Your browser is old and dusty. Try Google Chrome!

Details for slr1902

ORF slr1902
Accession NP_440680.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY120a: 851653 - 852454]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -241 -255 16.7159 0.0276
NP_441061.1_2 Forward -248 -234 -0.787057 0.239
NP_440795.1_7 Forward -248 -241 14.6904 0.0123
NP_440795.1_7 Reverse -241 -248 14.6904 0.0123
NP_441418.1_6 Reverse -240 -259 -0.688862 0.0105
NP_441418.1_6 Forward -249 -230 -18.4868 0.0832
NP_442291.1_5 Forward -250 -234 1.43517 0.147
NP_441453.1_4 Reverse -240 -248 16.539 0.00633
NP_441453.1_4 Forward -249 -241 16.539 0.00633
NP_441623.1_1 Reverse -64 -82 -5.38906 0.288
NP_441960.1_3 Reverse -144 -163 14.4648 0.243
NP_440226.1_1 Forward -249 -230 7.47261 0.105
NP_442169.1_1 Forward -315 -296 -2.65548 0.279
NP_440996.1_2 Forward -333 -324 15.241 0.248
NP_442173.1_1 Forward -248 -240 15.4574 0.00633
NP_442173.1_1 Reverse -241 -249 15.4574 0.00633
NP_442752.1_4 Forward -249 -242 13.8055 0.0199
NP_442752.1_4 Reverse -240 -247 13.8055 0.0199
NP_442752.1_4 Reverse -252 -259 4.95566 0.26
NP_443027.1_4 Forward -251 -241 14.828 0.0437
NP_441812.1_3 Reverse -239 -253 8.06273 0.254
NP_442975.1_10 Forward -253 -239 14.0603 0.0459
NP_440784.1_7 Forward -248 -241 15.9687 0.0123
NP_440784.1_7 Reverse -241 -248 15.9687 0.0123
NP_441967.1_5 Forward -70 -51 23.4022 0.013
NP_441250.1_3 Reverse -171 -190 13.1758 0.176
NP_440061.1_9 Forward -251 -237 8.25877 0.177
NP_440110.1_4 Reverse -229 -248 4.42435 0.189
NP_440110.1_8 Reverse -238 -257 0.491109 0.211
NP_441054.1_2 Forward -291 -272 11.5042 0.267
NP_442062.1_8 Reverse -240 -250 19.4496 0.000558
NP_442062.1_8 Forward -249 -239 17.3846 0.00193
NP_441859.1_3 Reverse -239 -258 1.08032 0.296
NP_440304.1_4 Forward -251 -241 10.8948 0.051
NP_440304.1_4 Forward -157 -147 2.83163 0.299
NP_440304.1_4 Reverse -238 -248 1.84832 0.299
NP_442242.1_4 Forward -248 -241 14.3954 0.0124
NP_442242.1_4 Reverse -241 -248 14.3954 0.0124
NP_440044.1_8 Forward -248 -229 1.47442 0.172
NP_439918.1_3 Reverse -237 -256 16.1257 0.113
NP_441619.1_8 Reverse -234 -248 10.6187 0.185
NP_441208.1_1 Reverse -337 -356 0.294447 0.25
NP_441208.1_9 Reverse -237 -251 5.40779 0.267
NP_441594.1_6 Forward -258 -239 1.57275 0.266
NP_442110.1_7 Reverse -240 -254 3.44117 0.21
NP_441925.1_4 Reverse -284 -303 -16.9142 0.287
NP_440769.1_8 Forward -341 -322 15.0441 0.15
NP_440856.1_4 Forward -256 -237 -1.18052 0.193
NP_440856.1_7 Reverse -237 -256 -5.11376 0.224
NP_441083.1_5 Forward -249 -239 20.3345 0.00053
NP_441083.1_5 Reverse -240 -250 11.3864 0.0159
NP_441738.1_2 Forward -247 -240 15.28 0.0102
NP_441738.1_2 Reverse -242 -249 15.28 0.0102
NP_441558.1_5 Forward -251 -232 5.60432 0.245
NP_440209.1_1 Reverse -240 -248 18.1123 0.00295
NP_440209.1_1 Forward -249 -241 18.1123 0.00295
NP_442889.1_8 Forward -252 -238 13.5686 0.0588
NP_441713.1_1 Forward -255 -236 -15.4385 0.263
NP_441770.1_5 Forward -187 -168 10.0292 0.127
NP_441770.1_5 Reverse -156 -175 3.34271 0.229
NP_442706.1_10 Forward -98 -80 13.2938 0.263
NP_441716.1_1 Reverse -240 -254 10.226 0.0968
NP_441716.1_1 Forward -249 -235 4.03116 0.259
NP_441327.1_1 Forward -153 -134 3.92505 0.276
NP_441327.1_5 Reverse -375 -384 14.356 0.192
NP_442111.1_4 Reverse -239 -253 19.6658 0.00373
NP_441624.1_7 Forward -345 -331 8.65272 0.237
NP_440906.1_5 Forward -248 -241 15.8704 0.0124
NP_440906.1_5 Reverse -241 -248 15.8704 0.0124
NP_440747.1_10 Reverse -237 -249 14.887 0.00223
NP_440747.1_10 Forward -252 -240 7.70879 0.00236
NP_442973.1_5 Forward -76 -57 12.7825 0.194
NP_441486.1_1 Forward -252 -238 13.7659 0.00763
NP_441486.1_1 Reverse -237 -251 11.3077 0.0164
NP_442850.1_8 Forward -253 -234 14.0832 0.266
NP_442634.1_3 Reverse -229 -248 10.9134 0.248
NP_442634.1_4 Reverse -238 -252 -1.67204 0.149
NP_441014.1_10 Reverse -239 -258 3.44025 0.214
