644.1_6 Reverse -51 -61 19.0557 0.000803
NP_441644.1_6 Reverse -194 -204 11.9759 0.0408
NP_441644.1_6 Forward -60 -50 10.1076 0.0628
NP_441644.1_6 Forward -203 -193 7.45273 0.124
NP_443049.1_6 Reverse -193 -203 11.0554 0.282
NP_440867.1_10 Forward -20 -1 1.37609 0.298
NP_441810.1_9 Forward -67 -48 9.93088 0.117
NP_442029.1_6 Forward -65 -46 5.80098 0.248
NP_442029.1_10 Reverse -344 -363 5.211 0.287
NP_442247.1_8 Reverse -192 -206 15.6342 0.247
NP_440253.1_2 Forward -60 -42 -3.71743 0.3
NP_440929.1_8 Forward -60 -51 19.2726 0.000701
NP_440929.1_8 Reverse -51 -60 19.2726 0.000701
NP_440929.1_8 Reverse -194 -203 9.93116 0.0249
NP_440929.1_8 Forward -203 -194 9.83282 0.0254
NP_440929.1_8 Forward -321 -312 4.81794 0.176
NP_442933.1_10 Forward -60 -51 17.601 0.00325
NP_442933.1_10 Reverse -51 -60 17.601 0.00325
NP_442933.1_10 Reverse -194 -203 9.04618 0.063
NP_442933.1_10 Forward -203 -194 8.94785 0.0643
NP_441751.2_8 Reverse -52 -66 5.50613 0.0423
NP_441751.2_8 Forward -202 -188 -0.688726 0.129
NP_442926.1_1 Forward -357 -338 -5.80207 0.278
NP_442926.1_3 Forward -71 -52 11.8975 0.114
NP_442554.1_8 Reverse -52 -62 19.1546 0.00369
NP_442554.1_8 Forward -59 -49 16.008 0.0065
NP_442554.1_8 Forward -202 -192 14.1397 0.0144
NP_442554.1_8 Reverse -195 -205 4.69992 0.176
NP_442554.1_8 Reverse -313 -323 1.74999 0.298
NP_441762.1_7 Forward -61 -49 12.527 0.0142
NP_441762.1_7 Reverse -50 -62 11.7404 0.0142
NP_441762.1_7 Reverse -193 -205 11.5437 0.0142
NP_441762.1_7 Forward -204 -192 4.07055 0.0572
NP_442142.1_4 Forward -206 -193 7.98351 0.125
NP_442142.1_4 Reverse -48 -61 6.60689 0.16
NP_442142.1_4 Forward -63 -50 6.21356 0.17
NP_442142.1_4 Reverse -191 -204 5.23026 0.197
NP_442292.1_1 Reverse -52 -61 17.5026 0.00435
NP_442292.1_1 Forward -202 -193 9.63616 0.0183
NP_442292.1_1 Forward -59 -50 9.63616 0.0183
NP_442292.1_1 Reverse -313 -322 5.3096 0.149
NP_442292.1_1 Reverse -195 -204 0.688044 0.23
NP_442292.1_1 Forward -320 -311 -0.786921 0.287
NP_442476.1_6 Forward -59 -45 13.9626 0.0401
NP_442476.1_6 Forward -202 -188 3.44117 0.156
NP_442476.1_6 Reverse -195 -209 0.687908 0.247
NP_443009.1_2 Reverse -53 -72 8.45592 0.216
NP_443009.1_5 Forward -61 -50 19.626 0.00102
NP_443009.1_5 Forward -204 -193 10.8746 0.0717
NP_443009.1_5 Forward -93 -82 8.31797 0.112
NP_443009.1_5 Reverse -50 -61 7.82632 0.118
NP_442301.1_2 Reverse -350 -369 4.81688 0.272
NP_440397.1_3 Forward -140 -121 16.9124 0.154
NP_441715.1_4 Forward -202 -192 18.8596 0.00741
NP_441715.1_4 Forward -59 -49 9.32148 0.097
NP_441715.1_4 Reverse -52 -62 7.25653 0.108
NP_440183.1_9 Forward -201 -182 -15.7335 0.273
NP_440183.1_9 Reverse -335 -354 -21.0434 0.296
NP_441198.1_8 Forward -62 -52 15.4199 0.0427
NP_440379.1_5 Forward -360 -341 14.2574 0.083
NP_440379.1_5 Reverse -348 -367 -1.08219 0.184
NP_440379.1_5 Forward -69 -50 -11.2103 0.291
NP_441468.1_1 Forward -202 -195 15.8704 0.0124
NP_441468.1_1 Reverse -195 -202 15.8704 0.0124
NP_441468.1_1 Forward -59 -52 15.8704 0.0124
NP_441468.1_1 Reverse -52 -59 15.8704 0.0124
NP_441618.1_3 Forward -203 -184 2.75272 0.228
NP_441020.2_6 Reverse -49 -66 10.9536 0.131
NP_441020.2_6 Forward -359 -342 9.67528 0.165
NP_441020.2_6 Forward -62 -45 8.98696 0.182
NP_441015.1_10 Forward -65 -46 13.3725 0.0566
NP_441015.1_10 Forward -366 -347 -6.49039 0.249
NP_441015.1_10 Forward -356 -337 -7.96535 0.272
NP_441673.1_1 Forward -60 -51 20.8459 0.000698
NP_441673.1_1 Reverse -51 -60 20.8459 0.000698
NP_441673.1_1 Reverse -194 -203 11.1111 0.0121
NP_441673.1_1 Forward -203 -194 11.0128 0.018
NP_441826.1_2 Reverse -45 -59 19.8624 0.00795
NP_441826.1_2 Reverse -188 -202 5.1128 0.0978
NP_441826.1_2 Forward -66 -52 -1.47537 0.248
NP_441826.1_2 Forward -209 -195 -2.06536 0.264
NP_441826.1_5 Forward -59 -40 4.52268 0.254
NP_441330.1_1 Forward -77 -58 -5.31042 0.116
NP_441330.1_1 Reverse -189 -208 -13.9635 0.209
NP_442490.1_9 Forward -60 -41 0.786102 0.167
NP_442490.1_9 Forward -72 -53 0.196116 0.175
NP_442868.1_6 Reverse -192 -202 10.3048 0.038
NP_442868.1_6 Forward -205 -195 8.82982 0.0555
NP_442868.1_6 Forward -62 -52 8.63316 0.0555
NP_442868.1_6 Reverse -49 -59 8.53483 0.0555
NP_442868.1_6 Forward -17 -7 0.766681 0.209
NP_442868.1_6 Reverse -346 -356 0.0783647 0.248
NP_441056.1_1 Forward -203 -184 -2.55715 0.211
NP_442227.1_2 Reverse -353 -372 3.24438 0.219
NP_442227.1_2 Reverse -350 -369 0.0977854 0.253
NP_442361.1_3 Reverse -306 -319 9.55739 0.276
NP_442808.1_1 Reverse -50 -60 18.4657 0.00201
NP_442808.1_1 Forward -204 -194 9.12434 0.0481
NP_442808.1_1 Reverse -193 -203 8.73102 0.0481
NP_442808.1_1 Forward -61 -51 8.73102 0.0481
NP_442808.1_1 Reverse -298 -308 1.5529 0.282
NP_441101.1_10 Reverse -344 -363 15.2408 0.0894
NP_442542.1_2 Reverse -192 -205 7.09911 0.193
NP_442542.1_9 Reverse -187 -201 14.3553 0.107
NP_442542.1_9 Forward -16 -2 9.24208 0.138
NP_442542.1_9 Forward -297 -283 4.42388 0.297
NP_442050.1_1 Forward -303 -284 8.25926 0.253
NP_442050.1_5 Forward -62 -52 17.1874 0.00812
NP_442050.1_5 Reverse -310 -320 9.91099 0.182
NP_442050.1_5 Reverse -49 -59 8.23937 0.234
NP_442050.1_5 Reverse -192 -202 6.96107 0.27
NP_442342.1_9 Reverse -49 -65 17.3648 0.0732
NP_442342.1_9 Reverse -350 -366 3.69678 0.258
NP_441493.2_10 Forward -214 -195 10.2259 0.249
NP_440342.1_2 Forward -360 -341 18.584 0.0939
NP_440342.1_2 Reverse -348 -367 10.0292 0.261
NP_442747.1_1 Forward -372 -353 -7.57203 0.218
NP_440558.1_2 Reverse -48 -67 -2.16383 0.223
NP_440558.1_2 Reverse -339 -358 -3.14714 0.234
NP_442789.1_4 Reverse -49 -68 -8.35868 0.299
NP_442593.1_7 Reverse -179 -198 12.3892 0.252
NP_441518.1_3 Forward -246 -227 -10.1286 0.236
NP_441878.1_6 Forward -61 -51 10.5014 0.0176
NP_441878.1_6 Forward -204 -194 10.4031 0.0176
