Your browser is old and dusty. Try Google Chrome!

Details for slr1900

ORF slr1900
Accession NP_440678.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Forward -341 -322 2.0644 0.244
NP_440795.1_7 Forward -341 -334 14.6904 0.0123
NP_440795.1_7 Reverse -334 -341 14.6904 0.0123
NP_442100.1_1 Forward -167 -148 6.63627 0.284
NP_441418.1_3 Reverse -185 -204 14.2756 0.173
NP_441418.1_6 Reverse -333 -352 -27.6315 0.202
NP_441418.1_6 Forward -342 -323 -29.0082 0.215
NP_440815.1_5 Reverse -278 -297 7.96426 0.237
NP_443032.1_8 Forward -292 -273 -1.67217 0.269
NP_441453.1_4 Reverse -333 -341 16.539 0.00633
NP_441453.1_4 Forward -342 -334 7.8859 0.0536
NP_441453.1_4 Reverse -272 -280 4.73931 0.252
NP_442151.1_6 Forward -342 -328 17.8958 0.00866
NP_442151.1_6 Reverse -333 -347 5.21113 0.288
NP_441818.1_1 Forward -341 -330 9.59626 0.232
NP_441818.1_9 Reverse -345 -364 -5.11376 0.248
NP_441818.1_9 Reverse -333 -352 -8.55534 0.277
NP_440226.1_1 Reverse -333 -352 12.8808 0.0399
NP_442287.1_1 Forward -221 -211 13.0576 0.288
NP_442173.1_1 Forward -341 -333 15.4574 0.00633
NP_442173.1_1 Reverse -334 -342 8.27922 0.101
NP_001035873.1_1 Forward -233 -214 17.2254 0.197
NP_001035873.1_1 Reverse -156 -175 16.7418 0.232
NP_442752.1_4 Reverse -333 -340 13.8055 0.0199
NP_443027.1_4 Reverse -331 -341 16.2046 0.0437
NP_442975.1_10 Reverse -329 -343 12.0937 0.0477
NP_442975.1_10 Forward -346 -332 10.5204 0.0541
NP_440784.1_7 Forward -341 -334 15.9687 0.0123
NP_440784.1_7 Reverse -334 -341 15.9687 0.0123
NP_442861.1_1 Forward -278 -259 13.5691 0.26
NP_440061.1_9 Reverse -209 -223 4.91554 0.3
NP_441054.1_4 Reverse -323 -341 1.29745 0.173
NP_440878.1_9 Forward -352 -333 -2.26216 0.258
NP_442062.1_8 Forward -309 -299 6.56821 0.123
NP_440304.1_4 Reverse -331 -341 19.9412 0.00364
NP_442242.1_4 Forward -341 -334 14.3954 0.0124
NP_442242.1_4 Reverse -334 -341 14.3954 0.0124
NP_442242.1_4 Reverse -273 -280 10.7572 0.153
NP_440044.1_8 Forward -341 -322 8.16093 0.0769
NP_441781.1_7 Forward -342 -323 -2.75381 0.289
NP_442602.1_3 Reverse -96 -115 2.0644 0.171
NP_439918.1_2 Forward -341 -322 3.83436 0.178
NP_441619.1_8 Forward -287 -273 10.5204 0.185
NP_441208.1_9 Forward -345 -331 6.78443 0.229
NP_440370.1_10 Reverse -324 -343 7.86593 0.247
NP_442742.1_9 Reverse -300 -319 -6.09707 0.222
NP_442110.1_7 Forward -342 -328 13.0776 0.0586
NP_440856.1_1 Reverse -323 -342 1.96607 0.228
NP_440856.1_4 Reverse -204 -223 6.29264 0.0772
NP_441083.1_5 Forward -342 -332 10.0098 0.0214
NP_441083.1_5 Reverse -272 -282 6.76487 0.0775
NP_441083.1_5 Reverse -333 -343 1.55333 0.204
NP_441083.1_5 Forward -281 -271 1.16001 0.215
NP_442827.1_8 Reverse -355 -374 1.27698 0.184
NP_441738.1_2 Forward -340 -333 15.28 0.0102
NP_441558.1_5 Forward -344 -325 4.71934 0.271