NP_442848.1_1 Forward -255 -241 -1.5737 0.263
NP_442848.1_1 Reverse -234 -248 -2.75368 0.263
NP_441012.1_4 Forward -253 -240 7.19745 0.272
NP_443018.1_3 Forward -248 -241 14.8871 0.0123
NP_443018.1_3 Reverse -241 -248 14.8871 0.0123
NP_443018.1_3 Forward -191 -184 5.34899 0.212
NP_441634.1_8 Reverse -238 -252 -3.147 0.295
NP_440376.1_1 Forward -249 -240 19.4693 0.000692
NP_440376.1_1 Reverse -240 -249 19.4693 0.000692
NP_441588.1_4 Forward -247 -237 15.9097 0.0369
NP_442687.1_7 Forward -250 -240 15.8113 0.0125
NP_442687.1_7 Reverse -239 -249 8.92815 0.0994
NP_441846.1_10 Forward -312 -293 -22.8133 0.266
NP_440642.1_10 Forward -382 -368 1.67063 0.29
NP_440571.1_5 Forward -111 -92 13.6675 0.236
NP_440533.1_9 Reverse -240 -259 10.0292 0.144
NP_440667.1_2 Forward -363 -344 -2.75381 0.232
NP_442296.1_9 Forward -248 -229 9.73422 0.0958
NP_442658.1_1 Forward -251 -241 15.9091 0.00966
NP_442658.1_1 Reverse -238 -248 6.76441 0.214
NP_440493.1_2 Forward -27 -8 31.4654 0.00000438
NP_440141.1_4 Reverse -243 -262 -3.24547 0.296
NP_440141.1_8 Forward -280 -261 4.916 0.278
NP_441855.2_4 Forward -257 -238 9.61947 0.275
NP_442782.1_2 Reverse -229 -243 4.62115 0.251
NP_442782.1_2 Reverse -240 -254 0.88457 0.282
NP_441414.1_9 Forward -249 -230 5.70265 0.0452
NP_441414.1_9 Reverse -240 -259 1.86774 0.0705
NP_442300.1_5 Reverse -238 -257 12.5858 0.282
NP_441256.1_1 Forward -252 -233 -4.81876 0.233
NP_442937.1_5 Reverse -235 -254 10.8159 0.152
NP_441958.1_5 Forward -250 -240 12.2714 0.00183
NP_441958.1_5 Reverse -239 -249 12.2714 0.00183
NP_440203.1_5 Reverse -149 -159 12.9592 0.135
NP_441097.1_2 Reverse -332 -349 3.77542 0.293
NP_442911.1_2 Forward -259 -240 17.994 0.00677
NP_442911.1_2 Reverse -230 -249 0.294447 0.0682
NP_442119.1_2 Forward -157 -138 13.2118 0.275
NP_442064.1_4 Forward -259 -240 7.57013 0.242
NP_443055.1_6 Reverse -232 -250 4.73828 0.181
NP_440138.1_6 Reverse -241 -260 4.42355 0.238
NP_441913.1_1 Forward -338 -322 13.723 0.246
NP_441913.1_3 Reverse -266 -279 16.8684 0.218
NP_441099.1_5 Reverse -230 -249 5.70265 0.0469
NP_441099.1_5 Forward -259 -240 -11.2103 0.273
NP_441099.1_5 Reverse -295 -314 -12.0953 0.294
NP_442002.1_9 Forward -156 -149 11.3472 0.185
NP_442002.1_9 Forward -250 -243 10.7572 0.185
NP_441646.1_1 Reverse -233 -252 -0.4922 0.266
NP_442438.1_10 Forward -254 -240 10.9143 0.0478
NP_441000.1_6 Forward -250 -236 -4.91696 0.254
NP_442771.1_1 Reverse -238 -256 -7.06068 0.169
NP_442870.1_2 Forward -100 -84 16.0865 0.297
NP_440147.1_4 Reverse -238 -251 10.049 0.0355
NP_440147.1_4 Forward -251 -238 3.46087 0.187
NP_441175.1_7 Forward -249 -230 13.3725 0.113
NP_441550.1_8 Reverse -238 -248 14.6309 0.0132
NP_441550.1_8 Forward -251 -241 6.0761 0.214
NP_441916.1_7 Reverse -240 -250 18.4663 0.00144
NP_441916.1_7 Forward -249 -239 10.3048 0.0261
NP_441041.1_4 Reverse -240 -259 2.65439 0.071
NP_441041.1_4 Forward -249 -230 -11.1119 0.241
NP_441041.1_4 Forward -369 -350 -12.1936 0.26
NP_441041.1_7 Forward -252 -240 7.61196 0.162
NP_442396.1_5 Reverse -236 -249 20.1771 0.00762
NP_443063.1_7 Reverse -239 -255 5.17175 0.288
NP_441725.1_4 Forward -254 -240 3.63724 0.278
NP_441725.1_5 Reverse -241 -251 11.2881 0.0247
NP_441725.1_5 Forward -248 -238 2.04498 0.115
NP_439966.1_7 Forward -251 -241 18.4657 0.00473
NP_439966.1_7 Reverse -238 -248 7.25606 0.15
NP_439966.1_9 Forward -251 -242 0.983037 0.253
NP_440736.1_3 Forward -239 -220 0.687771 0.282
NP_442941.1_3 Reverse -241 -251 11.4848 0.0116
NP_442941.1_3 Forward -248 -238 11.0914 0.0116
NP_440289.1_2 Forward -252 -239 11.819 0.0171
NP_440260.1_8 Reverse -231 -249 1.98577 0.182
NP_440260.1_8 Forward -389 -371 -4.50408 0.273
NP_441514.1_1 Forward -83 -73 15.5864 0.274
NP_442281.1_1 Forward -254 -240 20.4518 0.00192
NP_442281.1_1 Reverse -122 -136 2.75226 0.257
NP_442281.1_1 Reverse -235 -249 1.5723 0.296