NP_441878.1_6 Reverse -50 -60 10.4031 0.0176
NP_441878.1_6 Reverse -193 -203 0.668351 0.139
NP_441036.1_8 Reverse -50 -60 17.7779 0.000554
NP_441036.1_8 Forward -61 -51 15.713 0.00724
NP_441036.1_8 Forward -195 -185 9.7148 0.174
NP_441036.1_8 Reverse -193 -203 8.1415 0.176
NP_441036.1_8 Forward -204 -194 6.07655 0.242
NP_441557.1_5 Forward -60 -51 19.9609 0.000699
NP_441557.1_5 Reverse -51 -60 19.9609 0.000699
NP_441557.1_5 Reverse -194 -203 10.8161 0.00464
NP_441557.1_5 Forward -203 -194 10.4228 0.00915
NP_441445.1_1 Reverse -185 -204 0.687771 0.27
NP_442066.2_4 Forward -203 -184 1.0811 0.152
NP_442066.2_4 Forward -60 -41 -2.26216 0.211
NP_442066.2_4 Reverse -348 -367 -9.14533 0.296
NP_442066.2_9 Forward -64 -51 12.0157 0.154
NP_442419.1_2 Reverse -46 -65 4.62101 0.184
NP_442419.1_2 Forward -65 -46 -2.26216 0.247
NP_441308.1_8 Forward -62 -52 12.4681 0.218
NP_441308.1_8 Reverse -49 -59 9.22315 0.226
NP_440101.1_3 Forward -208 -189 2.55606 0.253
NP_440101.1_3 Reverse -46 -65 0.884433 0.289
NP_442192.1_8 Forward -361 -342 15.7324 0.139
NP_440762.1_2 Forward -92 -73 14.6508 0.0948
NP_442183.1_1 Reverse -51 -65 17.9942 0.00913
NP_442183.1_1 Reverse -194 -208 10.226 0.0869
NP_442183.1_1 Forward -60 -46 9.34103 0.0986
NP_442135.1_8 Reverse -183 -201 11.5239 0.207
NP_441574.1_1 Forward -135 -116 7.07928 0.11
NP_441574.1_1 Reverse -51 -70 4.81767 0.129
NP_441574.1_1 Forward -72 -53 -2.75381 0.23
NP_441574.1_1 Forward -60 -41 -2.75381 0.23
NP_441549.1_9 Reverse -47 -65 -7.15901 0.206
NP_442347.1_2 Forward -202 -193 11.1111 0.056
NP_442347.1_2 Forward -59 -50 11.1111 0.056
NP_442347.1_2 Forward -91 -82 6.8829 0.145
NP_442347.1_2 Reverse -52 -61 3.34298 0.284
NP_442645.1_2 Forward -68 -49 -22.9117 0.299
NP_441037.1_4 Forward -62 -52 16.5761 0.0168
NP_441037.1_4 Reverse -49 -59 16.2838 0.0168
NP_441037.1_4 Forward -205 -195 8.19481 0.237
NP_441037.1_4 Reverse -192 -202 6.92787 0.237
NP_441037.1_4 Forward -258 -248 6.05075 0.283
NP_442594.1_7 Forward -214 -195 17.2065 0.0576
NP_441633.1_3 Reverse -49 -62 5.91914 0.0481
NP_441633.1_3 Reverse -192 -205 5.42749 0.0532
NP_441633.1_3 Forward -62 -49 3.95252 0.0699
NP_441633.1_3 Forward -94 -81 -1.75067 0.163
NP_441633.1_3 Reverse -290 -303 -4.40561 0.195
NP_441633.1_3 Reverse -362 -375 -5.29059 0.234
NP_441633.1_3 Forward -205 -192 -6.07724 0.236
NP_440136.1_2 Forward -202 -195 15.9687 0.0123
NP_440136.1_2 Reverse -195 -202 15.9687 0.0123
NP_440136.1_2 Forward -59 -52 15.9687 0.0123
NP_440136.1_2 Reverse -52 -59 15.9687 0.0123
NP_442385.1_6 Forward -371 -352 4.32602 0.277
NP_442590.1_10 Forward -60 -41 7.17762 0.23
NP_442590.1_10 Reverse -336 -355 5.01433 0.267
NP_442590.1_10 Reverse -45 -64 3.93269 0.283
NP_442998.1_10 Forward -201 -194 15.5754 0.0102
NP_442998.1_10 Forward -58 -51 15.5754 0.0102
NP_442998.1_10 Reverse -53 -60 15.5754 0.0102
NP_442998.1_10 Reverse -196 -203 5.84064 0.235
NP_440299.1_1 Reverse -47 -60 17.3249 0.0065
NP_440299.1_1 Forward -64 -51 13.0967 0.0319
NP_440299.1_1 Reverse -344 -357 2.96866 0.265
NP_441799.1_1 Forward -207 -193 19.9601 0.00596
NP_441799.1_1 Forward -64 -50 7.47213 0.141
NP_441799.1_1 Reverse -47 -61 7.17714 0.149
NP_441799.1_1 Reverse -190 -204 3.53891 0.295
NP_442802.1_6 Forward -61 -42 1.57275 0.204
NP_441007.1_10 Forward -65 -52 12.8023 0.0499
NP_441007.1_10 Forward -208 -195 7.29578 0.145
NP_441007.1_10 Reverse -46 -59 2.18257 0.195
NP_441007.1_10 Forward -306 -293 1.00259 0.209
NP_441007.1_10 Forward -140 -127 -0.865694 0.295
NP_442201.1_10 Reverse -183 -202 -13.1769 0.27
NP_442201.1_10 Reverse -40 -59 -13.4719 0.274
NP_442333.2_5 Reverse -295 -314 -13.9635 0.271
NP_440256.1_1 Forward -63 -44 2.75272 0.0604
NP_440256.1_1 Forward -364 -345 -5.80207 0.193
NP_440256.1_1 Reverse -60 -79 -6.09707 0.201
NP_440087.1_1 Reverse -185 -204 6.29264 0.166
NP_442526.1_1 Reverse -363 -382 18.879 0.158
NP_441559.1_8 Reverse -46 -60 2.45787 0.143
NP_441559.1_8 Reverse -189 -203 -6.98191 0.281
NP_441559.1_8 Reverse -347 -361 -7.08024 0.283
NP_441559.1_8 Forward -65 -51 -7.57189 0.295
NP_440915.1_6 Reverse -47 -61 16.5192 0.0183
NP_440915.1_6 Forward -64 -50 13.0776 0.0198
NP_440915.1_6 Reverse -190 -204 9.14437 0.0457
NP_442158.1_4 Forward -338 -328 11.3864 0.278
NP_442855.1_3 Forward -69 -50 11.8975 0.257
NP_440717.1_2 Reverse -212 -231 -10.7186 0.251
NP_442866.1_1 Forward -320 -301 -6.78538 0.26
NP_442866.1_1 Reverse -346 -365 -9.44032 0.293
NP_442866.1_1 Forward -296 -277 -9.83364 0.3
NP_440748.1_4 Forward -366 -347 14.2566 0.288
NP_441464.1_8 Reverse -194 -208 7.17775 0.217
NP_440026.1_4 Forward -318 -299 11.9958 0.239
NP_440695.1_5 Forward -60 -41 3.44104 0.225
NP_441939.1_3 Forward -59 -40 12.2908 0.103
NP_441939.1_3 Reverse -52 -71 10.8159 0.12
NP_441199.1_6 Reverse -47 -66 24.7789 0.00941
NP_441199.1_6 Reverse -341 -360 7.17762 0.12
NP_441494.1_6 Forward -65 -52 9.75405 0.227
NP_441494.1_6 Reverse -46 -59 8.27909 0.23
NP_442993.1_1 Reverse -51 -67 -10.5612 0.222
NP_442386.1_5 Forward -77 -58 5.2102 0.263
NP_442386.1_9 Reverse -193 -202 15.7322 0.0144
NP_442386.1_9 Reverse -50 -59 15.7322 0.0144
NP_442386.1_9 Forward -204 -195 8.35743 0.201
NP_442386.1_9 Forward -61 -52 6.39082 0.219
NP_442386.1_9 Forward -16 -7 4.62087 0.294
NP_440570.1_5 Reverse -302 -321 -2.26216 0.278
NP_441340.1_5 Forward -202 -195 15.6737 0.0124
NP_441340.1_5 Reverse -195 -202 15.6737 0.0124
NP_441340.1_5 Forward -59 -52 15.6737 0.0124
NP_441340.1_5 Reverse -52 -59 15.6737 0.0124
NP_441340.1_5 Reverse -7 -14 4.07068 0.239
NP_441271.1_8 Forward -142 -132 13.7464 0.272
NP_442791.1_5 Reverse -344 -363 -4.32711 0.277
NP_440168.1_9 Forward -214 -195 -1.57384 0.275
NP_440168.1_9 Forward -205 -186 -2.85214 0.285
NP_440146.1_2 Forward -66 -52 16.6175 0.23
