Your browser is old and dusty. Try Google Chrome!

Details for slr1909

ORF slr1909
Accession NP_440450.1
Symbol
Category two-component response regulator NarL subfamily
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -321 -335 14.4542 0.138
NP_441061.1_2 Forward -45 -31 3.63784 0.161
NP_441061.1_2 Reverse -168 -182 1.76955 0.183
NP_441061.1_2 Forward -296 -282 -0.688726 0.237
NP_440795.1_7 Forward -175 -168 14.6904 0.0123
NP_440795.1_7 Reverse -168 -175 14.6904 0.0123
NP_441418.1_6 Forward -176 -157 -29.3032 0.221
NP_441418.1_6 Reverse -167 -186 -30.2865 0.267
NP_442291.1_5 Forward -177 -161 6.45005 0.0694
NP_440897.1_6 Forward -91 -72 -2.8529 0.225
NP_441453.1_4 Reverse -167 -175 16.539 0.00633
NP_441453.1_4 Forward -176 -168 16.539 0.00633
NP_441453.1_4 Reverse -37 -45 6.80426 0.121
NP_441453.1_4 Forward -46 -38 6.11594 0.121
NP_442151.1_6 Reverse -167 -181 8.06273 0.183
NP_442151.1_6 Forward -176 -162 6.98109 0.214
NP_440561.1_4 Reverse -318 -337 18.56 0.112
NP_441818.1_1 Forward -175 -164 8.80962 0.277
NP_441818.1_9 Reverse -315 -334 -1.96717 0.201
NP_441818.1_9 Reverse -309 -328 -5.11376 0.248
NP_440226.1_1 Forward -176 -157 15.4374 0.025
NP_440226.1_1 Reverse -167 -186 4.32602 0.196
NP_441630.1_3 Reverse -159 -178 3.93269 0.18
NP_443002.1_5 Forward -335 -317 8.47483 0.297
NP_442173.1_1 Forward -175 -167 15.4574 0.00633
NP_442173.1_1 Reverse -168 -176 15.4574 0.00633
NP_442173.1_1 Forward -45 -37 12.0158 0.0316
NP_442173.1_1 Reverse -38 -46 4.83764 0.241
NP_442752.1_4 Forward -176 -169 13.8055 0.0199
NP_442752.1_4 Reverse -167 -174 13.8055 0.0199
NP_442752.1_4 Reverse -37 -44 13.8055 0.0199
NP_443027.1_4 Reverse -165 -175 13.2547 0.0521
NP_441812.1_3 Forward -177 -163 10.4227 0.222
NP_442975.1_10 Reverse -163 -177 11.7987 0.0482
NP_440784.1_7 Forward -175 -168 15.9687 0.0123
NP_440784.1_7 Reverse -168 -175 15.9687 0.0123
NP_440784.1_7 Reverse -38 -45 6.23397 0.241
NP_440784.1_7 Forward -45 -38 6.13563 0.241
NP_442909.1_7 Reverse -168 -182 9.93039 0.14
NP_442909.1_7 Forward -45 -31 5.99717 0.258
NP_440061.1_9 Forward -178 -164 13.7653 0.076
NP_440061.1_9 Reverse -165 -179 10.5204 0.124
NP_441054.1_4 Reverse -157 -175 0.805796 0.173
NP_442062.1_8 Reverse -167 -177 17.3846 0.00193
NP_442062.1_8 Forward -176 -166 10.3048 0.0493
NP_441859.1_3 Forward -47 -28 9.7334 0.125
NP_440304.1_4 Reverse -165 -175 10.8948 0.051
NP_440304.1_4 Forward -178 -168 1.84832 0.299
NP_442268.1_9 Reverse -318 -337 12.0942 0.295
NP_442242.1_4 Forward -175 -168 14.3954 0.0124
NP_442242.1_4 Reverse -168 -175 14.3954 0.0124
NP_440044.1_1 Forward -327 -308 15.2408 0.139
NP_441619.1_8 Forward -182 -168 8.75042 0.237
NP_440893.1_3 Forward -395 -376 -0.197979 0.28
NP_441208.1_1 Reverse -327 -346 -5.21209 0.281
NP_441208.1_9 Forward -179 -165 16.5192 0.0647
NP_441208.1_9 Reverse -318 -332 10.226 0.192
NP_442742.1_9 Reverse -249 -268 -13.8652 0.284
NP_442110.1_7 Forward -176 -162 1.57289 0.222
NP_441083.1_5 Reverse -167 -177 20.3345 0.00053
NP_441083.1_5 Forward -46 -36 17.7779 0.00336
NP_441083.1_5 Forward -176 -166 11.2881 0.0159
NP_441083.1_5 Reverse -37 -47 -0.904945 0.283
NP_442827.1_4 Forward -328 -309 18.2882 0.0364
NP_441738.1_2 Forward -174 -167 15.28 0.0102
NP_441738.1_2 Reverse -169 -176 15.28 0.0102
NP_441738.1_2 Forward -44 -37 15.28 0.0102
NP_440209.1_1 Reverse -167 -175 18.1123 0.00295
NP_440209.1_1 Forward -176 -168 18.1123 0.00295
NP_440209.1_1 Reverse -37 -45 8.57422 0.0425
NP_440209.1_1 Forward -46 -38 5.52596 0.0821
NP_442889.1_8 Reverse -164 -178 11.4053 0.0733
NP_442889.1_8 Forward -49 -35 11.2087 0.0735
NP_440447.1_6 Reverse -327 -345 0.510803 0.288
NP_440056.1_9 Forward -83 -64 15.2389 0.272
NP_441713.1_1 Forward -182 -163 -5.11376 0.113
NP_440178.1_7 Forward -177 -158 6.19431 0.0153
NP_442570.1_3 Forward -184 -165 -7.08038 0.265
NP_441792.1_1 Forward -53 -34 7.66927 0.179
NP_442111.1_4 Forward -177 -163 10.9143 0.0518
NP_442111.1_4 Forward -47 -33 2.94952 0.259
NP_441624.1_9 Reverse -317 -335 14.8671 0.207
NP_441215.1_1 Reverse -23 -42 6.58763 0.229
NP_440906.1_5 Forward -175 -168 15.8704 0.0124
NP_440906.1_5 Reverse -168 -175 15.8704 0.0124
NP_440906.1_5 Reverse -38 -45 6.23397 0.234
NP_440906.1_5 Forward -45 -38 6.13563 0.241
NP_440747.1_10 Forward -179 -167 24.7201 0.00036
NP_440747.1_10 Reverse -164 -176 7.4138 0.00422
NP_440747.1_10 Reverse -34 -46 5.25052 0.0154
NP_440747.1_10 Forward -49 -37 -12.3507 0.27
NP_441130.1_10 Forward -178 -164 7.57108 0.155
NP_441486.1_1 Reverse -164 -178 6.09611 0.0344
NP_441486.1_1 Forward -179 -165 -2.45868 0.175
NP_441486.1_1 Forward -49 -35 -4.7203 0.205
NP_442634.1_4 Reverse -165 -179 7.86607 0.0479
NP_440403.1_4 Forward -329 -310 -6.98204 0.236
NP_440403.1_10 Reverse -28 -47 3.53937 0.273
NP_442848.1_1 Forward -182 -168 -0.885388 0.263
NP_442848.1_5 Forward -330 -312 -2.53746 0.286
NP_443018.1_3 Forward -175 -168 14.8871 0.0123