NP_440177.1_9 Reverse -232 -251 12.9791 0.228
NP_442256.1_2 Reverse -238 -256 -8.83064 0.236
NP_442012.1_1 Reverse -234 -253 -0.983855 0.272
NP_441556.1_4 Forward -258 -239 9.61947 0.297
NP_440498.1_1 Forward -258 -240 -0.669169 0.218
NP_441644.1_6 Forward -249 -239 17.3841 0.00127
NP_441644.1_6 Reverse -240 -250 10.1076 0.0628
NP_442215.1_2 Reverse -238 -254 6.54838 0.0702
NP_442215.1_2 Forward -251 -235 -4.36636 0.232
NP_442215.1_2 Forward -200 -184 -4.95634 0.242
NP_442029.1_6 Reverse -235 -254 7.47261 0.224
NP_440253.1_2 Forward -249 -231 5.03403 0.0989
NP_440253.1_2 Reverse -240 -258 -0.865831 0.226
NP_440929.1_8 Forward -249 -240 19.2726 0.000701
NP_440929.1_8 Reverse -240 -249 19.2726 0.000701
NP_440566.1_2 Forward -247 -228 5.50599 0.278
NP_442933.1_10 Forward -249 -240 17.601 0.00325
NP_442933.1_10 Reverse -240 -249 17.601 0.00325
NP_441751.2_8 Reverse -241 -255 -0.197071 0.125
NP_441751.2_8 Forward -248 -234 -0.787057 0.129
NP_442554.1_8 Forward -248 -238 15.3197 0.00882
NP_442554.1_8 Reverse -241 -251 13.8447 0.0145
NP_441762.1_7 Forward -250 -238 9.57708 0.0142
NP_441762.1_7 Reverse -239 -251 2.89058 0.0676
NP_442142.1_4 Forward -252 -239 17.1282 0.0264
NP_442142.1_4 Reverse -237 -250 5.52525 0.188
NP_442142.1_4 Forward -258 -245 2.57534 0.286
NP_442292.1_1 Forward -248 -239 18.486 0.00229
NP_442292.1_1 Reverse -241 -250 9.63616 0.0183
NP_441264.1_8 Reverse -38 -57 15.5357 0.284
NP_443009.1_5 Reverse -239 -250 18.3477 0.00265
NP_441715.1_4 Reverse -241 -251 16.303 0.0117
NP_441715.1_4 Forward -248 -238 7.94484 0.107
NP_441198.1_5 Forward -247 -234 14.67 0.206
NP_441198.1_5 Reverse -67 -80 12.605 0.219
NP_440464.1_10 Forward -248 -238 13.0082 0.169
NP_441468.1_1 Forward -248 -241 15.8704 0.0124
NP_441468.1_1 Reverse -241 -248 15.8704 0.0124
NP_441020.2_6 Reverse -238 -255 18.6234 0.0112
NP_441020.2_6 Forward -251 -234 10.9536 0.131
NP_441020.2_6 Forward -365 -348 6.03703 0.28
NP_441015.1_10 Forward -311 -292 0.491109 0.165
NP_441015.1_10 Reverse -247 -266 -7.67036 0.27
NP_441015.1_10 Reverse -241 -260 -9.53865 0.282
NP_441673.1_1 Forward -249 -240 20.8459 0.000698
NP_441673.1_1 Reverse -240 -249 20.8459 0.000698
NP_441826.1_2 Forward -255 -241 10.521 0.0471
NP_442868.1_6 Reverse -238 -248 9.81313 0.038
NP_442868.1_6 Reverse -218 -228 3.81494 0.192
NP_442868.1_6 Forward -251 -241 0.963343 0.205
NP_441612.1_2 Forward -249 -239 8.54929 0.21
NP_443058.1_7 Reverse -239 -258 13.6675 0.184
NP_443058.1_7 Reverse -304 -323 1.76941 0.294
NP_442361.1_3 Forward -255 -242 17.1289 0.0481
NP_442808.1_1 Forward -250 -240 18.4657 0.00201
NP_442808.1_1 Reverse -239 -249 8.63269 0.0481
NP_442808.1_1 Forward -267 -257 3.71617 0.227
NP_442808.1_1 Forward -346 -336 2.92952 0.252
NP_442050.1_5 Forward -251 -241 9.12434 0.193
NP_442050.1_5 Reverse -238 -248 7.64939 0.243
NP_440558.1_2 Forward -258 -239 0.884433 0.185
NP_440558.1_2 Reverse -345 -364 -3.24547 0.234
NP_442789.1_4 Reverse -238 -257 -6.29373 0.285
NP_441878.1_6 Forward -250 -240 10.4031 0.0176
NP_441878.1_6 Reverse -239 -249 10.4031 0.0176
NP_441036.1_8 Forward -250 -240 17.7779 0.000554
NP_441036.1_8 Reverse -239 -249 8.33817 0.174
NP_441557.1_5 Forward -249 -240 19.9609 0.000699
NP_441557.1_5 Reverse -240 -249 19.9609 0.000699
NP_441445.1_1 Forward -258 -239 0.0977854 0.283
NP_441433.1_8 Reverse -365 -384 -0.4922 0.246
NP_441433.1_8 Forward -345 -326 -0.885524 0.255
NP_441433.1_8 Forward -344 -325 -3.54046 0.283
NP_441433.1_8 Forward -160 -141 -3.63879 0.283
NP_441308.1_8 Forward -251 -241 10.1081 0.22
NP_441381.1_6 Forward -148 -129 15.0441 0.199
NP_441458.1_10 Forward -258 -239 5.89931 0.21
NP_442183.1_1 Reverse -240 -254 19.1741 0.0065
NP_442397.1_9 Reverse -370 -389 2.75272 0.271
NP_441574.1_1 Reverse -240 -259 -5.60541 0.265
NP_440276.1_8 Reverse -303 -322 9.73422 0.244