NP_442240.1_1 Reverse -340 -359 4.91521 0.266
NP_442240.1_1 Reverse -43 -62 4.52188 0.273
NP_442240.1_1 Reverse -350 -369 3.04693 0.295
NP_442240.1_2 Forward -59 -40 -16.4218 0.246
NP_440161.1_3 Reverse -192 -211 9.0459 0.259
NP_442714.1_7 Reverse -195 -214 0.687771 0.226
NP_440586.1_1 Forward -67 -48 -4.72043 0.278
NP_440586.1_1 Reverse -184 -203 -6.39206 0.299
NP_440586.1_2 Reverse -231 -250 12.4875 0.26
NP_440586.1_8 Forward -202 -195 13.2151 0.026
NP_440586.1_8 Forward -59 -52 13.2151 0.026
NP_440586.1_8 Reverse -195 -202 13.2151 0.026
NP_440586.1_8 Reverse -52 -59 13.2151 0.026
NP_440586.1_8 Reverse -228 -235 8.88855 0.205
NP_440586.1_8 Reverse -307 -314 7.21693 0.27
NP_440586.1_9 Reverse -341 -360 4.42435 0.289
NP_440452.1_1 Forward -302 -284 19.7837 0.0896
NP_440452.1_2 Forward -148 -129 17.1082 0.246
NP_442251.1_6 Forward -202 -195 15.2804 0.0124
NP_442251.1_6 Reverse -195 -202 15.2804 0.0124
NP_442251.1_6 Forward -59 -52 15.2804 0.0124
NP_442251.1_6 Reverse -52 -59 15.2804 0.0124
NP_442251.1_6 Reverse -93 -100 6.43063 0.298
NP_441262.1_3 Reverse -194 -201 14.7888 0.0223
NP_441262.1_3 Reverse -51 -58 14.7888 0.0223
NP_441262.1_3 Forward -60 -53 14.7888 0.0223
NP_441262.1_3 Forward -203 -196 6.52896 0.0809
NP_441262.1_3 Reverse -6 -13 5.44732 0.11
NP_440027.1_3 Reverse -342 -360 11.4247 0.159
NP_440027.1_3 Forward -361 -343 9.85146 0.181
NP_440027.1_3 Reverse -41 -59 1.78836 0.295
NP_440027.1_8 Reverse -60 -79 6.98015 0.27
NP_443051.1_1 Forward -61 -52 19.5676 0.00335
NP_443051.1_1 Reverse -193 -202 10.4228 0.00754
NP_443051.1_1 Reverse -50 -59 10.4228 0.00754
NP_443051.1_1 Forward -204 -195 8.65285 0.029
NP_439937.1_8 Reverse -49 -68 0.884433 0.232
NP_439937.1_8 Forward -356 -337 -1.7705 0.249
NP_439937.1_8 Forward -65 -46 -2.16383 0.256
NP_439937.1_9 Forward -61 -44 1.5131 0.093
NP_439937.1_9 Reverse -50 -67 -8.41828 0.176
NP_439937.1_9 Reverse -193 -210 -16.4814 0.287
NP_441595.1_5 Forward -67 -49 9.36059 0.217
NP_440408.1_10 Forward -66 -47 8.75091 0.176
NP_440408.1_10 Forward -360 -341 7.7676 0.185
NP_440439.1_1 Reverse -48 -61 18.8005 0.0105
NP_440439.1_1 Reverse -191 -204 11.229 0.0339
NP_440439.1_1 Forward -63 -50 10.2457 0.0372
NP_440439.1_1 Forward -364 -351 -1.45568 0.269
NP_442239.1_8 Forward -307 -288 8.25926 0.249
NP_442239.1_8 Reverse -342 -361 7.17762 0.258
NP_440372.1_2 Forward -202 -195 16.3621 0.0124
NP_440372.1_2 Reverse -195 -202 16.3621 0.0124
NP_440372.1_2 Forward -59 -52 16.3621 0.0124
NP_440372.1_2 Reverse -52 -59 16.3621 0.0124
NP_440372.1_2 Reverse -7 -14 4.36568 0.205
NP_440316.1_10 Reverse -193 -203 10.8948 0.218
NP_440316.1_10 Forward -361 -351 6.46988 0.257
NP_440316.1_10 Forward -352 -342 5.97822 0.275
NP_440316.1_10 Forward -291 -281 5.78156 0.281
NP_441803.1_2 Forward -65 -46 15.4374 0.039
NP_441803.1_2 Reverse -340 -359 2.26107 0.215
NP_439977.1_5 Forward -66 -47 6.98095 0.127
NP_439977.1_5 Reverse -45 -64 6.39097 0.133
NP_439977.1_5 Forward -327 -308 1.17943 0.195
NP_440139.1_1 Reverse -188 -207 0.588665 0.287
NP_441572.1_7 Reverse -188 -207 0.884433 0.159
NP_442384.1_10 Forward -60 -47 11.229 0.0372
NP_442384.1_10 Reverse -51 -64 9.65572 0.0508
NP_442384.1_10 Reverse -194 -207 7.98409 0.0711
NP_442384.1_10 Forward -357 -344 1.29759 0.263
NP_442384.1_10 Forward -203 -190 1.29759 0.263
NP_442114.1_4 Forward -203 -192 18.0532 0.107
NP_442114.1_4 Forward -60 -49 12.1534 0.107
NP_441877.1_7 Reverse -46 -65 1.57197 0.242
NP_442790.1_4 Forward -69 -50 -7.86702 0.158
NP_442790.1_4 Reverse -42 -61 -8.35868 0.168
NP_442790.1_4 Reverse -185 -204 -12.2919 0.244
NP_442262.1_10 Forward -202 -195 14.1988 0.0123
NP_442262.1_10 Reverse -195 -202 14.1988 0.0123
NP_442262.1_10 Forward -59 -52 14.1988 0.0123
NP_442262.1_10 Reverse -52 -59 14.1988 0.0123
NP_442262.1_10 Reverse -307 -314 10.7572 0.124
NP_442262.1_10 Reverse -282 -289 7.6106 0.274
NP_441689.1_5 Forward -62 -52 8.43603 0.132
NP_441814.1_5 Forward -130 -111 10.0292 0.204
NP_440344.1_10 Forward -67 -50 0.235503 0.0365
NP_440344.1_10 Forward -210 -193 -3.00942 0.0772
NP_440344.1_10 Reverse -44 -61 -6.25434 0.113
NP_440531.1_6 Reverse -186 -205 2.65439 0.152
NP_441965.1_10 Reverse -80 -96 2.91013 0.28
NP_441898.1_1 Reverse -68 -87 13.2741 0.299
NP_440297.1_9 Reverse -195 -205 1.16001 0.282
NP_440297.1_9 Forward -202 -192 -0.118297 0.282
NP_440297.1_9 Forward -59 -49 -0.216628 0.282
NP_440297.1_9 Reverse -52 -62 -0.314959 0.282
NP_441896.1_3 Reverse -42 -61 3.53937 0.167
NP_441896.1_3 Forward -69 -50 -0.688862 0.244
NP_441896.1_5 Reverse -236 -243 15.3787 0.268
NP_441103.1_2 Reverse -40 -58 12.6047 0.156
NP_440894.1_10 Reverse -46 -65 12.1925 0.135
NP_440894.1_10 Reverse -340 -359 9.53756 0.16
NP_442067.1_4 Forward -20 -1 2.65439 0.289
NP_440999.1_9 Reverse -47 -61 19.1741 0.0136
NP_440999.1_9 Reverse -190 -204 -1.5737 0.242
NP_440999.1_9 Forward -231 -217 -2.36035 0.268
NP_440999.1_9 Reverse -353 -367 -3.147 0.287
NP_440888.1_2 Forward -60 -46 20.6484 0.000502
NP_440888.1_2 Reverse -51 -65 18.5835 0.00223
NP_440888.1_2 Forward -203 -189 12.2903 0.0476
NP_440888.1_2 Reverse -126 -140 8.16044 0.171
NP_440600.1_4 Forward -211 -193 -2.3408 0.195
NP_440491.1_1 Reverse -48 -67 15.006 0.0913
NP_442948.1_2 Forward -61 -42 5.89931 0.246
NP_442277.1_4 Reverse -42 -61 9.24175 0.115
NP_442033.1_10 Forward -62 -43 -12.2919 0.267
NP_442033.1_10 Reverse -49 -68 -14.4552 0.298
NP_441543.1_2 Forward -202 -193 18.486 0.00236
NP_441543.1_2 Forward -59 -50 18.486 0.00236
NP_441543.1_2 Reverse -52 -61 15.9293 0.00518
NP_442845.1_2 Forward -66 -52 16.2242 0.0636
NP_442845.1_2 Reverse -141 -155 6.88276 0.201
NP_442845.1_2 Forward -321 -307 3.63784 0.282
NP_441178.1_6 Reverse -291 -310 3.83357 0.269