NP_443018.1_3 Reverse -168 -175 14.8871 0.0123
NP_443018.1_3 Forward -45 -38 11.7405 0.0655
NP_443018.1_3 Reverse -38 -45 5.44732 0.193
NP_441316.1_7 Reverse -165 -180 2.5365 0.154
NP_441634.1_8 Forward -178 -164 -3.93365 0.295
NP_441634.1_8 Reverse -35 -49 -4.32697 0.295
NP_440376.1_1 Forward -176 -167 19.4693 0.000692
NP_440376.1_1 Reverse -167 -176 19.4693 0.000692
NP_440376.1_1 Reverse -37 -46 5.99792 0.111
NP_440376.1_1 Forward -46 -37 -0.196935 0.285
NP_441588.1_4 Forward -44 -34 9.02648 0.14
NP_441588.1_4 Reverse -169 -179 9.02648 0.14
NP_442687.1_7 Reverse -166 -176 9.02648 0.0994
NP_442687.1_7 Forward -177 -167 8.92815 0.0994
NP_441388.1_10 Reverse -193 -210 15.6222 0.176
NP_441422.1_7 Forward -48 -31 6.13536 0.0992
NP_441422.1_7 Reverse -165 -182 -2.12444 0.209
NP_442296.1_5 Forward -327 -308 12.4875 0.146
NP_442296.1_5 Reverse -158 -177 3.34271 0.251
NP_442658.1_1 Reverse -165 -175 14.2375 0.0237
NP_442658.1_1 Forward -178 -168 6.76441 0.214
NP_442658.1_1 Forward -48 -38 5.28945 0.274
NP_442205.1_9 Reverse -161 -177 -1.61309 0.264
NP_441414.1_9 Reverse -167 -186 5.50599 0.0471
NP_441414.1_9 Reverse -37 -56 -1.67217 0.103
NP_441414.1_9 Forward -176 -157 -9.73531 0.266
NP_440184.1_5 Reverse -27 -46 9.3409 0.189
NP_441487.1_9 Forward -177 -158 -2.95047 0.298
NP_442937.1_5 Reverse -32 -51 7.96426 0.237
NP_441958.1_5 Reverse -166 -176 21.2195 0.000805
NP_441958.1_5 Forward -177 -167 12.2714 0.00183
NP_441958.1_5 Reverse -36 -46 0.865012 0.12
NP_440450.1_7 Forward -41 -27 16.6169 0.207
NP_440203.1_5 Forward -43 -33 14.2375 0.0886
NP_440203.1_5 Reverse -170 -180 11.8776 0.171
NP_439905.1_1 Forward -175 -162 11.0324 0.204
NP_440984.1_7 Reverse -162 -176 18.2892 0.0155
NP_440984.1_7 Forward -181 -167 9.04604 0.131
NP_439990.1_5 Forward -181 -168 7.98409 0.183
NP_439990.1_8 Forward -389 -370 -0.4922 0.283
NP_442911.1_2 Forward -186 -167 -3.14714 0.109
NP_440153.1_5 Forward -175 -161 14.7492 0.0551
NP_442064.1_1 Forward -181 -162 -0.885524 0.146
NP_443055.1_3 Reverse -158 -177 11.0271 0.27
NP_443055.1_6 Forward -176 -158 1.29671 0.233
NP_443055.1_6 Reverse -23 -41 -2.43985 0.295
NP_441099.1_5 Reverse -157 -176 -9.93197 0.237
NP_440475.1_1 Forward -55 -36 10.8762 0.267
NP_441294.1_7 Reverse -163 -177 17.0257 0.0103
NP_441294.1_7 Forward -50 -36 8.67469 0.289
NP_441646.1_1 Forward -183 -164 6.29264 0.173
NP_442431.1_10 Reverse -309 -327 3.16574 0.223
NP_442431.1_10 Reverse -318 -336 1.78911 0.247
NP_441000.1_6 Forward -177 -163 4.32615 0.0957
NP_440484.1_3 Reverse -165 -179 10.7177 0.242
NP_440147.1_4 Forward -178 -165 18.4072 0.00407
NP_440147.1_4 Reverse -165 -178 10.344 0.0355
NP_440147.1_4 Reverse -35 -48 6.60746 0.0881
NP_441175.1_2 Reverse -22 -41 5.70265 0.28
NP_441550.1_8 Reverse -165 -175 15.8108 0.0132
NP_441550.1_8 Forward -178 -168 14.6309 0.0132
NP_441550.1_8 Reverse -35 -45 13.3526 0.0252
NP_441916.1_7 Forward -176 -166 18.9579 0.00144
NP_441916.1_7 Reverse -167 -177 10.3048 0.0261
NP_440206.1_4 Forward -322 -303 -0.00131823 0.289
NP_441041.1_4 Forward -176 -157 -10.0303 0.227
NP_441041.1_4 Reverse -167 -186 -13.9635 0.299
NP_441041.1_7 Forward -179 -167 8.58373 0.133
NP_441041.1_7 Reverse -164 -176 7.32042 0.169
NP_441041.1_7 Forward -49 -37 5.57123 0.25
NP_442396.1_5 Forward -180 -167 11.6223 0.0913
NP_442004.1_6 Reverse -167 -181 4.42448 0.215
NP_441725.1_5 Reverse -168 -178 2.04498 0.115
NP_441725.1_5 Forward -175 -165 1.94665 0.115
NP_439966.1_7 Forward -48 -38 17.6791 0.00636
NP_439966.1_7 Reverse -165 -175 14.3359 0.0203
NP_439966.1_7 Forward -178 -168 7.25606 0.15
NP_442941.1_3 Forward -175 -165 19.2529 0.00262
NP_442941.1_3 Reverse -168 -178 11.0914 0.0116
NP_442941.1_3 Forward -45 -35 1.25834 0.15
NP_440289.1_2 Forward -49 -36 10.4424 0.0265
NP_440289.1_2 Reverse -164 -177 3.26421 0.0811
NP_440983.1_5 Forward -46 -27 -5.40875 0.266
NP_441514.1_4 Reverse -56 -75 15.3182 0.226
NP_442281.1_1 Forward -181 -167 17.6985 0.00542
NP_442281.1_1 Reverse -162 -176 8.25877 0.0832
NP_441334.1_7 Forward -178 -159 -21.1417 0.29
NP_441079.1_7 Reverse -261 -280 -7.57277 0.295
NP_440018.1_1 Reverse -33 -52 12.2908 0.263
NP_442256.1_2 Forward -178 -160 10.0489 0.0965
NP_442256.1_2 Forward -48 -30 -9.0273 0.247
NP_442256.1_2 Reverse -165 -183 -9.12563 0.249
NP_440647.1_9 Forward -178 -160 5.32902 0.23
NP_442500.1_8 Forward -77 -63 13.7454 0.191
NP_442012.1_1 Forward -182 -163 2.94938 0.19
NP_439983.1_7 Reverse -359 -377 8.86894 0.298
NP_442049.1_6 Reverse -29 -48 18.0924 0.0946
NP_441556.1_7 Forward -149 -130 10.4217 0.171
NP_440498.1_1 Reverse -158 -176 0.117479 0.218
NP_441644.1_6 Forward -176 -166 19.0557 0.000803
NP_441644.1_6 Reverse -167 -177 17.3841 0.00127
NP_441644.1_6 Forward -46 -36 14.4342 0.0126
NP_443049.1_6 Reverse -36 -46 14.4711 0.114
NP_442215.1_2 Reverse -165 -181 -5.448 0.25
NP_442215.1_2 Reverse -28 -44 -5.84132 0.26