NP_442347.1_2 Forward -248 -239 12.4878 0.056
NP_442347.1_2 Reverse -241 -250 11.1111 0.056
NP_442347.1_8 Forward -294 -275 2.3594 0.291
NP_442645.1_2 Reverse -232 -251 -2.65548 0.0487
NP_442965.1_2 Reverse -153 -172 -6.78538 0.261
NP_441037.1_4 Reverse -238 -248 7.9999 0.237
NP_441037.1_4 Forward -251 -241 7.02532 0.237
NP_442594.1_8 Forward -308 -289 6.68596 0.224
NP_442594.1_8 Forward -315 -296 4.81767 0.258
NP_441633.1_3 Reverse -238 -251 8.47575 0.0377
NP_441633.1_3 Forward -251 -238 -3.71729 0.177
NP_440136.1_2 Forward -248 -241 15.9687 0.0123
NP_440136.1_2 Reverse -241 -248 15.9687 0.0123
NP_442998.1_5 Reverse -376 -386 15.713 0.149
NP_442998.1_10 Forward -247 -240 15.5754 0.0102
NP_442998.1_10 Reverse -242 -249 15.5754 0.0102
NP_440299.1_1 Forward -253 -240 20.1765 0.00128
NP_440299.1_1 Reverse -236 -249 18.9965 0.00298
NP_441799.1_1 Reverse -236 -250 17.4035 0.011
NP_441799.1_1 Forward -253 -239 4.03056 0.269
NP_441007.1_10 Forward -368 -355 -0.570702 0.287
NP_442201.1_10 Forward -260 -241 -13.5702 0.274
NP_440256.1_1 Reverse -237 -256 5.11266 0.0386
NP_441559.1_8 Forward -254 -240 2.5562 0.143
NP_440915.1_6 Forward -253 -239 5.70279 0.0879
NP_440915.1_6 Reverse -236 -250 0.687908 0.155
NP_442069.1_8 Reverse -180 -199 6.39097 0.235
NP_442866.1_1 Reverse -235 -254 -4.81876 0.234
NP_441199.1_6 Forward -253 -234 2.16274 0.198
NP_440677.1_1 Forward -258 -239 8.55425 0.208
NP_442386.1_5 Reverse -270 -289 11.8967 0.148
NP_442386.1_9 Forward -250 -241 15.7322 0.0144
NP_442386.1_9 Reverse -239 -248 13.8639 0.0289
NP_441340.1_5 Forward -248 -241 15.6737 0.0124
NP_441340.1_5 Reverse -241 -248 15.6737 0.0124
NP_441340.1_9 Forward -335 -325 8.15881 0.256
NP_441027.1_1 Reverse -135 -149 15.0436 0.256
NP_440586.1_8 Forward -248 -241 13.2151 0.026
NP_440586.1_8 Reverse -241 -248 13.2151 0.026
NP_440586.1_8 Reverse -128 -135 8.88855 0.205
NP_442251.1_6 Forward -248 -241 15.2804 0.0124
NP_442251.1_6 Reverse -241 -248 15.2804 0.0124
NP_440192.1_5 Reverse -239 -258 8.45592 0.204
NP_440684.1_9 Reverse -234 -248 9.5377 0.218
NP_441262.1_3 Reverse -240 -247 14.7888 0.0223
NP_441262.1_3 Forward -249 -242 14.7888 0.0223
NP_443051.1_1 Reverse -239 -248 10.4228 0.00754
NP_443051.1_1 Forward -250 -241 10.4228 0.00754
NP_441232.1_10 Reverse -229 -248 13.0775 0.0698
NP_439937.1_8 Reverse -238 -257 -3.44213 0.268
NP_440626.1_1 Forward -248 -229 14.1583 0.192
NP_440439.1_1 Forward -252 -239 8.37742 0.0537
NP_440372.1_2 Forward -248 -241 16.3621 0.0124
NP_440372.1_2 Reverse -241 -248 16.3621 0.0124
NP_439977.1_5 Reverse -268 -287 0.786102 0.201
NP_440139.1_1 Reverse -234 -253 8.16011 0.118
NP_441572.1_1 Reverse -238 -257 -2.0655 0.212
NP_441572.1_7 Forward -255 -236 -2.0655 0.19
NP_442384.1_10 Forward -249 -236 16.7355 0.00732
NP_442384.1_10 Reverse -240 -253 15.7522 0.00946
NP_441018.1_7 Reverse -236 -255 8.06259 0.256
NP_442262.1_10 Forward -248 -241 14.1988 0.0123
NP_442262.1_10 Reverse -241 -248 14.1988 0.0123
NP_442262.1_10 Forward -191 -184 7.6106 0.274
NP_441689.1_5 Forward -251 -241 8.53436 0.132
NP_441689.1_5 Reverse -238 -248 5.78111 0.197
NP_442244.1_3 Reverse -243 -262 10.6192 0.148
NP_442244.1_7 Forward -315 -296 12.2908 0.26
NP_440163.1_10 Forward -252 -242 16.303 0.0762
NP_440344.1_10 Forward -256 -239 18.9184 0.00244
NP_440344.1_10 Reverse -233 -250 -12.8425 0.267
NP_440531.1_6 Forward -257 -238 -1.18052 0.229
NP_442910.1_1 Forward -256 -237 -7.27704 0.254
NP_440562.1_1 Reverse -150 -169 15.5349 0.235
NP_440297.1_9 Reverse -241 -251 9.32148 0.0917
NP_440297.1_9 Forward -248 -238 -0.118297 0.282
NP_442280.1_10 Forward -171 -153 9.44784 0.233
NP_442280.1_10 Reverse -301 -319 6.42843 0.275
NP_441103.1_9 Reverse -301 -311 12.6848 0.29
NP_440894.1_10 Reverse -292 -311 4.03102 0.259
NP_442067.1_4 Forward -260 -241 5.01433 0.244
NP_440999.1_9 Forward -253 -239 13.1759 0.0329