NP_440209.1_1 Reverse -333 -341 18.1123 0.00295
NP_440209.1_1 Forward -342 -334 15.1624 0.00583
NP_440447.1_5 Reverse -354 -364 14.4347 0.277
NP_441770.1_4 Forward -387 -368 -0.295539 0.184
NP_440178.1_7 Forward -282 -263 -22.3217 0.261
NP_442111.1_4 Forward -343 -329 9.63603 0.0593
NP_442111.1_4 Reverse -271 -285 5.70279 0.154
NP_440906.1_5 Forward -341 -334 15.8704 0.0124
NP_440906.1_5 Reverse -334 -341 15.8704 0.0124
NP_440747.1_10 Forward -345 -333 5.44718 0.0137
NP_440747.1_10 Reverse -330 -342 -11.6624 0.131
NP_440747.1_10 Reverse -269 -281 -12.0557 0.199
NP_440747.1_10 Reverse -208 -220 -12.3507 0.27
NP_442973.1_8 Reverse -157 -175 13.8838 0.241
NP_441486.1_1 Reverse -330 -344 -1.77037 0.175
NP_441486.1_1 Forward -58 -44 -5.60527 0.248
NP_442634.1_4 Reverse -331 -345 0.196253 0.149
NP_442634.1_4 Forward -344 -330 -2.75368 0.156
NP_440403.1_4 Reverse -263 -282 11.0125 0.068
NP_442848.1_1 Reverse -266 -280 3.8345 0.12
NP_442848.1_1 Reverse -327 -341 -2.45868 0.263
NP_443018.1_3 Forward -341 -334 14.8871 0.0123
NP_443018.1_3 Reverse -334 -341 14.8871 0.0123
NP_443018.1_3 Reverse -161 -168 8.49558 0.141
NP_441316.1_7 Reverse -331 -346 3.81481 0.137
NP_440376.1_1 Forward -114 -105 13.1761 0.0174
NP_440376.1_1 Reverse -333 -342 9.73449 0.0365
NP_440376.1_1 Forward -342 -333 9.63616 0.0385
NP_440376.1_1 Reverse -272 -281 8.06287 0.0463
NP_440376.1_1 Reverse -211 -220 1.76968 0.242
NP_440376.1_1 Reverse -363 -372 -0.000272808 0.285
NP_440376.1_1 Forward -281 -272 -0.196935 0.285
NP_441588.1_4 Forward -340 -330 6.66654 0.185
NP_442687.1_7 Forward -343 -333 6.27322 0.175
NP_442687.1_7 Forward -221 -211 4.0116 0.271
NP_441846.1_10 Reverse -352 -371 -22.125 0.257
NP_442958.1_3 Reverse -322 -341 -1.57384 0.283
NP_440042.1_2 Forward -352 -333 0.294447 0.213
NP_441682.1_2 Forward -107 -88 2.45773 0.241
NP_441763.1_10 Reverse -322 -341 11.2084 0.143
NP_440360.1_10 Forward -370 -356 2.06454 0.275
NP_442658.1_1 Reverse -331 -341 13.0576 0.04
NP_442658.1_1 Forward -344 -334 10.8943 0.102
NP_442658.1_1 Forward -171 -161 5.78111 0.25
NP_441855.2_4 Forward -289 -270 16.9464 0.0716
NP_442782.1_2 Reverse -333 -347 0.294584 0.291
NP_440656.1_2 Reverse -126 -145 3.44104 0.221
NP_439968.1_2 Forward -371 -352 16.9115 0.252
NP_442937.1_5 Reverse -267 -286 9.14423 0.202
NP_441958.1_5 Reverse -332 -342 12.0747 0.00222
NP_441958.1_5 Forward -343 -333 11.3864 0.0074
NP_441958.1_5 Forward -282 -272 0.865012 0.12
NP_442836.1_5 Forward -225 -206 5.40766 0.186
NP_440203.1_5 Reverse -137 -147 10.501 0.224
NP_443001.1_7 Forward -341 -322 11.0125 0.166
NP_441097.1_2 Forward -297 -280 4.56207 0.278
NP_439990.1_5 Reverse -328 -341 6.80412 0.221
NP_442690.1_1 Reverse -148 -167 -16.1268 0.283
NP_442911.1_2 Reverse -262 -281 -4.6221 0.138