NP_442177.1_5 Reverse -324 -338 19.4691 0.085
NP_442177.1_5 Reverse -28 -42 11.0127 0.22
NP_440253.1_2 Reverse -37 -55 5.03403 0.0989
NP_440929.1_8 Forward -176 -167 19.2726 0.000701
NP_440929.1_8 Reverse -167 -176 19.2726 0.000701
NP_440929.1_8 Forward -46 -37 7.07956 0.0713
NP_442933.1_10 Forward -176 -167 17.601 0.00325
NP_442933.1_10 Reverse -167 -176 17.601 0.00325
NP_442648.1_1 Forward -144 -125 9.53756 0.248
NP_441751.2_8 Reverse -168 -182 6.29277 0.0368
NP_441751.2_8 Forward -45 -31 -0.590395 0.129
NP_442554.1_8 Forward -175 -165 17.2863 0.00543
NP_442554.1_8 Reverse -168 -178 15.3197 0.00882
NP_442554.1_8 Forward -45 -35 5.48657 0.146
NP_442554.1_8 Reverse -38 -48 2.24165 0.276
NP_442554.1_9 Reverse -308 -327 14.0271 0.279
NP_442554.1_9 Reverse -305 -324 13.9317 0.279
NP_441762.1_7 Reverse -166 -178 0.530633 0.0747
NP_441762.1_7 Reverse -36 -48 -4.68091 0.181
NP_441762.1_7 Forward -177 -165 -6.84419 0.284
NP_442142.1_4 Forward -179 -166 12.8017 0.0409
NP_442142.1_4 Forward -49 -36 7.98351 0.125
NP_442142.1_4 Reverse -164 -177 3.7553 0.246
NP_442142.1_4 Forward -321 -308 3.16532 0.265
NP_442142.1_4 Reverse -350 -363 2.96866 0.269
NP_442292.1_1 Reverse -168 -177 18.486 0.00229
NP_442292.1_1 Forward -175 -166 17.5026 0.00435
NP_442292.1_1 Forward -45 -36 8.65285 0.0335
NP_440919.1_1 Reverse -355 -374 -6.68705 0.258
NP_442476.1_6 Reverse -168 -182 7.47274 0.112
NP_440895.1_6 Reverse -31 -44 11.1307 0.202
NP_441711.1_4 Reverse -158 -177 15.2408 0.0494
NP_443009.1_5 Forward -177 -166 14.5128 0.02
NP_443009.1_5 Reverse -166 -177 10.1862 0.0792
NP_442408.2_1 Forward -176 -157 -0.787193 0.233
NP_441715.1_4 Forward -175 -165 16.7946 0.0106
NP_441715.1_4 Reverse -168 -178 7.94484 0.107
NP_441448.1_2 Forward -286 -267 -1.96793 0.29
NP_440464.1_10 Reverse -168 -178 13.0082 0.169
NP_441468.1_1 Forward -175 -168 15.8704 0.0124
NP_441468.1_1 Reverse -168 -175 15.8704 0.0124
NP_441468.1_1 Reverse -38 -45 6.13563 0.209
NP_441468.1_1 Forward -45 -38 6.0373 0.223
NP_442099.1_1 Reverse -297 -315 15.4571 0.274
NP_441673.1_1 Forward -176 -167 20.8459 0.000698
NP_441673.1_1 Reverse -167 -176 20.8459 0.000698
NP_441673.1_1 Reverse -37 -46 1.37636 0.114
NP_441673.1_1 Forward -46 -37 1.1797 0.163
NP_441731.1_3 Reverse -29 -48 11.7008 0.159
NP_441876.1_9 Forward -51 -41 12.1726 0.267
NP_441426.1_6 Forward -103 -84 12.6841 0.274
NP_441826.1_2 Reverse -31 -45 3.63784 0.107
NP_441826.1_2 Forward -182 -168 2.06454 0.136
NP_441330.1_1 Reverse -162 -181 -3.24547 0.0791
NP_442868.1_6 Reverse -165 -175 10.4031 0.038
NP_442868.1_6 Forward -178 -168 9.81313 0.038
NP_442868.1_6 Forward -48 -38 0.176696 0.247
NP_442868.1_6 Reverse -35 -45 0.0783647 0.248
NP_441612.1_2 Forward -381 -371 11.8409 0.21
NP_441612.1_2 Reverse -167 -177 8.54929 0.21
NP_441612.1_2 Forward -258 -248 7.09709 0.266
NP_443058.1_7 Forward -312 -293 1.67108 0.295
NP_442427.1_8 Forward -55 -36 8.06259 0.203
NP_442808.1_1 Forward -47 -37 19.449 0.00201
NP_442808.1_1 Reverse -166 -176 8.73102 0.0481
NP_442808.1_1 Forward -177 -167 8.63269 0.0481
NP_441882.1_6 Reverse -29 -48 3.04771 0.167
NP_440145.1_3 Forward -186 -167 -0.39387 0.14
NP_442542.1_9 Reverse -160 -174 12.9786 0.108
NP_442050.1_5 Reverse -165 -175 15.9091 0.0091
NP_442050.1_5 Forward -178 -168 7.64939 0.243
NP_441493.2_10 Forward -187 -168 7.17762 0.249
NP_441878.1_6 Reverse -166 -176 10.5014 0.0176
NP_441878.1_6 Forward -177 -167 10.4031 0.0176
NP_441036.1_8 Reverse -166 -176 15.713 0.00724
NP_441036.1_8 Forward -177 -167 8.33817 0.174
NP_441036.1_8 Forward -47 -37 6.07655 0.242
NP_441557.1_5 Forward -176 -167 19.9609 0.000699
NP_441557.1_5 Reverse -167 -176 19.9609 0.000699
NP_441557.1_5 Reverse -37 -46 1.08137 0.0794
NP_441557.1_5 Forward -46 -37 0.589713 0.134
NP_441445.1_1 Forward -185 -166 1.37609 0.257
NP_442066.2_9 Forward -50 -37 14.6706 0.12
NP_441458.1_10 Forward -185 -166 5.50599 0.216
NP_442183.1_1 Reverse -167 -181 8.94771 0.105
NP_442183.1_9 Forward -203 -193 10.6981 0.296
NP_442397.1_9 Reverse -24 -43 6.39097 0.246
NP_442397.1_9 Forward -46 -27 2.55606 0.273
NP_441116.1_9 Reverse -359 -373 10.816 0.297
NP_441549.1_9 Forward -180 -162 -6.37237 0.198
NP_442170.1_5 Forward -176 -157 0.294447 0.224
NP_442347.1_2 Reverse -168 -177 12.4878 0.056
NP_442347.1_2 Forward -45 -36 10.3245 0.058
NP_442347.1_2 Forward -175 -166 3.34298 0.284
NP_442645.1_2 Reverse -159 -178 -21.6334 0.29
NP_441037.1_4 Forward -178 -168 7.9999 0.237
NP_441037.1_4 Reverse -165 -175 7.22024 0.237
NP_442594.1_9 Reverse -61 -80 8.25844 0.232
NP_442317.1_6 Forward -181 -162 3.83436 0.259
NP_441633.1_3 Forward -178 -165 1.10092 0.109
NP_441633.1_3 Reverse -165 -178 -3.71729 0.177
NP_440136.1_2 Forward -175 -168 15.9687 0.0123
NP_440136.1_2 Reverse -168 -175 15.9687 0.0123
NP_440136.1_2 Reverse -38 -45 6.23397 0.171
NP_440136.1_2 Forward -45 -38 6.13563 0.193
NP_442998.1_5 Forward -259 -249 12.1731 0.176