NP_441469.1_8 Reverse -193 -202 16.126 0.00797
NP_441469.1_8 Reverse -50 -59 16.126 0.00797
NP_441469.1_8 Forward -204 -195 12.6844 0.0995
NP_441469.1_8 Forward -61 -52 6.5879 0.227
NP_441469.1_8 Reverse -5 -14 5.01461 0.297
NP_443064.1_6 Reverse -51 -61 10.8217 0.13
NP_443064.1_6 Reverse -83 -93 9.07643 0.247
NP_442337.1_8 Forward -314 -295 2.0644 0.221
NP_442578.1_7 Forward -202 -195 14.5921 0.026
NP_442578.1_7 Forward -59 -52 14.5921 0.026
NP_442578.1_7 Reverse -195 -202 14.5921 0.026
NP_442578.1_7 Reverse -52 -59 14.5921 0.026
NP_441462.1_2 Reverse -51 -61 20.2362 0.000805
NP_441462.1_2 Reverse -194 -204 17.8763 0.00406
NP_441462.1_2 Forward -60 -50 11.5831 0.00406
NP_441462.1_2 Forward -203 -193 1.74999 0.0811
NP_441621.1_7 Reverse -49 -63 14.0609 0.0266
NP_441621.1_7 Forward -62 -48 6.48943 0.068
NP_441621.1_7 Forward -205 -191 4.52282 0.0934
NP_441621.1_7 Forward -356 -342 -3.04867 0.188
NP_441621.1_7 Reverse -37 -51 -4.91696 0.248
NP_443062.1_1 Forward -203 -185 14.3964 0.048
NP_443062.1_1 Forward -60 -42 5.81572 0.218
NP_443062.1_6 Forward -211 -192 11.3075 0.105
NP_441601.1_4 Reverse -347 -366 3.04771 0.206
NP_441601.1_4 Reverse -350 -369 2.16274 0.223
NP_441601.1_4 Reverse -294 -313 -3.3438 0.293
NP_442204.1_1 Forward -64 -53 2.51695 0.266
NP_442204.1_1 Reverse -190 -201 1.82863 0.266
NP_442204.1_1 Reverse -302 -313 0.94365 0.281
NP_442204.1_1 Reverse -47 -58 0.648657 0.281
NP_442204.1_5 Forward -213 -194 11.9958 0.0688
NP_442204.1_5 Reverse -41 -60 7.66927 0.125
NP_441560.1_5 Reverse -181 -200 12.6841 0.271
NP_441560.1_8 Forward -65 -46 15.7004 0.0972
NP_441351.1_8 Reverse -49 -68 4.12936 0.225
NP_440516.1_8 Reverse -194 -203 18.9776 0.00442
NP_440516.1_8 Forward -60 -51 16.9127 0.00442
NP_440516.1_8 Reverse -51 -60 16.9127 0.00442
NP_440516.1_8 Forward -203 -194 7.07956 0.0867
NP_440516.1_8 Reverse -6 -15 -0.295266 0.232
NP_441033.1_2 Forward -213 -194 -7.57203 0.293
NP_442428.1_5 Forward -202 -195 15.8704 0.0124
NP_442428.1_5 Reverse -195 -202 15.8704 0.0124
NP_442428.1_5 Forward -59 -52 15.8704 0.0124
NP_442428.1_5 Reverse -52 -59 15.8704 0.0124
NP_442859.1_2 Reverse -52 -71 2.85105 0.262
NP_442120.1_10 Forward -135 -116 2.55606 0.15
NP_442120.1_10 Reverse -45 -64 -16.1268 0.296
NP_441867.1_2 Forward -377 -358 -17.0118 0.291
NP_440673.1_2 Forward -361 -342 13.0235 0.129
NP_440673.1_3 Reverse -196 -203 13.1171 0.0426
NP_440673.1_3 Forward -201 -194 12.4288 0.0426
NP_440673.1_3 Forward -58 -51 12.4288 0.0426
NP_440673.1_3 Reverse -53 -60 12.4288 0.0426
NP_440673.1_7 Forward -201 -182 4.03102 0.189
NP_440718.1_5 Forward -193 -174 6.78429 0.18
NP_440077.1_5 Forward -316 -297 13.5691 0.28
NP_440865.1_9 Forward -66 -47 8.94757 0.0586
NP_441052.1_2 Forward -203 -193 11.0914 0.0285
NP_441052.1_2 Forward -60 -50 10.5014 0.0285
NP_441052.1_2 Reverse -51 -61 10.4031 0.0285
NP_441052.1_2 Forward -83 -73 1.35667 0.248
NP_441052.1_2 Reverse -194 -204 0.668351 0.256
NP_442219.1_8 Reverse -47 -66 7.49067 0.267
NP_442219.1_9 Reverse -195 -204 8.84951 0.0681
NP_442219.1_9 Forward -202 -193 8.35786 0.0681
NP_442219.1_9 Forward -59 -50 8.35786 0.0681
NP_442219.1_9 Reverse -52 -61 8.25953 0.0681
NP_442219.1_9 Forward -255 -246 2.75299 0.233
NP_440436.1_4 Forward -202 -193 18.1905 0.00233
NP_440436.1_4 Forward -59 -50 18.1905 0.00233
NP_440436.1_4 Reverse -52 -61 9.24241 0.0871
NP_440436.1_4 Reverse -195 -204 6.78414 0.147
NP_441884.1_8 Forward -204 -185 -7.76869 0.254
NP_441884.1_8 Forward -61 -42 -8.752 0.262
NP_441884.1_8 Reverse -193 -212 -9.73531 0.268
NP_441884.1_9 Forward -63 -44 -12.4886 0.138
NP_441884.1_9 Reverse -48 -67 -22.3217 0.277
NP_441884.1_9 Reverse -191 -210 -24.5833 0.288
NP_442086.1_6 Forward -72 -53 8.94757 0.274
NP_440314.1_9 Forward -202 -183 -7.57203 0.241
NP_440314.1_9 Reverse -52 -71 -9.53865 0.269
NP_441719.1_4 Forward -202 -195 16.3621 0.0124
NP_441719.1_4 Reverse -195 -202 16.3621 0.0124
NP_441719.1_4 Forward -59 -52 16.3621 0.0124
NP_441719.1_4 Reverse -52 -59 16.3621 0.0124
NP_441733.1_10 Forward -63 -50 15.3589 0.06
NP_441733.1_10 Reverse -191 -204 8.18076 0.14
NP_441004.1_1 Forward -66 -47 1.27776 0.111
NP_441004.1_1 Reverse -181 -200 -16.1268 0.283
NP_441004.1_3 Forward -138 -119 2.55606 0.266
NP_442366.1_3 Reverse -50 -68 -1.84914 0.219
NP_443029.1_8 Forward -382 -363 11.3075 0.293
NP_441115.1_4 Forward -61 -43 24.1094 0.000205
NP_441115.1_4 Reverse -50 -68 13.6864 0.0723
NP_441115.1_8 Reverse -67 -85 12.1139 0.292
NP_442206.1_10 Reverse -312 -327 4.01147 0.179
NP_440328.1_4 Reverse -188 -207 12.8808 0.0497
NP_440328.1_4 Reverse -45 -64 1.37609 0.225
NP_443054.1_2 Forward -62 -48 3.04785 0.24
NP_441851.1_10 Reverse -50 -60 16.008 0.00552
NP_441851.1_10 Reverse -193 -203 8.53483 0.114
NP_441851.1_10 Forward -61 -51 8.53483 0.114
NP_441851.1_10 Forward -204 -194 8.1415 0.122
NP_441851.1_10 Reverse -82 -92 4.89658 0.24
NP_442208.1_5 Forward -359 -340 -2.55715 0.252
NP_442622.1_8 Forward -203 -185 -9.0273 0.138
NP_442856.1_7 Reverse -185 -204 -0.688862 0.209
NP_442856.1_7 Reverse -348 -367 -6.1954 0.295
NP_441668.1_4 Forward -213 -194 9.53756 0.121
NP_442515.1_1 Reverse -50 -64 -1.8687 0.266
NP_442515.1_1 Reverse -291 -305 -3.73699 0.297
NP_442515.1_1 Forward -61 -47 -3.93365 0.298
NP_442515.1_1 Reverse -193 -207 -4.03198 0.298
NP_440593.1_3 Reverse -46 -65 9.14423 0.107
NP_440593.1_3 Forward -65 -46 2.16274 0.178
NP_440593.1_9 Reverse -345 -359 10.9143 0.24
NP_440593.1_9 Reverse -182 -196 8.16106 0.261
NP_440355.1_2 Forward -347 -328 14.9449 0.131
NP_440463.1_6 Reverse -349 -368 8.75091 0.25
NP_440463.1_8 Reverse -350 -369 14.9545 0.168
NP_440463.1_8 Reverse -341 -360 5.07958 0.292
NP_442709.1_3 Forward -210 -191 2.3594 0.296