NP_442911.1_2 Forward -291 -272 -7.67036 0.216
NP_441580.1_6 Reverse -322 -341 8.35759 0.0988
NP_440153.1_5 Forward -341 -327 2.94952 0.219
NP_440153.1_8 Forward -373 -360 -3.71729 0.299
NP_442064.1_1 Forward -347 -328 -2.55715 0.146
NP_440993.1_2 Reverse -328 -344 8.41667 0.146
NP_441099.1_5 Reverse -323 -342 -9.53865 0.226
NP_442002.1_9 Forward -221 -214 12.2322 0.185
NP_441646.1_1 Forward -288 -269 7.7676 0.154
NP_440147.1_4 Forward -283 -270 18.0139 0.00528
NP_440147.1_4 Forward -344 -331 2.87088 0.202
NP_441550.1_8 Reverse -331 -341 13.0576 0.0273
NP_441550.1_8 Forward -344 -334 11.6809 0.0446
NP_441916.1_7 Forward -342 -332 10.6981 0.0261
NP_441916.1_7 Reverse -333 -343 9.61647 0.0333
NP_441916.1_7 Reverse -272 -282 4.10993 0.19
NP_441041.1_4 Forward -342 -323 -2.26216 0.109
NP_441041.1_4 Reverse -333 -352 -10.4236 0.232
NP_441041.1_7 Forward -345 -333 11.7906 0.0711
NP_441041.1_7 Reverse -330 -342 8.68091 0.133
NP_440016.1_8 Reverse -165 -184 19.3707 0.127
NP_442004.1_6 Forward -342 -328 1.47456 0.288
NP_441725.1_5 Forward -341 -331 11.1898 0.0247
NP_441725.1_5 Reverse -334 -344 -0.0199663 0.223
NP_439966.1_7 Reverse -331 -341 14.8275 0.0177
NP_439966.1_7 Forward -344 -334 6.96107 0.16
NP_439966.1_9 Reverse -158 -167 6.29291 0.253
NP_440736.1_3 Reverse -331 -350 5.50599 0.223
NP_442941.1_3 Forward -341 -331 19.9412 0.00262
NP_442941.1_3 Reverse -334 -344 1.65166 0.147
NP_440289.1_2 Reverse -330 -343 5.32916 0.0636
NP_440289.1_2 Reverse -269 -282 -0.767364 0.209
NP_440983.1_5 Reverse -303 -322 -7.96535 0.294
NP_442281.1_1 Forward -347 -333 10.3237 0.0595
NP_442281.1_1 Reverse -328 -342 7.57046 0.0969
NP_442847.1_3 Reverse -85 -104 6.88182 0.235
NP_442256.1_2 Forward -344 -326 -6.66736 0.214
NP_440498.1_1 Forward -351 -333 14.2771 0.0377
NP_441644.1_6 Forward -342 -332 16.4008 0.00405
NP_441644.1_6 Reverse -333 -343 15.3192 0.00663
NP_443049.1_6 Reverse -332 -342 11.7385 0.24
NP_442215.1_2 Forward -344 -328 -0.826444 0.173
NP_442215.1_2 Reverse -270 -286 -6.82463 0.28
NP_440253.1_2 Forward -342 -324 -0.177514 0.204
NP_440929.1_8 Reverse -333 -342 9.93116 0.0249
NP_440929.1_8 Forward -342 -333 9.83282 0.0254
NP_442933.1_10 Reverse -333 -342 9.04618 0.063
NP_442933.1_10 Forward -342 -333 8.94785 0.0643
NP_441751.2_8 Forward -341 -327 -3.04867 0.134
NP_442554.1_8 Forward -341 -331 16.9913 0.0065
NP_442554.1_8 Reverse -334 -344 6.8632 0.103
NP_442554.1_8 Reverse -273 -283 2.43831 0.272
NP_441762.1_7 Reverse -332 -344 2.49725 0.0676
NP_442142.1_4 Forward -345 -332 14.8666 0.0302
NP_442142.1_4 Reverse -330 -343 10.9334 0.0646
NP_442292.1_1 Forward -341 -332 17.5026 0.00435
NP_442292.1_1 Reverse -334 -343 8.65285 0.0335
NP_442999.1_1 Forward -389 -370 6.98095 0.26