NP_442998.1_5 Reverse -45 -55 11.8781 0.176
NP_442998.1_10 Forward -174 -167 15.5754 0.0102
NP_442998.1_10 Reverse -169 -176 15.5754 0.0102
NP_442998.1_10 Forward -44 -37 15.5754 0.0102
NP_440299.1_1 Forward -180 -167 12.605 0.0362
NP_440299.1_1 Reverse -33 -46 4.24695 0.213
NP_441799.1_1 Forward -180 -166 18.6818 0.00832
NP_441799.1_1 Reverse -163 -177 16.2235 0.0153
NP_441799.1_1 Forward -50 -36 5.30886 0.214
NP_441799.1_9 Forward -177 -158 0.687771 0.213
NP_441007.1_10 Forward -181 -168 8.57408 0.112
NP_441007.1_10 Reverse -162 -175 1.39592 0.203
NP_442334.1_2 Reverse -27 -44 -5.56602 0.207
NP_442201.1_10 Reverse -156 -175 -7.37537 0.2
NP_440256.1_1 Forward -179 -160 14.9458 0.00747
NP_440256.1_1 Reverse -34 -53 -4.81876 0.166
NP_441559.1_8 Reverse -162 -176 1.47456 0.155
NP_440915.1_6 Forward -180 -166 3.14618 0.107
NP_440915.1_6 Reverse -33 -47 2.16287 0.124
NP_440997.1_6 Reverse -288 -307 11.8975 0.234
NP_442785.1_7 Reverse -165 -179 10.7177 0.228
NP_441704.1_4 Reverse -309 -328 12.8808 0.298
NP_440748.1_5 Forward -327 -308 0.0977854 0.252
NP_441464.1_10 Forward -208 -194 14.3559 0.18
NP_441464.1_10 Reverse -316 -330 8.35772 0.284
NP_441464.1_10 Reverse -35 -49 8.16106 0.287
NP_441939.1_3 Forward -175 -156 6.98095 0.217
NP_442993.1_1 Reverse -37 -53 -9.47957 0.186
NP_442993.1_1 Reverse -242 -258 -13.4128 0.291
NP_442386.1_9 Forward -177 -168 13.8639 0.0289
NP_442386.1_9 Forward -47 -38 13.8639 0.0289
NP_442386.1_9 Forward -336 -327 6.9808 0.219
NP_442386.1_9 Reverse -166 -175 6.39082 0.219
NP_441340.1_5 Forward -175 -168 15.6737 0.0124
NP_441340.1_5 Reverse -168 -175 15.6737 0.0124
NP_441340.1_5 Reverse -38 -45 13.5105 0.0314
NP_441340.1_5 Forward -45 -38 5.84064 0.208
NP_441340.1_9 Forward -80 -70 8.15881 0.256
NP_440327.1_6 Forward -315 -296 4.81767 0.266
NP_441132.1_5 Reverse -270 -289 17.0107 0.245
NP_442240.1_2 Forward -175 -156 -12.9802 0.163
NP_442240.1_2 Forward -209 -190 -17.1101 0.256
NP_440161.1_3 Reverse -165 -184 9.0459 0.259
NP_440586.1_1 Reverse -317 -336 -5.70374 0.288
NP_440586.1_8 Forward -175 -168 13.2151 0.026
NP_440586.1_8 Reverse -168 -175 13.2151 0.026
NP_440586.1_8 Forward -45 -38 9.47853 0.146
NP_440586.1_8 Reverse -38 -45 5.74197 0.283
NP_442251.1_6 Forward -175 -168 15.2804 0.0124
NP_442251.1_6 Reverse -168 -175 15.2804 0.0124
NP_440684.1_9 Forward -182 -168 10.1277 0.209
NP_440684.1_9 Reverse -31 -45 9.2427 0.221
NP_441262.1_3 Reverse -167 -174 14.7888 0.0223
NP_441262.1_3 Reverse -37 -44 14.7888 0.0223
NP_441262.1_3 Forward -176 -169 14.7888 0.0223
NP_440027.1_8 Forward -179 -160 5.70185 0.279
NP_443051.1_1 Reverse -166 -175 19.5676 0.00335
NP_443051.1_1 Forward -177 -168 10.4228 0.00754
NP_443051.1_1 Reverse -36 -45 7.47288 0.0571
NP_439984.1_3 Forward -183 -169 15.1419 0.158
NP_440439.1_1 Reverse -164 -177 13.1956 0.0211
NP_440439.1_1 Forward -179 -166 0.0192843 0.203
NP_440372.1_2 Forward -175 -168 16.3621 0.0124
NP_440372.1_2 Reverse -168 -175 16.3621 0.0124
NP_440372.1_2 Reverse -38 -45 13.8055 0.0214
NP_440372.1_2 Forward -45 -38 6.52896 0.188
NP_440770.1_2 Forward -287 -268 24.2863 0.00998
NP_441789.1_7 Reverse -158 -177 5.89851 0.193
NP_441789.1_7 Forward -328 -309 0.195343 0.248
NP_439977.1_5 Forward -52 -33 1.76941 0.188
NP_440139.1_1 Reverse -161 -180 5.60352 0.157
NP_440267.1_2 Reverse -162 -176 11.9953 0.125
NP_440267.1_2 Forward -15 -1 6.0955 0.243
NP_442384.1_10 Reverse -167 -180 15.5556 0.00986
NP_442384.1_10 Forward -176 -163 11.524 0.0348
NP_442384.1_10 Forward -46 -33 5.32916 0.131
NP_442035.1_7 Forward -313 -294 15.5947 0.285
NP_441018.1_7 Reverse -316 -335 6.98095 0.278
NP_442790.1_4 Reverse -28 -47 2.26107 0.0729
NP_442790.1_4 Forward -185 -166 -2.85214 0.119
NP_442262.1_10 Forward -175 -168 14.1988 0.0123
NP_442262.1_10 Reverse -168 -175 14.1988 0.0123
NP_442262.1_10 Forward -45 -38 13.2155 0.0213
NP_441689.1_5 Reverse -165 -175 8.3377 0.132
NP_441689.1_5 Forward -178 -168 5.78111 0.197
NP_441689.1_5 Forward -12 -2 5.38779 0.265
NP_440344.1_10 Forward -53 -36 3.28376 0.0273
NP_440531.1_6 Reverse -159 -178 8.65258 0.0844
NP_440531.1_6 Forward -184 -165 -2.16383 0.246
NP_442910.1_1 Forward -183 -164 3.04771 0.118
NP_441965.1_10 Reverse -164 -180 20.6097 0.0176
NP_440297.1_9 Reverse -168 -178 -0.118297 0.282
NP_440297.1_9 Forward -175 -165 -0.216628 0.282
NP_440100.1_3 Reverse -160 -179 -1.86883 0.166
NP_442187.1_3 Reverse -36 -46 15.6147 0.105
NP_439926.1_5 Forward -330 -316 18.7801 0.275
NP_442280.1_1 Forward -176 -157 7.27595 0.162
NP_440894.1_10 Forward -51 -32 13.8641 0.104
NP_440937.1_5 Reverse -314 -333 14.9458 0.275
NP_440937.1_5 Reverse -236 -255 10.0292 0.275
NP_440999.1_9 Forward -240 -226 8.35772 0.0764
NP_440999.1_9 Forward -50 -36 8.06273 0.0797
NP_440999.1_9 Reverse -163 -177 -0.295402 0.203
NP_440999.1_9 Forward -180 -166 -2.36035 0.268
NP_440888.1_2 Forward -176 -162 15.2402 0.0118