NP_441349.1_10 Forward -213 -194 0.0977854 0.0906
NP_441349.1_10 Reverse -237 -256 -8.94866 0.28
NP_441409.1_6 Forward -209 -190 -4.91709 0.0958
NP_441409.1_10 Forward -318 -305 21.0615 0.231
NP_440389.1_5 Reverse -44 -63 11.644 0.28
NP_440432.1_9 Forward -202 -187 -1.49507 0.167
NP_440432.1_9 Reverse -248 -263 -4.15 0.198
NP_442843.1_1 Forward -202 -183 -4.72043 0.239
NP_439960.1_10 Forward -145 -127 6.01734 0.144
NP_439960.1_10 Reverse -178 -196 4.73903 0.161
NP_439960.1_10 Reverse -341 -359 -2.63579 0.257
NP_440474.1_8 Reverse -52 -66 10.8154 0.126
NP_440431.1_4 Reverse -379 -398 -10.1703 0.297
NP_442450.1_5 Forward -205 -195 17.6796 0.0267
NP_440588.1_2 Forward -212 -193 15.6341 0.0129
NP_440588.1_2 Reverse -185 -204 -6.58872 0.285
NP_439950.1_1 Reverse -81 -90 12.4878 0.279
NP_440195.1_4 Forward -72 -53 7.96426 0.233
NP_442006.1_2 Reverse -185 -202 -15.8908 0.23
NP_442006.1_2 Forward -351 -334 -16.2841 0.247
NP_442006.1_2 Forward -369 -352 -16.4808 0.254
NP_442006.1_2 Forward -18 -1 -16.8741 0.265
NP_441570.1_1 Forward -60 -42 -8.92897 0.124
NP_441570.1_1 Reverse -194 -212 -13.3539 0.222
NP_441078.1_4 Forward -60 -51 19.6659 0.0007
NP_441078.1_4 Reverse -51 -60 19.6659 0.0007
NP_441078.1_4 Reverse -194 -203 9.93116 0.0203
NP_441078.1_4 Forward -203 -194 9.83282 0.0226
NP_442729.1_8 Forward -64 -51 10.1474 0.125
NP_442729.1_8 Reverse -47 -60 8.47575 0.125
NP_441663.1_8 Reverse -188 -207 15.1424 0.0471
NP_442443.1_1 Reverse -186 -205 -2.65548 0.259
NP_440526.1_3 Forward -59 -48 2.41814 0.267
NP_440526.1_3 Reverse -52 -63 2.41814 0.267
NP_441432.1_3 Forward -256 -237 12.4867 0.275
NP_441432.1_8 Forward -61 -52 16.8143 0.00595
NP_441432.1_8 Reverse -193 -202 8.25953 0.0755
NP_441432.1_8 Reverse -50 -59 8.25953 0.0755
NP_441432.1_8 Reverse -311 -320 4.32629 0.223
NP_442320.1_8 Forward -66 -52 7.66941 0.0189
NP_442320.1_8 Reverse -45 -59 6.3911 0.029
NP_442320.1_8 Reverse -188 -202 -3.24533 0.113
NP_442344.1_7 Forward -202 -183 12.2908 0.0213
NP_441732.1_2 Forward -64 -48 4.28677 0.0141
NP_441732.1_2 Reverse -47 -63 -6.23465 0.0495
NP_440760.1_1 Reverse -51 -70 -2.75381 0.0332
NP_440760.1_1 Reverse -194 -213 -13.3736 0.102
NP_442797.1_7 Reverse -50 -68 4.83737 0.217
NP_442797.1_7 Reverse -341 -359 0.117479 0.278
NP_440131.1_4 Forward -145 -126 3.73603 0.275
NP_441945.1_10 Forward -151 -132 8.45592 0.273
NP_441057.1_4 Forward -367 -349 5.72234 0.195
NP_442353.1_3 Reverse -340 -359 6.68515 0.299
NP_440280.1_4 Forward -136 -122 15.1426 0.298
NP_440713.1_4 Reverse -41 -60 4.52268 0.226
NP_442489.1_7 Forward -60 -51 20.1576 0.000695
NP_442489.1_7 Reverse -51 -60 20.1576 0.000695
NP_442489.1_7 Reverse -194 -203 10.4228 0.0151
NP_442489.1_7 Forward -203 -194 10.3245 0.0193
NP_441830.1_2 Forward -360 -341 0.687771 0.227
NP_440559.1_1 Reverse -195 -204 9.14451 0.0586
NP_440559.1_1 Forward -202 -193 8.75118 0.0586
NP_440559.1_1 Forward -59 -50 8.75118 0.0586
NP_440559.1_1 Reverse -52 -61 8.65285 0.0586
NP_441659.2_8 Reverse -51 -61 20.9245 0.000805
NP_441659.2_8 Forward -60 -50 11.9764 0.0147
NP_441659.2_8 Reverse -194 -204 9.81313 0.0269
NP_441659.2_8 Forward -203 -193 2.43831 0.2
NP_441092.1_6 Forward -359 -340 8.84924 0.233
NP_440363.1_9 Forward -366 -348 14.5721 0.217
NP_442913.1_10 Reverse -42 -61 6.39097 0.0612
NP_442913.1_10 Forward -212 -193 -4.72043 0.244
NP_441040.1_2 Reverse -43 -62 -16.3235 0.295
NP_442008.1_2 Forward -206 -187 7.66927 0.207
NP_442346.1_1 Forward -59 -40 13.6675 0.27
NP_442346.1_5 Forward -61 -51 16.303 0.00248
NP_442346.1_5 Forward -204 -194 14.1397 0.0164
NP_442346.1_5 Reverse -50 -60 9.02648 0.118
NP_440545.1_3 Forward -64 -47 18.0334 0.0107
NP_440545.1_3 Reverse -47 -64 11.0519 0.028
NP_440545.1_3 Forward -361 -344 -4.87771 0.235
NP_440545.1_3 Forward -207 -190 -4.87771 0.235
NP_440545.1_3 Forward -370 -353 -5.66436 0.256
NP_440545.1_3 Reverse -308 -325 -6.64766 0.285
NP_440545.1_3 Reverse -272 -289 -6.746 0.287
NP_440545.1_5 Reverse -238 -255 4.16874 0.26
NP_440831.1_3 Reverse -185 -204 17.551 0.0749
NP_440831.1_9 Forward -70 -51 27.0405 0.0037
NP_440486.1_6 Forward -374 -355 7.96426 0.253
NP_440459.1_2 Forward -62 -45 9.57695 0.224
NP_441653.1_2 Reverse -40 -59 24.8857 0.00969
NP_440010.1_4 Reverse -47 -66 -1.27961 0.267
NP_440010.1_10 Forward -65 -46 4.03102 0.248
NP_442603.1_7 Forward -60 -46 12.8803 0.0937
NP_442603.1_7 Reverse -194 -208 7.47213 0.205
NP_441585.1_6 Reverse -186 -205 20.1564 0.147
NP_441888.1_7 Reverse -46 -60 4.12949 0.225
NP_441888.1_7 Reverse -189 -203 3.8345 0.225
NP_441050.1_5 Reverse -227 -245 -1.55415 0.265
NP_440449.1_6 Reverse -43 -61 20.2192 0.036
NP_440449.1_6 Forward -68 -50 14.8697 0.0924
NP_441948.1_4 Forward -210 -192 0.510803 0.136
NP_441948.1_4 Reverse -44 -62 -1.45582 0.146
NP_441948.1_4 Reverse -32 -50 -2.93078 0.179
NP_441948.1_4 Reverse -187 -205 -5.29072 0.26
NP_440170.1_6 Forward -65 -46 10.9142 0.298
NP_441502.1_3 Forward -62 -43 10.4225 0.21
NP_441502.1_3 Forward -74 -55 5.99764 0.282
NP_441833.1_4 Forward -202 -195 15.9687 0.0124
NP_441833.1_4 Reverse -195 -202 15.9687 0.0124
NP_441833.1_4 Forward -59 -52 15.9687 0.0124
NP_441833.1_4 Reverse -52 -59 15.9687 0.0124
NP_442162.1_9 Forward -202 -195 16.2637 0.0124
NP_442162.1_9 Reverse -195 -202 16.2637 0.0124
NP_442162.1_9 Forward -59 -52 16.2637 0.0124
NP_442162.1_9 Reverse -52 -59 16.2637 0.0124
NP_442162.1_9 Reverse -7 -14 3.4807 0.246
NP_442162.1_9 Forward -14 -7 3.38237 0.276
NP_440671.1_4 Reverse -188 -202 9.43936 0.184
NP_441915.1_4 Forward -361 -342 12.0933 0.229
NP_442199.1_5 Forward -68 -49 8.65258 0.0695
NP_442199.1_5 Reverse -43 -62 -5.80207 0.254
NP_442140.1_3 Forward -59 -49 17.4829 0.0159
NP_442140.1_3 Reverse -195 -205 15.3197 0.0412
NP_442140.1_3 Forward -202 -192 14.238 0.0486