NP_440888.1_2 Reverse -240 -254 14.9452 0.0137
NP_440888.1_2 Forward -249 -235 9.93039 0.11
NP_440888.1_2 Reverse -305 -319 9.93039 0.11
NP_440600.1_4 Forward -257 -239 -7.45401 0.291
NP_440179.1_6 Forward -248 -229 3.83436 0.259
NP_442948.1_2 Reverse -239 -258 4.916 0.257
NP_441949.1_2 Reverse -230 -249 5.30933 0.261
NP_441543.1_2 Reverse -241 -250 18.486 0.00236
NP_441543.1_2 Forward -248 -239 16.9127 0.00359
NP_442845.1_2 Reverse -234 -248 5.40779 0.233
NP_441829.1_4 Reverse -252 -266 21.3374 0.0746
NP_441469.1_8 Forward -250 -241 16.126 0.00797
NP_441469.1_8 Reverse -239 -248 6.48957 0.227
NP_443064.1_6 Forward -249 -239 12.5669 0.0796
NP_442578.1_7 Forward -248 -241 14.5921 0.026
NP_442578.1_7 Reverse -241 -248 14.5921 0.026
NP_440710.1_1 Reverse -232 -250 -9.12563 0.294
NP_441462.1_2 Forward -249 -239 11.5831 0.00406
NP_441462.1_2 Reverse -240 -250 11.5831 0.00406
NP_441621.1_7 Reverse -238 -252 -3.44199 0.188
NP_443062.1_1 Reverse -240 -258 20.0518 0.0208
NP_443062.1_6 Reverse -232 -251 9.24257 0.13
NP_442204.1_1 Forward -253 -242 9.69511 0.0736
NP_442204.1_5 Forward -259 -240 3.93269 0.18
NP_441560.1_10 Forward -257 -238 9.63589 0.226
NP_441351.1_8 Forward -365 -346 2.65439 0.243
NP_440516.1_8 Forward -249 -240 16.9127 0.00442
NP_440516.1_8 Reverse -240 -249 16.9127 0.00442
NP_442428.1_5 Forward -248 -241 15.8704 0.0124
NP_442428.1_5 Reverse -241 -248 15.8704 0.0124
NP_442120.1_10 Reverse -342 -361 -10.522 0.259
NP_442120.1_10 Reverse -171 -190 -11.5053 0.262
NP_440673.1_2 Reverse -344 -363 11.9504 0.162
NP_440673.1_2 Reverse -230 -249 7.95079 0.286
NP_440673.1_3 Forward -247 -240 12.4288 0.0426
NP_440673.1_3 Reverse -242 -249 12.4288 0.0426
NP_441714.1_3 Reverse -233 -251 13.6864 0.217
NP_441052.1_2 Forward -249 -239 19.9412 0.00106
NP_441052.1_2 Reverse -240 -250 10.5014 0.0285
NP_442219.1_9 Forward -248 -239 17.7976 0.00718
NP_442219.1_9 Reverse -241 -250 8.35786 0.0681
NP_440436.1_4 Reverse -241 -250 18.1905 0.00233
NP_440436.1_4 Forward -248 -239 17.2072 0.00233
NP_441884.1_8 Reverse -239 -258 -5.21209 0.175
NP_441884.1_9 Forward -252 -233 -23.895 0.284
NP_442086.1_4 Reverse -214 -233 15.2531 0.268
NP_440314.1_9 Forward -248 -229 -8.26035 0.246
NP_442907.1_9 Forward -254 -235 -0.000545616 0.212
NP_441719.1_2 Reverse -237 -251 13.2523 0.286
NP_441719.1_4 Forward -248 -241 16.3621 0.0124
NP_441719.1_4 Reverse -241 -248 16.3621 0.0124
NP_441733.1_10 Reverse -237 -250 7.09911 0.156
NP_441004.1_1 Reverse -234 -253 -14.4552 0.268
NP_442366.1_3 Reverse -239 -257 8.08229 0.0693
NP_442366.1_3 Forward -250 -232 -3.81576 0.258
NP_442366.1_5 Reverse -237 -247 15.4175 0.0374
NP_440129.1_10 Forward -256 -242 25.5656 0.00296
NP_442206.1_10 Reverse -240 -255 14.1396 0.0799
NP_440094.1_9 Reverse -239 -258 -1.67217 0.206
NP_440094.1_10 Reverse -27 -46 19.2715 0.0248
NP_443054.1_2 Forward -251 -237 1.86788 0.245
NP_441851.1_10 Forward -250 -240 16.008 0.00552
NP_441851.1_10 Reverse -239 -249 15.8113 0.00552
NP_441195.1_1 Forward -194 -175 6.58763 0.087
NP_442515.1_1 Forward -250 -236 -4.4253 0.298
NP_442515.1_1 Reverse -239 -253 -4.81863 0.298
NP_441396.1_5 Reverse -184 -193 8.25953 0.224
NP_440593.1_3 Forward -266 -247 -6.88371 0.282
NP_440165.1_5 Reverse -239 -258 -5.40875 0.22
NP_442689.1_8 Forward -339 -322 -7.53264 0.292
NP_442689.1_8 Forward -279 -262 -7.82764 0.292
NP_440940.1_7 Forward -259 -241 16.4396 0.0622
NP_441349.1_10 Forward -259 -240 4.22769 0.0575
NP_440432.1_9 Forward -248 -233 -1.10174 0.167
NP_442843.1_1 Reverse -153 -172 -10.0303 0.274
NP_439960.1_4 Reverse -239 -258 15.1416 0.159
NP_441124.1_5 Reverse -3 -13 11.7668 0.245
NP_441124.1_5 Forward -335 -325 11.7668 0.245
NP_442450.1_5 Forward -251 -241 9.32148 0.115
NP_442450.1_5 Reverse -238 -248 7.55152 0.13
NP_442168.1_5 Forward -265 -246 -3.44213 0.285
NP_440588.1_2 Forward -258 -239 -2.95047 0.174