NP_440600.1_4 Forward -184 -166 8.7706 0.0635
NP_440600.1_4 Reverse -159 -177 7.00065 0.0957
NP_442512.1_3 Reverse -237 -256 7.57094 0.3
NP_441543.1_2 Reverse -168 -177 16.9127 0.00359
NP_441543.1_2 Forward -175 -166 15.9293 0.00518
NP_441543.1_2 Forward -45 -36 7.07956 0.131
NP_442845.1_2 Reverse -31 -45 13.7659 0.0921
NP_442845.1_2 Forward -182 -168 5.50613 0.231
NP_441304.1_10 Reverse -357 -366 13.7661 0.239
NP_441551.1_5 Forward -180 -164 6.64602 0.262
NP_441918.1_7 Reverse -135 -154 2.94938 0.265
NP_441829.1_2 Reverse -96 -110 22.32 0.0471
NP_441469.1_8 Reverse -166 -175 6.5879 0.227
NP_441469.1_8 Forward -177 -168 6.48957 0.227
NP_441469.1_8 Forward -47 -38 5.60459 0.258
NP_443064.1_6 Reverse -167 -177 12.5669 0.0796
NP_443064.1_6 Forward -176 -166 10.8217 0.13
NP_442337.1_8 Reverse -20 -39 3.93269 0.21
NP_442578.1_7 Forward -175 -168 14.5921 0.026
NP_442578.1_7 Reverse -168 -175 14.5921 0.026
NP_442578.1_7 Reverse -38 -45 6.0373 0.18
NP_440710.1_1 Reverse -159 -177 9.16393 0.0983
NP_441462.1_2 Forward -176 -166 20.2362 0.000805
NP_441462.1_2 Reverse -167 -177 11.5831 0.00406
NP_441462.1_2 Reverse -37 -47 7.55152 0.0543
NP_443062.1_1 Forward -46 -28 12.7387 0.0744
NP_443062.1_1 Forward -176 -158 10.8861 0.108
NP_443062.1_1 Reverse -167 -185 5.6207 0.224
NP_443062.1_6 Forward -184 -165 2.0644 0.262
NP_440277.1_5 Reverse -14 -32 17.4237 0.138
NP_442204.1_1 Reverse -163 -174 9.59678 0.0736
NP_442204.1_1 Reverse -33 -44 8.7118 0.0852
NP_441560.1_10 Forward -184 -165 7.57094 0.277
NP_440516.1_2 Forward -182 -164 13.2938 0.0588
NP_440516.1_2 Forward -52 -34 6.11567 0.122
NP_440516.1_8 Reverse -37 -46 18.9776 0.00442
NP_440516.1_8 Forward -176 -167 16.9127 0.00442
NP_440516.1_8 Reverse -167 -176 16.9127 0.00442
NP_440516.1_8 Forward -46 -37 5.01461 0.118
NP_442428.1_5 Forward -175 -168 15.8704 0.0124
NP_442428.1_5 Reverse -168 -175 15.8704 0.0124
NP_442428.1_5 Reverse -38 -45 6.13563 0.209
NP_442428.1_5 Forward -45 -38 6.0373 0.212
NP_440673.1_3 Forward -174 -167 12.4288 0.0426
NP_440673.1_3 Forward -44 -37 12.4288 0.0426
NP_440673.1_3 Reverse -169 -176 12.4288 0.0426
NP_440673.1_7 Reverse -156 -175 2.55606 0.224
NP_441052.1_2 Reverse -167 -177 19.9412 0.00106
NP_441052.1_2 Forward -46 -36 10.6981 0.0285
NP_441052.1_2 Forward -176 -166 10.4031 0.0285
NP_442219.1_9 Reverse -168 -177 17.7976 0.00718
NP_442219.1_9 Forward -175 -166 8.25953 0.0681
NP_442219.1_9 Forward -45 -36 7.96454 0.0696
NP_440436.1_4 Reverse -168 -177 17.2072 0.00233
NP_440436.1_4 Forward -175 -166 9.24241 0.0871
NP_440436.1_4 Forward -45 -36 7.57079 0.124
NP_441884.1_8 Forward -177 -158 -11.3086 0.269
NP_440648.1_1 Forward -176 -157 4.62101 0.221
NP_440648.1_3 Reverse -366 -384 17.7187 0.241
NP_441719.1_4 Forward -175 -168 16.3621 0.0124
NP_441719.1_4 Reverse -168 -175 16.3621 0.0124
NP_441719.1_4 Reverse -38 -45 6.82395 0.0855
NP_441719.1_4 Forward -45 -38 6.52896 0.188
NP_441733.1_10 Reverse -34 -47 8.08242 0.143
NP_442813.1_4 Reverse -29 -48 -1.37718 0.239
NP_442366.1_3 Forward -47 -29 8.47561 0.0653
NP_442366.1_5 Reverse -34 -44 14.0409 0.0497
NP_442366.1_5 Forward -179 -169 14.0409 0.0497
NP_440296.1_10 Forward -179 -160 -12.2919 0.269
NP_442694.1_9 Forward -234 -215 7.96426 0.278
NP_442206.1_10 Reverse -167 -182 13.0579 0.0799
NP_442206.1_10 Forward -46 -31 0.569883 0.254
NP_442854.1_6 Forward -176 -157 2.75272 0.272
NP_440328.1_4 Reverse -161 -180 14.6508 0.0367
NP_440328.1_4 Forward -182 -163 6.78429 0.129
NP_443054.1_2 Reverse -165 -179 -0.393733 0.294
NP_442430.1_10 Reverse -157 -176 16.3215 0.105
NP_440864.1_9 Reverse -310 -329 2.3594 0.139
NP_441851.1_10 Forward -177 -167 15.8113 0.00552
NP_441851.1_10 Reverse -166 -176 8.53483 0.114
NP_442001.1_4 Reverse -294 -313 9.63507 0.275
NP_442622.1_8 Forward -176 -158 -9.0273 0.138
NP_441668.1_4 Reverse -27 -46 13.0775 0.0735
NP_441668.1_4 Forward -186 -167 5.211 0.173
NP_442515.1_1 Forward -177 -163 10.0294 0.0568
NP_442515.1_1 Forward -330 -316 -1.08205 0.245
NP_442515.1_1 Reverse -166 -180 -4.52363 0.298
NP_441396.1_5 Forward -205 -196 9.4395 0.205
NP_440165.1_5 Reverse -166 -185 -7.27704 0.259
NP_442709.1_3 Forward -183 -164 8.75091 0.121
NP_441349.1_10 Forward -186 -167 1.96607 0.0784
NP_441349.1_10 Reverse -27 -46 0.196116 0.0902
NP_441349.1_10 Reverse -157 -176 0.0977854 0.0906
NP_441409.1_6 Forward -182 -163 -6.58872 0.13
NP_440432.1_9 Forward -175 -160 14.2379 0.0156
NP_440726.1_5 Forward -301 -282 9.83255 0.253
NP_440431.1_3 Reverse -166 -185 -5.31042 0.181
NP_442450.1_5 Forward -178 -168 7.55152 0.13
NP_440588.1_2 Reverse -28 -47 6.19431 0.0594
NP_441031.1_6 Reverse -322 -341 2.85105 0.194
NP_440195.1_4 Forward -335 -316 5.01433 0.29
NP_440943.1_6 Reverse -24 -43 18.584 0.202
NP_442006.1_3 Reverse -31 -49 -6.4707 0.298
NP_441570.1_1 Forward -176 -158 9.36059 0.0115
NP_441570.1_1 Reverse -167 -185 -6.4707 0.0796