NP_442381.1_8 Reverse -330 -349 -11.8986 0.266
NP_443009.1_5 Reverse -332 -343 7.138 0.137
NP_443009.1_5 Forward -343 -332 6.05637 0.177
NP_440125.1_1 Forward -69 -50 9.14423 0.168
NP_441715.1_4 Forward -341 -331 14.238 0.0295
NP_440279.1_2 Forward -113 -94 6.19431 0.255
NP_441448.1_1 Reverse -352 -371 4.52268 0.278
NP_440183.1_1 Forward -341 -322 6.39097 0.278
NP_440183.1_1 Reverse -334 -353 4.71934 0.296
NP_440183.1_9 Forward -106 -87 -18.0934 0.276
NP_441198.1_8 Reverse -331 -341 13.2713 0.108
NP_441758.1_3 Reverse -318 -336 18.7995 0.188
NP_441468.1_1 Forward -341 -334 15.8704 0.0124
NP_441468.1_1 Reverse -334 -341 15.8704 0.0124
NP_441673.1_1 Reverse -333 -342 11.1111 0.0121
NP_441673.1_1 Forward -342 -333 11.0128 0.018
NP_441673.1_1 Reverse -272 -281 1.37636 0.114
NP_441673.1_1 Forward -281 -272 1.1797 0.163
NP_442253.1_5 Reverse -96 -113 -3.30441 0.287
NP_441826.1_2 Reverse -327 -341 6.88276 0.0899
NP_442490.1_9 Forward -232 -213 -3.73712 0.244
NP_442490.1_9 Reverse -351 -370 -8.06369 0.282
NP_441764.1_8 Forward -162 -152 10.9279 0.291
NP_442868.1_6 Reverse -331 -341 1.06167 0.205
NP_442868.1_6 Forward -344 -334 0.668351 0.213
NP_442719.1_2 Forward -380 -362 1.10005 0.162
NP_442719.1_2 Forward -379 -361 -10.5029 0.276
NP_441056.1_1 Forward -342 -323 -6.78538 0.271
NP_442361.1_3 Reverse -327 -340 9.85238 0.272
NP_442427.1_3 Forward -347 -329 5.82068 0.171
NP_442808.1_1 Forward -343 -333 9.12434 0.0481
NP_442808.1_1 Forward -361 -351 2.73286 0.256
NP_442050.1_5 Reverse -331 -341 18.0724 0.00365
NP_442050.1_5 Forward -344 -334 8.23937 0.234
NP_440558.1_2 Forward -376 -357 -3.3438 0.234
NP_440558.1_2 Forward -102 -83 -4.52377 0.246
NP_440558.1_2 Reverse -80 -99 -7.37537 0.293
NP_441878.1_6 Forward -282 -272 1.16001 0.11
NP_441878.1_6 Reverse -332 -342 0.766681 0.134
NP_441878.1_6 Forward -343 -333 0.668351 0.139
NP_441878.1_6 Forward -115 -105 -6.60814 0.193
NP_441878.1_6 Reverse -271 -281 -7.49312 0.231
NP_441036.1_8 Forward -343 -333 13.353 0.0482
NP_441036.1_8 Reverse -332 -342 6.07655 0.242
NP_440614.1_8 Reverse -81 -100 16.8141 0.194
NP_441557.1_5 Reverse -333 -342 10.8161 0.00464
NP_441557.1_5 Forward -342 -333 10.4228 0.00915
NP_441557.1_5 Reverse -272 -281 0.491382 0.144
NP_441557.1_5 Forward -281 -272 0.29472 0.174
NP_442066.2_4 Forward -342 -323 -0.0988766 0.172
NP_442066.2_9 Forward -376 -363 7.39411 0.23
NP_441308.1_8 Reverse -331 -341 13.353 0.218
NP_441564.1_10 Reverse -304 -323 10.5209 0.146
NP_442183.1_1 Reverse -333 -347 7.17775 0.147
NP_442183.1_1 Forward -281 -267 4.91614 0.239
NP_442397.1_9 Forward -115 -96 6.19431 0.246
NP_442347.1_2 Forward -304 -295 8.06287 0.116
NP_442347.1_2 Forward -341 -332 3.34298 0.284
NP_441597.1_7 Reverse -138 -157 16.4207 0.291
NP_441037.1_4 Reverse -331 -341 7.31769 0.237