NP_442006.1_2 Forward -372 -355 -15.1041 0.215
NP_442006.1_2 Forward -321 -304 -17.9557 0.285
NP_441003.1_9 Forward -258 -239 9.3409 0.214
NP_441570.1_1 Reverse -240 -258 10.4422 0.00901
NP_441570.1_1 Forward -249 -231 -16.5988 0.249
NP_440078.1_10 Forward -74 -55 7.7676 0.216
NP_441078.1_4 Forward -249 -240 19.6659 0.0007
NP_441078.1_4 Reverse -240 -249 19.6659 0.0007
NP_442729.1_5 Reverse -245 -255 14.0414 0.22
NP_442729.1_7 Forward -359 -341 5.91901 0.286
NP_442729.1_8 Forward -253 -240 8.08242 0.125
NP_441663.1_7 Reverse -237 -256 6.88262 0.209
NP_440526.1_3 Forward -248 -237 1.04151 0.267
NP_440526.1_3 Reverse -355 -366 0.844851 0.267
NP_441432.1_8 Reverse -239 -248 16.8143 0.00595
NP_441432.1_8 Forward -250 -241 8.25953 0.0755
NP_441432.1_8 Reverse -256 -265 3.14632 0.259
NP_442320.1_8 Forward -255 -241 4.62115 0.0472
NP_442320.1_8 Reverse -234 -248 -4.81863 0.188
NP_442344.1_7 Forward -73 -54 -10.227 0.291
NP_441732.1_2 Forward -253 -237 2.02515 0.0253
NP_440760.1_1 Forward -249 -230 -21.7317 0.243
NP_441945.1_10 Reverse -239 -258 11.7008 0.235
NP_441057.1_4 Forward -298 -280 11.1305 0.14
NP_442489.1_7 Forward -249 -240 20.1576 0.000695
NP_442489.1_7 Reverse -240 -249 20.1576 0.000695
NP_440565.1_3 Reverse -294 -313 16.5473 0.218
NP_440386.1_3 Forward -239 -220 -4.13045 0.221
NP_442079.1_7 Reverse -241 -260 7.47261 0.136
NP_440559.1_1 Forward -248 -239 17.4043 0.00658
NP_440559.1_1 Reverse -241 -250 8.75118 0.0586
NP_441659.2_8 Forward -249 -239 18.1713 0.00133
NP_441659.2_8 Reverse -240 -250 11.9764 0.0147
NP_441040.1_2 Reverse -238 -257 -15.7335 0.286
NP_442346.1_5 Reverse -239 -249 16.6963 0.00248
NP_442346.1_5 Forward -250 -240 9.02648 0.118
NP_440352.1_5 Reverse -148 -167 13.4344 0.189
NP_440545.1_3 Reverse -236 -253 11.6419 0.0247
NP_440010.1_4 Forward -259 -240 4.32522 0.22
NP_440010.1_6 Reverse -229 -248 6.68596 0.217
NP_441943.1_8 Reverse -150 -169 -12.8819 0.261
NP_442603.1_7 Reverse -240 -254 8.3571 0.176
NP_441888.1_7 Forward -254 -240 13.3726 0.0743
NP_441050.1_5 Reverse -341 -359 -2.73412 0.284
NP_441948.1_9 Reverse -242 -260 12.1139 0.299
NP_440170.1_5 Forward -259 -240 7.47261 0.142
NP_441833.1_4 Forward -248 -241 15.9687 0.0124
NP_441833.1_4 Reverse -241 -248 15.9687 0.0124
NP_441329.1_3 Reverse -267 -277 13.3642 0.265
NP_441895.1_2 Forward -378 -359 -17.5035 0.234
NP_442162.1_9 Forward -248 -241 16.2637 0.0124
NP_442162.1_9 Reverse -241 -248 16.2637 0.0124
NP_440671.1_4 Forward -255 -241 13.4709 0.0806
NP_442199.1_5 Forward -257 -238 -4.13045 0.219
NP_442140.1_3 Forward -248 -238 12.2714 0.0632
NP_442140.1_3 Reverse -241 -251 8.33817 0.119
NP_442021.1_3 Reverse -234 -253 -8.16202 0.296
NP_440875.1_9 Reverse -242 -252 9.05339 0.233
NP_441813.1_5 Forward -251 -241 17.188 0.00979
NP_441813.1_5 Reverse -238 -248 8.63316 0.0367
NP_440590.1_4 Forward -248 -235 0.707601 0.144
NP_440590.1_4 Reverse -241 -254 -2.24233 0.239
NP_440567.1_1 Forward -248 -234 13.0776 0.0213
NP_440567.1_1 Reverse -241 -255 12.4876 0.023
NP_442497.1_10 Forward -248 -239 10.4228 0.0087
NP_442497.1_10 Reverse -241 -250 10.4228 0.0087
NP_440821.1_4 Forward -251 -241 19.0562 0.00399
NP_440821.1_4 Reverse -238 -248 9.41981 0.0286
NP_441239.1_9 Forward -251 -239 13.3137 0.037
NP_441239.1_9 Reverse -238 -250 5.93884 0.202
NP_441009.1_4 Reverse -240 -259 15.7324 0.158
NP_440156.1_3 Forward -261 -242 10.7175 0.126
NP_440156.1_4 Forward -387 -377 14.5325 0.176
NP_440400.1_1 Reverse -296 -315 1.6703 0.263
NP_441892.1_1 Forward -258 -241 5.15205 0.105
NP_440604.1_6 Reverse -240 -259 18.4857 0.0305
NP_440604.1_6 Forward -285 -266 -3.63879 0.23
NP_440219.1_4 Forward -83 -70 17.091 0.196
NP_440949.1_7 Forward -257 -238 10.0284 0.25
NP_442138.1_10 Reverse -240 -259 -3.73712 0.242
NP_440546.1_4 Reverse -240 -250 11.8882 0.0679
NP_440546.1_4 Forward -249 -239 10.046 0.109