NP_440078.1_4 Reverse -26 -45 10.7175 0.25
NP_441078.1_4 Forward -176 -167 19.6659 0.0007
NP_441078.1_4 Reverse -167 -176 19.6659 0.0007
NP_441078.1_4 Reverse -37 -46 0.196389 0.205
NP_441078.1_4 Forward -46 -37 -0.000272808 0.205
NP_441539.1_1 Reverse -4 -18 15.4369 0.284
NP_441663.1_8 Reverse -161 -180 11.3075 0.0741
NP_442348.1_2 Forward -200 -191 7.76787 0.28
NP_442348.1_2 Forward -199 -190 7.66954 0.28
NP_440707.1_6 Reverse -159 -178 24.3846 0.0066
NP_440707.1_7 Reverse -30 -49 9.93088 0.207
NP_440526.1_3 Reverse -168 -179 8.02298 0.126
NP_440526.1_3 Reverse -83 -94 7.33466 0.153
NP_441432.1_8 Reverse -166 -175 16.8143 0.00595
NP_441432.1_8 Forward -177 -168 16.8143 0.00595
NP_441432.1_8 Reverse -36 -45 14.0611 0.0258
NP_441732.1_2 Reverse -163 -179 -6.7263 0.0495
NP_441732.1_2 Forward -180 -164 -7.61128 0.0861
NP_441030.1_6 Forward -178 -159 14.9694 0.184
NP_442815.1_3 Forward -206 -187 14.5524 0.123
NP_440685.1_6 Forward -179 -160 16.4199 0.217
NP_440760.1_1 Reverse -167 -186 -22.715 0.267
NP_442797.1_1 Forward -328 -309 0.196116 0.223
NP_440131.1_4 Reverse -30 -49 6.78429 0.243
NP_442353.1_4 Reverse -161 -180 2.16195 0.236
NP_442489.1_7 Forward -176 -167 20.1576 0.000695
NP_442489.1_7 Reverse -167 -176 20.1576 0.000695
NP_442489.1_7 Forward -46 -37 0.688044 0.152
NP_442489.1_7 Reverse -37 -46 0.688044 0.152
NP_440559.1_1 Reverse -168 -177 17.4043 0.00658
NP_440559.1_1 Forward -175 -166 8.65285 0.0586
NP_440559.1_1 Forward -45 -36 7.76787 0.0918
NP_441659.2_8 Forward -176 -166 20.9245 0.000805
NP_441659.2_8 Reverse -167 -177 18.1713 0.00133
NP_441659.2_8 Forward -46 -36 5.48657 0.106
NP_442913.1_10 Reverse -158 -177 18.6823 0.0136
NP_442008.1_2 Forward -179 -160 5.60432 0.226
NP_442776.1_1 Reverse -156 -175 5.01433 0.266
NP_442346.1_5 Forward -177 -167 16.6963 0.00248
NP_442346.1_5 Reverse -166 -176 16.303 0.00248
NP_440352.1_5 Forward -89 -70 9.83295 0.289
NP_440545.1_3 Forward -180 -163 4.16874 0.0738
NP_440545.1_3 Reverse -163 -180 -1.73112 0.173
NP_440831.1_3 Reverse -28 -47 9.00822 0.214
NP_441629.1_3 Reverse -160 -179 -4.52452 0.294
NP_440459.1_2 Forward -48 -31 9.57695 0.224
NP_441943.1_5 Forward -25 -6 13.9777 0.288
NP_440847.1_3 Forward -369 -355 11.012 0.275
NP_442603.1_7 Reverse -167 -181 6.19383 0.253
NP_441833.1_4 Forward -175 -168 15.9687 0.0124
NP_441833.1_4 Reverse -168 -175 15.9687 0.0124
NP_441833.1_4 Forward -45 -38 6.52896 0.0924
NP_441833.1_4 Reverse -38 -45 6.23397 0.163
NP_441329.1_4 Reverse -125 -143 10.4106 0.282
NP_441329.1_6 Reverse -179 -198 -3.10391 0.296
NP_441895.1_2 Reverse -197 -216 1.96607 0.0195
NP_441895.1_2 Reverse -196 -215 -7.57203 0.0796
NP_442060.1_10 Reverse -29 -48 10.3242 0.244
NP_441112.1_8 Reverse -264 -283 4.03102 0.232
NP_442162.1_9 Forward -175 -168 16.2637 0.0124
NP_442162.1_9 Reverse -168 -175 16.2637 0.0124
NP_442162.1_9 Forward -45 -38 12.9205 0.0282
NP_442162.1_9 Reverse -38 -45 12.9205 0.0282
NP_440671.1_4 Reverse -31 -45 11.6026 0.129
NP_440772.1_10 Forward -105 -86 12.3233 0.253
NP_442199.1_5 Reverse -159 -178 -2.36049 0.185
NP_442140.1_3 Reverse -168 -178 12.2714 0.0632
NP_442140.1_3 Forward -45 -35 10.2065 0.0902
NP_442140.1_3 Reverse -38 -48 6.76487 0.159
NP_442140.1_3 Forward -175 -165 4.69992 0.238
NP_440875.1_9 Forward -174 -164 13.5309 0.0677
NP_441813.1_5 Reverse -165 -175 18.1713 0.00743
NP_441813.1_5 Forward -48 -38 16.303 0.01
NP_441813.1_5 Forward -178 -168 8.63316 0.0367
NP_441813.1_7 Forward -330 -316 12.2903 0.212
NP_441813.1_7 Forward -336 -322 11.012 0.23
NP_440590.1_4 Reverse -38 -51 3.85419 0.0672
NP_440590.1_4 Forward -175 -162 3.16588 0.0756
NP_440590.1_4 Forward -45 -32 -5.78224 0.289
NP_440590.1_4 Reverse -168 -181 -5.88057 0.293
NP_440567.1_1 Reverse -168 -182 3.53951 0.141
NP_440567.1_1 Forward -175 -161 1.67122 0.196
NP_440567.1_1 Forward -45 -31 0.589577 0.24
NP_442497.1_10 Forward -175 -166 17.601 0.00813
NP_442497.1_10 Reverse -168 -177 10.4228 0.0087
NP_442497.1_10 Forward -45 -36 0.589713 0.153
NP_440821.1_4 Forward -178 -168 9.41981 0.0286
NP_440821.1_4 Reverse -165 -175 2.24165 0.131
NP_440821.1_4 Reverse -35 -45 -0.314959 0.251
NP_441239.1_9 Reverse -165 -177 13.0187 0.0389
NP_441239.1_9 Forward -48 -36 12.6253 0.0446
NP_441239.1_9 Reverse -301 -313 4.66053 0.248
NP_441239.1_9 Forward -178 -166 3.38223 0.285
NP_441727.1_3 Reverse -313 -332 2.65439 0.299
NP_441892.1_1 Forward -185 -168 1.41547 0.152
NP_441892.1_1 Reverse -158 -175 0.92382 0.159
NP_442044.1_1 Forward -335 -316 -14.7502 0.299
NP_440546.1_4 Reverse -37 -47 14.0213 0.0459
NP_440546.1_4 Forward -176 -166 13.5365 0.0459
NP_440546.1_4 Reverse -167 -177 10.046 0.109
NP_441230.1_5 Reverse -162 -181 10.8159 0.0971
NP_440675.1_1 Reverse -317 -336 5.30933 0.223
NP_440462.1_6 Reverse -165 -175 18.7612 0.00454
NP_440462.1_6 Forward -48 -38 13.353 0.0279
NP_440462.1_6 Forward -178 -168 1.35667 0.294
NP_440868.1_4 Reverse -163 -175 17.3452 0.0124