NP_442140.1_3 Reverse -52 -62 7.94484 0.124
NP_441671.1_10 Forward -372 -353 0.687771 0.281
NP_441671.1_10 Reverse -183 -202 -0.000545616 0.288
NP_440875.1_9 Forward -201 -191 17.327 0.0126
NP_440875.1_9 Forward -58 -48 15.2829 0.0295
NP_440875.1_9 Reverse -53 -63 8.66404 0.233
NP_441813.1_5 Reverse -192 -202 19.4496 0.00647
NP_441813.1_5 Reverse -49 -59 10.0098 0.0208
NP_441813.1_5 Forward -205 -195 8.82982 0.0367
NP_441813.1_5 Forward -62 -52 8.73149 0.0367
NP_441813.1_5 Forward -17 -7 6.76487 0.0792
NP_440590.1_4 Forward -59 -46 22.0454 0.00377
NP_440590.1_4 Reverse -52 -65 11.1307 0.0221
NP_440590.1_4 Forward -202 -189 3.65753 0.0702
NP_440590.1_4 Reverse -42 -55 -4.9956 0.272
NP_440567.1_1 Reverse -52 -66 15.1426 0.0179
NP_440567.1_1 Forward -59 -45 11.406 0.0286
NP_440567.1_1 Reverse -195 -209 6.48943 0.0831
NP_440567.1_1 Forward -202 -188 0.589577 0.24
NP_442497.1_10 Reverse -52 -61 17.601 0.00813
NP_442497.1_10 Reverse -195 -204 10.8161 0.0087
NP_442497.1_10 Forward -202 -193 10.4228 0.0087
NP_442497.1_10 Forward -59 -50 10.4228 0.0087
NP_440821.1_4 Reverse -49 -59 18.7612 0.00422
NP_440821.1_4 Forward -62 -52 10.7964 0.0146
NP_440821.1_4 Reverse -192 -202 10.2065 0.0163
NP_440821.1_4 Forward -205 -195 8.63316 0.0454
NP_440821.1_4 Reverse -4 -14 -0.708283 0.287
NP_440821.1_4 Reverse -310 -320 -0.806614 0.296
NP_441239.1_9 Forward -62 -50 17.4436 0.0146
NP_441239.1_9 Reverse -49 -61 16.0669 0.0175
NP_441239.1_9 Forward -205 -193 13.0187 0.0389
NP_441239.1_9 Reverse -192 -204 8.20045 0.141
NP_441239.1_9 Reverse -340 -352 4.26721 0.256
NP_441239.1_9 Forward -74 -62 3.67722 0.279
NP_441727.1_3 Forward -67 -48 4.32602 0.264
NP_441892.1_1 Forward -69 -52 5.05372 0.105
NP_441892.1_1 Reverse -42 -59 2.10379 0.144
NP_441892.1_1 Forward -212 -195 -3.20608 0.235
NP_441892.1_1 Reverse -185 -202 -4.09106 0.255
NP_441892.1_4 Reverse -341 -360 -1.08219 0.28
NP_440665.1_1 Forward -147 -128 -17.2085 0.298
NP_442044.1_1 Forward -65 -46 -10.7186 0.271
NP_442193.1_8 Reverse -48 -67 12.1917 0.234
NP_442643.1_3 Forward -78 -59 2.3594 0.166
NP_440354.1_5 Reverse -48 -67 7.07928 0.174
NP_440354.1_7 Forward -66 -48 7.4923 0.265
NP_442138.1_10 Forward -203 -184 -0.590531 0.159
NP_440546.1_4 Reverse -194 -204 14.0213 0.0459
NP_440546.1_4 Reverse -51 -61 13.5365 0.0459
NP_440546.1_4 Forward -60 -50 11.8882 0.0679
NP_440546.1_4 Forward -203 -193 9.17338 0.151
NP_441230.1_5 Forward -65 -46 4.42435 0.188
NP_441230.1_5 Reverse -46 -65 3.83436 0.191
NP_441230.1_5 Forward -320 -301 -0.197208 0.28
NP_441603.1_5 Reverse -96 -115 14.9449 0.196
NP_440462.1_6 Forward -62 -52 19.4496 0.00371
NP_440462.1_6 Reverse -49 -59 17.9746 0.00578
NP_440462.1_6 Reverse -192 -202 17.2863 0.00752
NP_440462.1_6 Forward -17 -7 3.81494 0.228
NP_442611.1_1 Forward -65 -46 4.81767 0.19
NP_442611.1_1 Forward -366 -347 3.6377 0.207
NP_440868.1_4 Reverse -190 -202 17.3452 0.0124
NP_440868.1_4 Reverse -47 -59 12.527 0.0235
NP_440868.1_4 Forward -207 -195 12.3303 0.0242
NP_440868.1_4 Forward -64 -52 0.333971 0.217
NP_440868.1_4 Forward -19 -7 -0.256015 0.255
NP_442499.1_3 Reverse -311 -329 4.05072 0.289
NP_442499.1_3 Reverse -50 -68 3.75572 0.289
NP_442479.1_9 Reverse -81 -100 -6.49039 0.266
NP_441084.1_6 Forward -62 -48 10.6046 0.234
NP_440653.1_6 Forward -203 -184 15.2408 0.151
NP_440653.1_10 Forward -251 -232 2.75272 0.288
NP_440696.1_3 Forward -361 -343 6.11567 0.189
NP_440696.1_3 Forward -207 -189 -0.570838 0.247
NP_440696.1_3 Reverse -348 -366 -2.53746 0.276
NP_442039.1_4 Forward -202 -195 15.1821 0.0124
NP_442039.1_4 Reverse -195 -202 15.1821 0.0124
NP_442039.1_4 Forward -59 -52 15.1821 0.0124
NP_442039.1_4 Reverse -52 -59 15.1821 0.0124
NP_441811.1_4 Reverse -49 -68 -0.39387 0.295
NP_441811.1_8 Forward -66 -52 9.04604 0.227
NP_441811.1_8 Forward -209 -195 6.09611 0.287
NP_442837.1_3 Forward -202 -195 15.7721 0.0124
NP_442837.1_3 Reverse -195 -202 15.7721 0.0124
NP_442837.1_3 Forward -59 -52 15.7721 0.0124
NP_442837.1_3 Reverse -52 -59 15.7721 0.0124
NP_442053.1_1 Forward -60 -51 18.3876 0.0007
NP_442053.1_1 Reverse -51 -60 18.3876 0.0007
NP_442053.1_1 Reverse -194 -203 17.601 0.00138
NP_442053.1_1 Forward -203 -194 16.2243 0.00451
NP_442053.1_1 Forward -194 -185 8.45619 0.0798
NP_440505.1_3 Reverse -192 -202 15.9097 0.00857
NP_440505.1_3 Forward -62 -52 15.418 0.0114
NP_440505.1_3 Reverse -49 -59 14.1397 0.0235
NP_441203.1_1 Forward -314 -295 -14.5535 0.193
NP_442532.1_7 Reverse -51 -65 15.6342 0.0587
NP_442532.1_7 Forward -60 -46 7.86607 0.171
NP_442532.1_7 Reverse -194 -208 3.24451 0.205
NP_440914.1_1 Reverse -51 -61 16.3248 0.00196
NP_440914.1_1 Forward -60 -50 8.6151 0.186
NP_440914.1_1 Reverse -194 -204 7.24882 0.242
NP_440914.1_1 Forward -203 -193 6.07773 0.297
NP_441011.1_8 Forward -202 -193 16.9127 0.00602
NP_441011.1_8 Forward -59 -50 16.9127 0.00602
NP_441011.1_8 Reverse -52 -61 16.6177 0.00602
NP_441011.1_8 Reverse -195 -204 12.7828 0.0397
NP_442533.1_6 Forward -60 -51 17.2076 0.00137
NP_442533.1_6 Reverse -51 -60 17.2076 0.00137
NP_442533.1_6 Reverse -194 -203 7.86621 0.0862
NP_442533.1_6 Forward -203 -194 7.37455 0.0898
NP_442533.1_6 Reverse -348 -357 3.44131 0.212
NP_442533.1_6 Reverse -352 -361 3.24465 0.219
NP_442541.1_10 Reverse -357 -371 1.17898 0.29
NP_440263.1_5 Forward -34 -20 9.04604 0.294
NP_442232.1_3 Forward -211 -192 -3.14714 0.163
NP_442232.1_3 Forward -68 -49 -4.81876 0.163
NP_443016.1_1 Reverse -188 -207 -7.57203 0.277
NP_441219.1_6 Reverse -184 -202 9.26226 0.276
NP_441482.1_7 Forward -66 -52 6.78443 0.026
NP_441482.1_7 Reverse -45 -59 -8.26021 0.193
NP_441482.1_7 Reverse -188 -202 -10.3252 0.209
NP_441482.1_7 Reverse -342 -356 -10.6202 0.211
NP_441482.1_7 Forward -209 -195 -11.0135 0.229