NP_440546.1_4 Reverse -336 -346 7.71902 0.224
NP_442349.1_6 Forward -267 -248 1.37609 0.214
NP_441154.1_1 Forward -64 -50 21.7307 0.0231
NP_440675.1_1 Reverse -237 -256 3.53937 0.251
NP_440462.1_6 Forward -251 -241 15.418 0.0142
NP_440462.1_6 Reverse -238 -248 1.35667 0.294
NP_442611.1_1 Reverse -331 -350 -1.08219 0.274
NP_440868.1_4 Forward -253 -241 8.6921 0.0582
NP_440868.1_4 Reverse -236 -248 6.1355 0.0878
NP_442479.1_9 Forward -282 -263 -8.26035 0.266
NP_442402.1_4 Reverse -16 -35 -1.37794 0.189
NP_442402.1_4 Forward -175 -156 -6.09781 0.25
NP_441848.1_4 Forward -340 -324 7.07321 0.297
NP_442039.1_4 Forward -248 -241 15.1821 0.0124
NP_442039.1_4 Reverse -241 -248 15.1821 0.0124
NP_442039.1_7 Reverse -154 -164 11.2881 0.257
NP_440825.1_7 Forward -248 -238 12.9096 0.152
NP_442837.1_3 Forward -248 -241 15.7721 0.0124
NP_442837.1_3 Reverse -241 -248 15.7721 0.0124
NP_442053.1_1 Forward -249 -240 18.3876 0.0007
NP_442053.1_1 Reverse -240 -249 18.3876 0.0007
NP_440505.1_3 Forward -251 -241 13.8447 0.0247
NP_440505.1_3 Reverse -238 -248 9.22315 0.122
NP_441203.1_1 Reverse -241 -260 -19.8634 0.297
NP_441153.1_4 Forward -49 -30 33.432 0.0000116
NP_440914.1_1 Forward -249 -239 17.5935 0.000537
NP_440914.1_1 Reverse -240 -250 8.6151 0.186
NP_441011.1_8 Reverse -241 -250 16.9127 0.00602
NP_441011.1_8 Forward -248 -239 8.25953 0.144
NP_442533.1_1 Forward -303 -284 -16.4218 0.268
NP_442533.1_3 Reverse -265 -283 16.3239 0.241
NP_442533.1_6 Forward -249 -240 17.2076 0.00137
NP_442533.1_6 Reverse -240 -249 17.2076 0.00137
NP_442229.1_1 Reverse -238 -252 7.27547 0.196
NP_443016.1_1 Reverse -234 -253 -0.590531 0.219
NP_441482.1_7 Forward -255 -241 8.16106 0.0189
NP_439944.1_9 Forward -248 -238 10.5014 0.0887
NP_439944.1_9 Reverse -241 -251 10.3048 0.0887
NP_440816.1_7 Forward -253 -234 13.5691 0.201
NP_440116.1_5 Reverse -237 -254 7.512 0.155
NP_440116.1_5 Forward -252 -235 2.69378 0.26
NP_440007.1_9 Forward -253 -239 3.73617 0.267
NP_441972.1_5 Forward -260 -241 -2.26216 0.18
NP_441106.1_1 Forward -250 -241 18.191 0.0028
NP_441106.1_1 Reverse -239 -248 9.63616 0.0311
NP_441286.1_1 Reverse -239 -251 14.4936 0.00418
NP_441286.1_1 Forward -250 -238 3.38223 0.0467
NP_442674.1_3 Forward -257 -238 9.43841 0.174
NP_440670.1_8 Forward -249 -240 18.3876 0.000699
NP_440670.1_8 Reverse -240 -249 18.3876 0.000699
NP_440886.1_7 Forward -250 -240 17.7774 0.0011
NP_440886.1_7 Reverse -239 -249 7.94438 0.0805
NP_442072.1_9 Forward -250 -232 -20.827 0.204
NP_441753.1_10 Forward -258 -239 3.04771 0.222
NP_440907.2_8 Reverse -241 -251 7.84605 0.117
NP_440907.2_8 Forward -248 -238 7.64939 0.117
NP_441021.1_1 Forward -248 -229 6.78429 0.0704
NP_441463.1_3 Forward -259 -240 8.84924 0.0481
NP_441463.1_3 Reverse -230 -249 -0.787193 0.133
NP_441463.1_3 Forward -190 -171 -9.63698 0.282
NP_441463.1_6 Reverse -238 -252 5.54623 0.287
NP_441626.1_2 Forward -248 -241 15.7721 0.0124
NP_441626.1_2 Reverse -241 -248 15.7721 0.0124
NP_442221.1_5 Forward -248 -229 21.6314 0.0979
NP_442365.1_7 Forward -253 -234 8.94757 0.0809
NP_441460.1_2 Forward -382 -369 15.6533 0.171
NP_442794.1_1 Forward -253 -241 10.1671 0.0721
NP_442794.1_1 Reverse -236 -248 9.38042 0.0795
NP_442615.1_1 Reverse -231 -249 8.47561 0.0284
NP_441962.1_4 Reverse -235 -254 -4.91709 0.162
NP_440387.1_1 Forward -249 -233 23.2646 0.00161
NP_440387.1_1 Reverse -240 -256 14.6115 0.00635
NP_441431.1_2 Forward -252 -238 11.5037 0.136
NP_441993.1_1 Reverse -240 -259 2.92126 0.246
NP_441174.1_4 Forward -89 -79 15.123 0.267
NP_440358.1_8 Reverse -318 -337 -1.18052 0.274
NP_440754.1_5 Forward -70 -51 12.3892 0.232
NP_441510.2_6 Forward -259 -240 15.0432 0.173
NP_441510.2_7 Forward -255 -241 11.602 0.28
NP_440766.1_4 Forward -253 -239 8.25939 0.0871
NP_440766.1_4 Forward -140 -126 1.96621 0.205
NP_441237.1_9 Forward -248 -238 14.828 0.0242