NP_440868.1_4 Forward -180 -168 15.1819 0.0164
NP_440868.1_4 Forward -50 -38 4.5622 0.115
NP_440868.1_4 Reverse -33 -45 3.57889 0.134
NP_440401.1_9 Reverse -194 -201 12.6251 0.287
NP_441474.1_1 Reverse -157 -176 -0.00131823 0.255
NP_442402.1_2 Forward -58 -44 12.3887 0.271
NP_442402.1_4 Forward -230 -211 -6.3928 0.257
NP_441848.1_4 Reverse -182 -198 11.2749 0.228
NP_441084.1_6 Forward -332 -318 10.8954 0.226
NP_440696.1_3 Forward -176 -158 6.90232 0.182
NP_442039.1_4 Forward -175 -168 15.1821 0.0124
NP_442039.1_4 Reverse -168 -175 15.1821 0.0124
NP_442039.1_4 Reverse -38 -45 11.6422 0.0747
NP_442829.1_2 Reverse -191 -207 9.78387 0.287
NP_441926.1_3 Forward -176 -160 5.95839 0.17
NP_440825.1_6 Reverse -358 -377 10.3242 0.285
NP_440825.1_6 Reverse -310 -329 7.96426 0.285
NP_440825.1_7 Reverse -168 -178 12.9096 0.152
NP_440825.1_7 Forward -45 -35 10.9578 0.278
NP_442837.1_3 Forward -175 -168 15.7721 0.0124
NP_442837.1_3 Reverse -168 -175 15.7721 0.0124
NP_442837.1_3 Forward -45 -38 6.0373 0.25
NP_442837.1_3 Reverse -38 -45 6.0373 0.25
NP_442053.1_1 Forward -176 -167 18.3876 0.0007
NP_442053.1_1 Reverse -167 -176 18.3876 0.0007
NP_442053.1_1 Forward -46 -37 14.4544 0.0114
NP_442053.1_1 Reverse -37 -46 7.86621 0.0863
NP_440505.1_3 Reverse -165 -175 17.188 0.00332
NP_440505.1_3 Forward -178 -168 9.22315 0.122
NP_440505.1_3 Reverse -35 -45 7.64985 0.151
NP_442844.1_5 Forward -197 -178 7.27514 0.26
NP_442532.1_4 Reverse -218 -236 11.3584 0.242
NP_440914.1_1 Reverse -167 -177 17.5935 0.000537
NP_440914.1_1 Forward -176 -166 16.3248 0.00196
NP_440914.1_1 Forward -46 -36 13.1043 0.0386
NP_441011.1_8 Forward -175 -166 16.6177 0.00602
NP_441011.1_8 Reverse -38 -47 11.7994 0.0629
NP_441011.1_8 Reverse -168 -177 8.25953 0.144
NP_442101.1_10 Reverse -159 -178 -6.09707 0.183
NP_440724.1_6 Forward -180 -161 9.14423 0.249
NP_442533.1_6 Forward -176 -167 17.2076 0.00137
NP_442533.1_6 Reverse -167 -176 17.2076 0.00137
NP_442533.1_6 Forward -46 -37 4.42462 0.179
NP_442232.1_3 Reverse -29 -48 -14.3569 0.288
NP_442232.1_3 Forward -184 -165 -15.2418 0.289
NP_441482.1_7 Forward -182 -168 -1.27871 0.0666
NP_441482.1_7 Reverse -31 -45 -10.6202 0.211
NP_441482.1_7 Reverse -161 -175 -12.1934 0.29
NP_439944.1_9 Reverse -168 -178 10.5014 0.0887
NP_439944.1_9 Forward -175 -165 9.12481 0.1
NP_441028.1_6 Forward -52 -42 6.0761 0.232
NP_440115.1_6 Reverse -164 -174 13.0581 0.0818
NP_440115.1_6 Forward -179 -169 9.32148 0.115
NP_440115.1_6 Reverse -34 -44 9.32148 0.115
NP_440007.1_9 Forward -169 -155 2.06454 0.281
NP_442728.1_7 Forward -336 -322 21.1407 0.0656
NP_443045.1_2 Reverse -297 -316 14.2574 0.282
NP_441602.1_3 Reverse -315 -334 2.75272 0.191
NP_441106.1_1 Reverse -166 -175 18.486 0.0028
NP_441106.1_1 Forward -177 -168 9.63616 0.0311
NP_439903.1_6 Reverse -164 -183 4.91521 0.188
NP_439903.1_6 Forward -49 -30 -0.39464 0.282
NP_001035870.1_3 Reverse -26 -45 -4.52377 0.278
NP_440797.1_2 Forward -187 -168 16.5632 0.144
NP_441286.1_1 Forward -177 -165 5.93884 0.0258
NP_441286.1_1 Reverse -166 -178 3.48056 0.0467
NP_441286.1_1 Reverse -36 -48 -4.38592 0.156
NP_442674.1_3 Forward -184 -165 3.63691 0.294
NP_440670.1_8 Forward -176 -167 18.3876 0.000699
NP_440670.1_8 Reverse -167 -176 18.3876 0.000699
NP_440670.1_8 Reverse -37 -46 8.75118 0.0606
NP_440670.1_8 Forward -46 -37 6.19458 0.124
NP_440886.1_7 Forward -47 -37 16.4991 0.0104
NP_440886.1_7 Reverse -166 -176 8.04271 0.0805
NP_440886.1_7 Forward -177 -167 7.94438 0.0805
NP_442614.1_2 Reverse -167 -181 8.94771 0.242
NP_442614.1_2 Reverse -37 -51 8.06273 0.255
NP_442072.1_9 Forward -177 -159 -20.9253 0.204
NP_441427.1_2 Forward -215 -196 14.0608 0.076
NP_441753.1_10 Reverse -158 -177 14.5524 0.0769
NP_440907.2_4 Reverse -246 -265 13.0891 0.299
NP_440907.2_8 Forward -175 -165 9.616 0.103
NP_440907.2_8 Reverse -168 -178 7.64939 0.117
NP_440907.2_8 Forward -45 -35 5.87944 0.184
NP_442264.1_2 Forward -186 -169 4.95539 0.288
NP_441463.1_3 Reverse -157 -176 -2.0655 0.149
NP_441626.1_2 Forward -175 -168 15.7721 0.0124
NP_441626.1_2 Reverse -168 -175 15.7721 0.0124
NP_441626.1_2 Reverse -38 -45 12.2322 0.0511
NP_441626.1_2 Forward -45 -38 5.93897 0.231
NP_442365.1_7 Forward -180 -161 0.392778 0.177
NP_442794.1_1 Reverse -33 -45 12.232 0.0721
NP_442794.1_1 Forward -180 -168 12.1337 0.0721
NP_442615.1_1 Forward -185 -167 -1.06249 0.124
NP_442615.1_1 Reverse -28 -46 -1.45582 0.128
NP_442467.1_4 Forward -176 -157 11.6025 0.156
NP_440387.1_1 Reverse -167 -183 10.1866 0.0235
NP_440387.1_1 Forward -176 -160 -0.728113 0.141
NP_440387.1_1 Forward -46 -30 -5.34967 0.227
NP_441431.1_2 Reverse -164 -178 15.6336 0.045
NP_441431.1_2 Forward -49 -35 13.8636 0.0784
NP_441488.1_8 Reverse -32 -46 13.5686 0.146
NP_441836.1_2 Reverse -161 -180 0.392778 0.202
NP_441836.1_2 Reverse -34 -53 -1.18052 0.217
NP_441993.1_1 Forward -176 -157 8.18396 0.151