NP_439944.1_9 Reverse -52 -62 17.7779 0.00341
NP_439944.1_9 Forward -59 -49 10.4031 0.0887
NP_439944.1_9 Forward -320 -310 5.78156 0.221
NP_440816.1_7 Forward -207 -188 8.45592 0.29
NP_440116.1_5 Reverse -48 -65 2.20212 0.279
NP_440116.1_8 Forward -59 -40 -1.57384 0.12
NP_440115.1_6 Reverse -48 -58 9.61647 0.115
NP_440115.1_6 Forward -259 -249 8.1415 0.143
NP_440115.1_6 Forward -63 -53 7.74818 0.146
NP_440115.1_6 Reverse -191 -201 7.64985 0.146
NP_440007.1_9 Reverse -302 -316 0.786239 0.29
NP_441347.1_5 Reverse -179 -193 7.96378 0.298
NP_443045.1_9 Reverse -358 -376 8.57317 0.246
NP_441602.1_3 Forward -65 -46 20.059 0.0354
NP_441602.1_3 Reverse -46 -65 15.8307 0.0525
NP_441602.1_3 Reverse -347 -366 -3.83545 0.253
NP_441170.1_4 Forward -312 -294 12.1139 0.166
NP_441972.1_5 Forward -59 -40 4.62101 0.103
NP_441106.1_1 Forward -61 -52 18.486 0.0028
NP_441106.1_1 Reverse -193 -202 18.191 0.0028
NP_441106.1_1 Reverse -50 -59 18.191 0.0028
NP_439903.1_6 Reverse -333 -352 4.03023 0.203
NP_439903.1_6 Reverse -191 -210 2.16195 0.231
NP_439903.1_6 Reverse -48 -67 -1.08295 0.292
NP_442306.1_10 Reverse -46 -65 -18.5851 0.197
NP_441286.1_1 Forward -61 -49 5.34885 0.0259
NP_441286.1_1 Reverse -50 -62 5.15219 0.0259
NP_441286.1_1 Reverse -193 -205 4.95553 0.027
NP_441286.1_1 Reverse -291 -303 -5.86088 0.229
NP_441385.1_1 Forward -138 -123 18.1711 0.224
NP_440670.1_8 Forward -60 -51 18.3876 0.000699
NP_440670.1_8 Reverse -51 -60 18.3876 0.000699
NP_440670.1_8 Reverse -194 -203 9.04618 0.0606
NP_440670.1_8 Forward -203 -194 8.75118 0.0606
NP_441886.1_2 Forward -146 -127 6.09597 0.26
NP_440886.1_7 Reverse -50 -60 17.7774 0.0011
NP_440886.1_7 Reverse -193 -203 16.4991 0.0104
NP_440886.1_7 Forward -204 -194 8.04271 0.0805
NP_440886.1_7 Forward -61 -51 8.04271 0.0805
NP_440886.1_7 Forward -16 -6 6.27276 0.134
NP_440828.1_4 Reverse -341 -360 -5.80282 0.258
NP_442614.1_2 Forward -301 -287 12.6843 0.151
NP_442614.1_2 Reverse -194 -208 9.63603 0.242
NP_442072.1_9 Forward -61 -43 4.34571 0.0229
NP_442072.1_9 Reverse -50 -68 -3.52077 0.0363
NP_442072.1_9 Forward -204 -186 -21.9087 0.215
NP_440513.1_4 Forward -60 -41 12.9791 0.19
NP_441753.1_10 Forward -299 -280 4.71934 0.193
NP_440907.2_8 Reverse -52 -62 19.1541 0.00362
NP_440907.2_8 Forward -59 -49 17.4824 0.00685
NP_440907.2_8 Forward -202 -192 7.94438 0.117
NP_440907.2_8 Reverse -195 -205 7.0594 0.132
NP_441021.1_1 Reverse -52 -71 -5.80207 0.177
NP_441463.1_3 Reverse -41 -60 1.27776 0.127
NP_441463.1_3 Forward -70 -51 -9.73531 0.284
NP_441626.1_2 Forward -202 -195 15.7721 0.0124
NP_441626.1_2 Reverse -195 -202 15.7721 0.0124
NP_441626.1_2 Forward -59 -52 15.7721 0.0124
NP_441626.1_2 Reverse -52 -59 15.7721 0.0124
NP_442365.1_5 Reverse -349 -368 9.73422 0.202
NP_442365.1_7 Reverse -47 -66 -3.3438 0.217
NP_441589.1_5 Forward -380 -361 15.7877 0.262
NP_442615.1_1 Forward -69 -51 8.67227 0.0275
NP_442615.1_1 Reverse -42 -60 6.70565 0.034
NP_442615.1_1 Reverse -185 -203 -4.20908 0.18
NP_441962.1_4 Forward -65 -46 1.67108 0.103
NP_441962.1_4 Reverse -46 -65 -6.88371 0.183
NP_441962.1_4 Forward -115 -96 -10.7186 0.232
NP_440387.1_1 Reverse -51 -67 17.8564 0.0044
NP_440387.1_1 Forward -60 -44 6.25339 0.0282
NP_440387.1_1 Reverse -194 -210 -5.34967 0.227
NP_440387.1_1 Reverse -348 -364 -5.74299 0.249
NP_440855.1_5 Reverse -350 -369 6.39016 0.285
NP_441431.1_2 Reverse -191 -205 19.2718 0.0129
NP_441431.1_2 Reverse -48 -62 16.9119 0.0308
NP_441488.1_7 Forward -66 -47 24.6805 0.0219
NP_441488.1_8 Forward -320 -306 7.66879 0.231
NP_441836.1_2 Forward -363 -344 -3.73712 0.244
NP_441836.1_2 Forward -66 -47 -5.31042 0.277
NP_441993.1_1 Forward -66 -47 10.1331 0.13
NP_441174.1_2 Reverse -48 -62 14.4542 0.161
NP_441174.1_2 Forward -63 -49 12.4876 0.248
NP_440467.1_3 Forward -59 -40 11.3539 0.278
NP_440114.1_10 Reverse -194 -208 12.3893 0.0845
NP_440114.1_10 Reverse -51 -65 8.35772 0.207
NP_440114.1_10 Forward -203 -189 6.19444 0.282
NP_442437.1_8 Reverse -40 -59 4.62101 0.256
NP_442323.1_7 Reverse -46 -65 9.93006 0.156
NP_440287.1_5 Reverse -354 -373 6.1935 0.294
NP_440287.1_6 Reverse -42 -61 5.30933 0.183
NP_440287.1_6 Forward -62 -43 2.65439 0.232
NP_441272.1_4 Forward -69 -50 2.75272 0.233
NP_440293.1_3 Reverse -235 -254 5.60432 0.192
NP_440293.1_3 Forward -68 -49 0.687771 0.214
NP_440766.1_4 Reverse -2 -16 14.4542 0.0306
NP_440766.1_4 Forward -64 -50 8.35772 0.0871
NP_440766.1_4 Reverse -47 -61 8.06273 0.0871
NP_439988.1_3 Forward -313 -299 8.75105 0.249
NP_441237.1_9 Reverse -195 -205 16.7946 0.0141
NP_441237.1_9 Forward -47 -37 10.0098 0.255
NP_441979.1_5 Forward -66 -47 -2.65548 0.147
NP_442743.1_4 Reverse -195 -214 -3.73712 0.242
NP_442867.1_8 Reverse -127 -146 5.211 0.276
NP_442867.1_8 Forward -316 -297 4.62101 0.278
NP_440457.1_1 Reverse -47 -59 7.21714 0.105
NP_440457.1_1 Reverse -2 -14 6.03717 0.132
NP_440457.1_1 Forward -64 -52 5.44718 0.141
NP_440457.1_1 Reverse -10 -22 1.31728 0.241
NP_440457.1_1 Reverse -190 -202 0.628964 0.25
NP_440798.1_6 Forward -59 -46 13.3923 0.0445
NP_440798.1_6 Forward -202 -189 12.409 0.0468
NP_440801.1_10 Reverse -344 -363 5.99764 0.289
NP_441332.1_6 Forward -17 -7 15.2288 0.135
NP_441436.1_6 Reverse -348 -367 10.4225 0.259
NP_442509.1_9 Forward -60 -50 16.2041 0.00739
NP_442509.1_9 Reverse -194 -204 15.9091 0.00953
NP_442509.1_9 Forward -203 -193 12.4676 0.09
NP_442509.1_9 Reverse -51 -61 8.04271 0.192
NP_440554.1_4 Forward -202 -192 16.4996 0.0189
NP_440554.1_4 Reverse -52 -62 15.418 0.0199
NP_440554.1_4 Forward -59 -49 13.943 0.0218
NP_440554.1_4 Reverse -313 -323 6.46988 0.123
NP_440554.1_4 Forward -14 -4 3.42162 0.23
NP_441885.1_5 Forward -60 -50 11.4848 0.00668
NP_441885.1_5 Reverse -51 -61 11.3864 0.00668