NP_442867.1_8 Forward -319 -300 3.73603 0.297
NP_440457.1_1 Forward -253 -241 8.29878 0.101
NP_440457.1_1 Reverse -236 -248 0.825626 0.25
NP_442680.1_5 Forward -88 -69 -1.19775 0.299
NP_441436.1_8 Reverse -239 -258 12.9791 0.215
NP_442509.1_5 Reverse -282 -299 13.7061 0.259
NP_442509.1_9 Reverse -240 -250 16.2041 0.00739
NP_442509.1_9 Forward -249 -239 8.14104 0.192
NP_440554.1_4 Reverse -241 -251 14.6313 0.02
NP_442737.1_5 Reverse -239 -258 11.5216 0.284
NP_441885.1_5 Forward -249 -239 20.9245 0.000538
NP_441885.1_5 Reverse -240 -250 11.4848 0.00668
NP_442341.1_7 Reverse -239 -253 17.7975 0.0111
NP_442341.1_7 Forward -250 -236 7.66941 0.0994
NP_442341.1_9 Forward -251 -237 7.07881 0.204
NP_441173.1_9 Reverse -328 -336 12.1137 0.21
NP_441173.1_9 Forward -10 -2 11.0321 0.228
NP_441173.1_9 Forward -164 -156 10.9338 0.242
NP_441173.1_9 Reverse -268 -276 9.85212 0.275
NP_442395.2_4 Reverse -239 -258 7.17681 0.141
NP_443000.1_7 Reverse -238 -248 10.3048 0.0345
NP_443000.1_7 Forward -251 -241 8.73149 0.0437
NP_440507.2_3 Forward -258 -239 15.6332 0.0903
NP_441842.1_10 Forward -256 -242 10.226 0.167
NP_440275.1_3 Forward -251 -241 8.4365 0.0602
NP_440275.1_3 Reverse -238 -248 8.04317 0.0602
NP_440091.1_1 Forward -253 -241 1.41561 0.197
NP_440091.1_1 Reverse -236 -248 1.41561 0.197
NP_441397.1_8 Forward -34 -21 12.9532 0.251
NP_441902.1_3 Forward -88 -78 11.8156 0.288
NP_440679.1_10 Reverse -242 -261 -14.2585 0.226
NP_441359.1_5 Forward -373 -354 3.04771 0.259
NP_440149.1_8 Reverse -240 -259 5.11266 0.0776
NP_441105.1_3 Forward -260 -241 1.67108 0.111
NP_440216.1_1 Forward -249 -235 -1.47537 0.0328
NP_440216.1_1 Reverse -240 -254 -2.26202 0.0484
NP_440216.1_9 Reverse -154 -163 11.9961 0.252
NP_440172.1_1 Forward -249 -239 15.0247 0.00945
NP_440172.1_1 Reverse -240 -250 8.73149 0.0586
NP_442015.1_10 Forward -253 -240 19.1938 0.00444
NP_442015.1_10 Reverse -236 -249 1.49425 0.204
NP_441226.1_7 Forward -248 -241 14.4934 0.0123
NP_441226.1_7 Reverse -241 -248 14.4934 0.0123
NP_441111.1_7 Forward -248 -240 18.7023 0.00294
NP_441111.1_7 Reverse -241 -249 18.7023 0.00294
NP_442379.1_10 Reverse -233 -250 -0.747806 0.223
NP_441766.1_2 Forward -249 -240 17.5026 0.00297
NP_441766.1_2 Reverse -240 -249 17.5026 0.00297
NP_441766.1_2 Reverse -65 -74 5.99792 0.103
NP_442417.1_5 Reverse -240 -254 21.3374 0.00922
NP_440416.1_9 Forward -256 -237 -2.55715 0.071
NP_440416.1_9 Reverse -233 -252 -10.817 0.146
NP_440416.1_9 Forward -380 -361 -20.4534 0.285
NP_443052.1_8 Forward -259 -240 -12.6852 0.259
NP_442154.1_1 Forward -230 -212 -14.3372 0.218
NP_442154.1_1 Forward -311 -293 -14.9272 0.218
NP_442154.1_1 Reverse -247 -265 -16.5005 0.241
NP_442154.1_1 Forward -302 -284 -19.3521 0.298
NP_440261.1_5 Reverse -241 -254 -10.5021 0.201
NP_440988.1_10 Reverse -244 -258 6.64146 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGCTCTGGTGGAACGATTTTCCCCTTACCGACAAGTGGCGGTGGAATTATCTGCCCCCATACCTTTGGAAAAATTACAGCTCTATGGCGAAGTGGAGAGTGTGGAGGGTCTACTGGTGCGCTTTTTGCTAAAACGGGAAAGCCTCACCACGGCGATCGCCAAACTGTTAGCGGAGTTGCCAGTATCGGATTTAAGCGTATCTGACCCCCCCATTGAAGAAATCATTGGCCGTCTATTTTCCCAGGGCAATTTGGATAATAAACTTTGATCGGTGTTAGAGAGAGTTACACAATTTCTCGGACTATTCCAAGTGGGGAGGAAAATTAGAGACCGGAGAGAGCTTCAAATAGATAATGATATGGCATGATAGAAAATATTGGGTAATGAGATTTTGCAAAG

CDS

ATGTCTACACACTGTCACTGTCCTCAATGTGGTCATGGGAATGTTGTCAAAAATGGCTTTGTCAAGGATAAGCAACGATTCAAGTGTAAGAGTTGCCAATATCAATTCACCAATCTCTCCAAGGAAAGAGGTAAACCTCTCTGGATGAAACTAGAAGCGGTCTTACTGTACATGAGTGGTATGTCAATGAATGCCACAGCAAAACTCTTGGGAGTTTCCACTCAGTCAGTGCTCAACTGGATTAGGGATTTTGGCGAAGCAAACTACGAGAAACCGGCTCCAGACTCAGCAATCGTAGTGGAATTAGACGAACTGTGGCATTTTCTCCAGGCAAAAAAAACAAGTTATGGCTCTGGAAAGCATATGACCGTGTTACTGGGAGACTCATCGACTGGGAACTGGGAAATCGTGATAGTCAAACCCTAA

Protein

MSTHCHCPQCGHGNVVKNGFVKDKQRFKCKSCQYQFTNLSKERGKPLWMKLEAVLLYMSGMSMNATAKLLGVSTQSVLNWIRDFGEANYEKPAPDSAIVVELDELWHFLQAKKTSYGSGKHMTVLLGDSSTGNWEIVIVKP