NP_440114.1_10 Forward -176 -162 17.5025 0.0104
NP_440114.1_10 Reverse -37 -51 11.0127 0.127
NP_440114.1_10 Reverse -242 -256 6.19444 0.282
NP_441510.2_7 Reverse -31 -45 10.9137 0.28
NP_442087.1_2 Reverse -167 -186 12.4373 0.298
NP_440766.1_4 Reverse -33 -47 12.8809 0.0431
NP_440766.1_5 Forward -82 -70 13.2898 0.222
NP_440766.1_5 Reverse -44 -56 6.50989 0.299
NP_439988.1_3 Reverse -322 -336 4.03116 0.296
NP_441237.1_9 Reverse -168 -178 14.828 0.0242
NP_439910.1_2 Forward -54 -37 -22.3806 0.232
NP_440457.1_1 Reverse -33 -45 1.80894 0.223
NP_440457.1_1 Reverse -163 -175 1.31728 0.241
NP_440798.1_6 Forward -175 -162 12.8023 0.0468
NP_440801.1_8 Forward -47 -28 5.50599 0.192
NP_441332.1_6 Forward -337 -327 10.9691 0.278
NP_441436.1_8 Forward -177 -158 13.7658 0.215
NP_442509.1_5 Reverse -159 -176 13.6078 0.259
NP_442509.1_9 Reverse -37 -47 11.9759 0.107
NP_442509.1_9 Reverse -167 -177 8.14104 0.192
NP_442509.1_9 Forward -176 -166 8.04271 0.192
NP_441253.1_1 Reverse -158 -177 3.73603 0.297
NP_440554.1_4 Forward -175 -165 17.9746 0.0131
NP_441885.1_5 Reverse -167 -177 20.9245 0.000538
NP_441885.1_5 Forward -176 -166 11.3864 0.00668
NP_441885.1_5 Forward -46 -36 1.25834 0.11
NP_441885.1_5 Reverse -37 -47 0.0783647 0.183
NP_440478.1_10 Forward -178 -164 7.76774 0.257
NP_442341.1_7 Forward -47 -33 6.29277 0.13
NP_442341.1_7 Reverse -166 -180 3.93283 0.208
NP_442341.1_9 Reverse -165 -179 21.9267 0.00232
NP_442341.1_9 Forward -48 -34 14.2569 0.0695
NP_441756.1_5 Forward -180 -161 -3.3438 0.29
NP_441173.1_9 Reverse -252 -260 12.0154 0.214
NP_442395.2_4 Forward -47 -28 2.06362 0.227
NP_440423.1_6 Reverse -29 -48 -18.6834 0.233
NP_443000.1_7 Reverse -165 -175 20.3345 0.00223
NP_443000.1_7 Forward -178 -168 10.3048 0.0345
NP_443000.1_7 Reverse -35 -45 0.57002 0.294
NP_440275.1_3 Reverse -165 -175 16.1063 0.0155
NP_440275.1_3 Forward -178 -168 8.04317 0.0602
NP_440275.1_3 Reverse -35 -45 5.48657 0.145
NP_440679.1_5 Forward -43 -24 15.1424 0.123
NP_442638.1_3 Reverse -63 -82 12.4613 0.298
NP_440149.1_8 Forward -176 -157 -5.70374 0.231
NP_441105.1_3 Reverse -26 -45 4.52268 0.0784
NP_441105.1_3 Forward -187 -168 -4.91709 0.209
NP_440216.1_1 Forward -176 -162 25.959 0.000481
NP_440216.1_1 Reverse -167 -181 -10.3252 0.145
NP_440216.1_1 Reverse -37 -51 -11.1118 0.163
NP_440172.1_1 Forward -176 -166 17.5813 0.00421
NP_440172.1_1 Reverse -167 -177 15.0247 0.00945
NP_440172.1_1 Reverse -1 -11 4.20827 0.2
NP_440172.1_1 Forward -46 -36 2.24165 0.279
NP_442015.1_10 Forward -180 -167 10.049 0.0415
NP_442015.1_10 Reverse -163 -176 4.14919 0.178
NP_442015.1_10 Reverse -33 -46 0.60927 0.221
NP_441226.1_7 Forward -175 -168 14.4934 0.0123
NP_441226.1_7 Reverse -168 -175 14.4934 0.0123
NP_441226.1_7 Reverse -38 -45 12.7234 0.0312
NP_441226.1_7 Forward -45 -38 11.5435 0.0757
NP_441111.1_7 Forward -175 -167 18.7023 0.00294
NP_441111.1_7 Reverse -168 -176 18.7023 0.00294
NP_441111.1_7 Forward -45 -37 8.86921 0.0589
NP_442379.1_10 Reverse -160 -177 -1.73112 0.223
NP_441766.1_2 Forward -176 -167 17.5026 0.00297
NP_441766.1_2 Reverse -167 -176 17.5026 0.00297
NP_441766.1_2 Forward -46 -37 14.7494 0.00772
NP_442417.1_5 Forward -46 -32 9.04604 0.138
NP_440416.1_1 Reverse -37 -56 -10.817 0.272
NP_440416.1_1 Forward -176 -157 -13.7669 0.283
NP_440416.1_9 Forward -183 -164 -5.60541 0.0813
NP_440416.1_9 Reverse -30 -49 -8.65367 0.119
NP_443052.1_8 Reverse -157 -176 -6.39206 0.143
NP_442154.1_1 Reverse -310 -328 -15.9105 0.228
NP_440261.1_5 Forward -175 -162 5.03416 0.0478
NP_440261.1_5 Reverse -168 -181 -0.964025 0.0655
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTCAATACCAGTTCCCTGTGAACAAAAACATCCAAATTACCCCTGGTGCTTACGTAATTCTTAGCCCCGAAGCCAACAGCAACAACAGTGCCATTTGGGTTGGTGTACTCCGCACCACCTTCAAGTTCTAGGAACTTTGTTGGGGTAAAACCAATACTCACACCAGTAACTTCCAGATATTTAGCCCCCACTTTATTGCTGGGGGTTTTTTCAATACTAATCTTGGCGATCGCCTGCTGGTGGGATGAAAAACTCCATATCCGGCAAAACTATTTAGACGGTACAGTTCGTCGGTTAGGATTATTTAGGGATGATGGTAGTCGGAAAAATTCTCAGATAAACCTTAGTTTTACCCCCGATCGCCAAGGTCAACCTGGTTAACCTGCAAAAATTAATCGCC

CDS

ATGAGCCAATCTAAGGAAAATTATCATTTATTGTTGGTGGACGACGATCCCAATCTACTCCTTTTGGTCAAGGATTATTTGGAATATCAGGGTTACCAAGTCACCACCGCTGGGAACGGTCGTGAAGCTCTGGACCTGCTGACAACTACAGTGCCCGATATGATTGTTTGTGACATCATGATGCCGGAGATGGATGGCTACGCCTTCATCGAGCAGGTGCGCCAAAACCCGGATATTAGTTGGATTCCGGTGATGTTTCTTTCTGCCAAAGGCCAAAGCCACAATCGGGTGAAAGGACTCAACGTGGGAGCGGATATTTATATGGCTAAACCCTTTGAGCCGGAGGAACTGGCCGCCCAAGTGCAATCTTGTCTCCGTCAAGCTGATCGCCTATTGCAACACAATAATCATCCCCTGGAAGACAATGCTCGGGTGCAGGTGGCCAGGGACGTGGAACTCACCCCCACCGAAACCAAGGTGATTCAATTGGTAGCCCAGGGATTGGCCAACCGGGAAATTGCCGACCACTTAAAAGTCAGTCAGCGCACTGTCGAAAGTCATGTATCGAATATGTTAAACAAGACAGGATTACACAACCGCACCGAGTTAGCCCGTTGGGCGATCCAAAAAAGTATTGCTTGA

Protein

MSQSKENYHLLLVDDDPNLLLLVKDYLEYQGYQVTTAGNGREALDLLTTTVPDMIVCDIMMPEMDGYAFIEQVRQNPDISWIPVMFLSAKGQSHNRVKGLNVGADIYMAKPFEPEELAAQVQSCLRQADRLLQHNNHPLEDNARVQVARDVELTPTETKVIQLVAQGLANREIADHLKVSQRTVESHVSNMLNKTGLHNRTELARWAIQKSIA