NP_441885.1_5 Reverse -194 -204 2.24165 0.0822
NP_441885.1_5 Forward -203 -193 1.65166 0.106
NP_441885.1_5 Forward -256 -246 -1.69159 0.277
NP_440478.1_10 Forward -359 -345 12.8809 0.142
NP_440898.1_6 Reverse -57 -76 11.0125 0.22
NP_442341.1_7 Forward -61 -47 13.1759 0.0376
NP_442341.1_7 Reverse -50 -64 12.0943 0.0478
NP_442341.1_7 Reverse -193 -207 2.94952 0.239
NP_442341.1_9 Reverse -192 -206 18.0918 0.0208
NP_442341.1_9 Forward -317 -303 4.62054 0.296
NP_441756.1_5 Reverse -340 -359 0.786102 0.224
NP_441756.1_5 Reverse -47 -66 -4.32711 0.294
NP_441756.1_5 Reverse -341 -360 -4.6221 0.295
NP_441756.1_5 Reverse -350 -369 -4.72043 0.295
NP_442395.2_4 Reverse -50 -69 11.8967 0.0862
NP_440423.1_6 Forward -309 -290 -13.3736 0.217
NP_440423.1_6 Reverse -186 -205 -20.5517 0.261
NP_440423.1_6 Forward -264 -245 -21.4367 0.294
NP_443000.1_7 Reverse -192 -202 11.5831 0.0344
NP_443000.1_7 Forward -62 -52 10.7964 0.0345
NP_443000.1_7 Reverse -310 -320 4.99491 0.153
NP_443000.1_7 Reverse -49 -59 2.04498 0.226
NP_441842.1_1 Forward -58 -45 10.2451 0.3
NP_441842.1_10 Reverse -44 -58 13.0776 0.0843
NP_441842.1_10 Forward -67 -53 10.4227 0.165
NP_440275.1_3 Forward -62 -52 18.6629 0.0082
NP_440275.1_3 Reverse -49 -59 17.9746 0.0082
NP_440275.1_3 Reverse -192 -202 15.418 0.0178
NP_440275.1_3 Forward -303 -293 6.56821 0.101
NP_440275.1_3 Forward -205 -195 1.25834 0.291
NP_440091.1_1 Reverse -47 -59 10.1671 0.0498
NP_440091.1_1 Reverse -190 -202 1.41561 0.197
NP_441359.1_5 Reverse -48 -67 6.29264 0.188
NP_442451.1_2 Reverse -43 -62 1.86774 0.143
NP_442451.1_2 Reverse -186 -205 -6.1954 0.232
NP_439962.1_4 Reverse -349 -368 -0.000545616 0.197
NP_439962.1_4 Reverse -340 -359 -2.85214 0.241
NP_439962.1_4 Reverse -343 -362 -7.27704 0.288
NP_439962.1_4 Reverse -293 -312 -7.67036 0.29
NP_439962.1_4 Forward -68 -49 -8.06369 0.292
NP_440149.1_8 Forward -60 -41 -2.75381 0.175
NP_441105.1_1 Forward -134 -115 28.8104 0.000394
NP_441105.1_2 Forward -197 -178 21.2389 0.0449
NP_441105.1_3 Forward -71 -52 29.4987 0.000155
NP_441105.1_3 Reverse -40 -59 -4.6221 0.203
NP_441105.1_5 Forward -325 -307 13.6864 0.29
NP_441105.1_6 Forward -155 -136 22.3206 0.0405
NP_441105.1_7 Forward -176 -157 19.5329 0.236
NP_441105.1_9 Forward -248 -229 19.3707 0.287
NP_440216.1_1 Forward -203 -189 15.4376 0.00367
NP_440216.1_1 Forward -60 -46 8.55439 0.00592
NP_440216.1_1 Reverse -51 -65 -2.85201 0.0608
NP_440216.1_1 Reverse -194 -208 -10.9151 0.153
NP_440216.1_6 Reverse -44 -60 7.92501 0.179
NP_440678.1_9 Forward -65 -46 9.63589 0.279
NP_440172.1_1 Reverse -51 -61 17.5813 0.00421
NP_440172.1_1 Reverse -194 -204 17.2863 0.00544
NP_440172.1_1 Forward -60 -50 8.73149 0.0586
NP_442015.1_10 Reverse -47 -60 12.9006 0.0365
NP_442015.1_10 Forward -207 -194 4.24752 0.177
NP_442015.1_10 Reverse -190 -203 1.9859 0.204
NP_441226.1_7 Forward -202 -195 14.4934 0.0123
NP_441226.1_7 Reverse -195 -202 14.4934 0.0123
NP_441226.1_7 Forward -59 -52 14.4934 0.0123
NP_441226.1_7 Reverse -52 -59 14.4934 0.0123
NP_441226.1_7 Reverse -7 -14 10.0685 0.103
NP_441226.1_7 Reverse -301 -308 5.34865 0.289
NP_442446.1_3 Forward -72 -53 13.8641 0.222
NP_441111.1_7 Forward -202 -194 18.7023 0.00294
NP_441111.1_7 Forward -59 -51 18.7023 0.00294
NP_441111.1_7 Reverse -52 -60 18.7023 0.00294
NP_441111.1_7 Reverse -195 -203 8.96754 0.0463
NP_441111.1_7 Forward -320 -312 -0.570565 0.233
NP_441766.1_2 Forward -203 -194 18.2893 0.00297
NP_441766.1_2 Forward -60 -51 17.5026 0.00297
NP_441766.1_2 Reverse -51 -60 17.5026 0.00297
NP_441766.1_2 Reverse -194 -203 9.14451 0.0337
NP_441766.1_2 Forward -321 -312 2.94966 0.245
NP_442417.1_5 Forward -203 -189 8.25939 0.164
NP_440416.1_9 Reverse -340 -359 -11.5053 0.152
NP_440416.1_9 Forward -67 -48 -13.5702 0.168
NP_440416.1_9 Reverse -187 -206 -14.7502 0.18
NP_440416.1_9 Reverse -56 -75 -14.8485 0.18
NP_440416.1_9 Reverse -341 -360 -18.1918 0.253
NP_440416.1_9 Reverse -280 -299 -21.1417 0.291
NP_443052.1_8 Reverse -41 -60 -5.11376 0.126
NP_443052.1_8 Forward -367 -348 -10.3253 0.207
NP_443052.1_8 Reverse -184 -203 -13.8652 0.299
NP_443052.1_9 Reverse -341 -360 5.99764 0.138
NP_443052.1_9 Reverse -350 -369 4.12936 0.156
NP_443052.1_9 Forward -359 -340 -6.88371 0.289
NP_441019.1_2 Forward -377 -358 12.2908 0.197
NP_440591.1_9 Forward -67 -49 14.2771 0.0893
NP_442154.1_1 Forward -359 -341 -11.5839 0.215
NP_442154.1_1 Forward -311 -293 -17.1888 0.249
NP_441430.1_6 Forward -362 -343 14.1591 0.179
NP_441430.1_6 Reverse -46 -65 11.9958 0.238
NP_440261.1_5 Forward -59 -46 6.80412 0.0316
NP_440261.1_5 Forward -202 -189 6.70579 0.0318
NP_440261.1_5 Reverse -195 -208 -2.53732 0.0924
NP_440261.1_5 Reverse -52 -65 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACAGTGATATATTTGTTTCTCTGCAGGGTCGGGTGCAGAGGGCAGCGGCGGCCCGGGCGGACATTTTTGTTAGTATCCATGCGAACTCCATCGGGTTGGGGCGGCCGGAAGTCAATGGGGTGGAAACCTATTATTTCCAAACGGGGCGTTCCTTAGCCCAAACCATTCATCGCAGTATCCTACAGCGGCTTAATGTGCGCGATCGCCGGGTGCGCCAGGCTAGATTTTATGTGTTGCGCCGTACTTCCATGCCTTCTACCCTAGTGGAGGTGGGTTTTGTCACGGGGAGTCAAGATAGTCGCAATCTTAGTAATCCCCGCTTTCAACAGCAAATGGCTGAGGCGATCGCCGCCGGTATCGTACAGTATTTGAAGTAAGTTCACCCCCCGACCGCAGTCGA

CDS

ATGTTTTCCCCCGACCCCATACTTCCCGACGACGGCCAACATCCCTGGCGTTACCGACTAGACCAGTTCACCAAGGAGGAACAAACCGCCCTAGGGGCCCTGGCCTGGGCGTTTTACCAACAATGGCCAGCCAAAGAACAGTATTTAGGTTTGGACCTCCATCCTCAAGCCCATTTCATTAGCTGTGCTCCCCAGGCGATCGCCCAACTCAATGACCAGGTGAACGGCCGCATCCAAGAAATGGTGGGAATTTTGTACGGTTATGACCCGAGAACAGAAGTGGCCATTTTTGTCATTGGCCCCACCCAATTCAAACTGCTCTTTTTCCAGCCAATTCCCGACCCCGCCAGTTGTTTTGCCGCATTGGGACTGACCATTGAGGAACTCAAACACAGGCTGGAAAAGACACTCCAGGAAAAACTAGCCTAG

Protein

MFSPDPILPDDGQHPWRYRLDQFTKEEQTALGALAWAFYQQWPAKEQYLGLDLHPQAHFISCAPQAIAQLNDQVNGRIQEMVGILYGYDPRTEVAIFVIGPTQFKLLFFQPIPDPASCFAALGLTIEELKHRLEKTLQEKLA