NP_441037.1_4 Forward -344 -334 5.85583 0.296
NP_440136.1_2 Forward -341 -334 15.9687 0.0123
NP_440136.1_2 Reverse -334 -341 15.9687 0.0123
NP_442998.1_5 Forward -222 -212 7.94484 0.278
NP_442998.1_10 Forward -340 -333 15.5754 0.0102
NP_442998.1_10 Reverse -274 -281 9.28223 0.117
NP_442998.1_10 Reverse -335 -342 5.84064 0.235
NP_440299.1_1 Reverse -268 -281 9.65513 0.0681
NP_440299.1_1 Forward -285 -272 3.55864 0.241
NP_441799.1_1 Forward -346 -332 14.4536 0.0236
NP_441799.1_1 Reverse -329 -343 3.8339 0.279
NP_441007.1_10 Reverse -328 -341 2.67422 0.183
NP_441007.1_10 Forward -347 -334 -0.472371 0.285
NP_442333.2_5 Reverse -316 -335 -9.53865 0.246
NP_440256.1_1 Forward -345 -326 7.37428 0.0259
NP_440256.1_1 Reverse -86 -105 -8.45701 0.261
NP_441559.1_8 Forward -103 -89 -6.78525 0.279
NP_440915.1_6 Reverse -329 -343 11.996 0.023
NP_440915.1_6 Reverse -268 -282 2.2612 0.121
NP_442866.1_1 Forward -347 -328 -4.72043 0.232
NP_441464.1_1 Forward -371 -352 14.1591 0.175
NP_441464.1_10 Forward -123 -109 8.84938 0.267
NP_441494.1_6 Reverse -358 -371 9.95071 0.227
NP_442386.1_9 Forward -343 -334 8.35743 0.201
NP_442386.1_9 Forward -360 -351 6.48915 0.219
NP_442386.1_9 Reverse -332 -341 6.39082 0.219
NP_440570.1_5 Reverse -262 -281 2.85105 0.234
NP_441340.1_5 Forward -341 -334 15.6737 0.0124
NP_441340.1_5 Reverse -334 -341 15.6737 0.0124
NP_442240.1_2 Forward -153 -134 -7.08038 0.123
NP_442240.1_2 Forward -341 -322 -13.1769 0.166
NP_440161.1_3 Reverse -331 -350 10.7175 0.229
NP_440161.1_3 Reverse -377 -396 9.43923 0.247
NP_440586.1_8 Forward -341 -334 13.2151 0.026
NP_440586.1_8 Reverse -334 -341 13.2151 0.026
NP_440586.1_8 Forward -91 -84 7.02027 0.279
NP_442251.1_6 Forward -341 -334 15.2804 0.0124
NP_442251.1_6 Reverse -334 -341 15.2804 0.0124
NP_442251.1_6 Forward -8 -1 8.10225 0.245
NP_442251.1_6 Reverse -380 -387 6.43063 0.298
NP_441262.1_3 Reverse -333 -340 14.7888 0.0223
NP_441262.1_3 Forward -342 -335 6.52896 0.0809
NP_443051.1_1 Reverse -332 -341 19.5676 0.00335
NP_443051.1_1 Forward -343 -334 10.1278 0.0112
NP_439937.1_9 Forward -374 -357 -10.0899 0.221
NP_439937.1_9 Forward -100 -83 -14.8098 0.287
NP_441595.1_2 Forward -165 -152 9.41998 0.277
NP_440439.1_1 Reverse -330 -343 0.60927 0.182
NP_440439.1_1 Forward -345 -332 -0.865694 0.241
NP_440372.1_2 Forward -341 -334 16.3621 0.0124
NP_440372.1_2 Reverse -334 -341 16.3621 0.0124
NP_440574.1_7 Forward -327 -308 13.7658 0.184
NP_441293.1_3 Reverse -35 -53 14.2303 0.291
NP_440316.1_10 Reverse -332 -342 12.1731 0.214
NP_441803.1_2 Forward -347 -328 0.982764 0.242
NP_441572.1_7 Reverse -327 -346 2.26107 0.135
NP_440267.1_2 Forward -347 -333 4.8172 0.292
NP_442384.1_10 Reverse -105 -118 2.18257 0.235
NP_442262.1_10 Forward -341 -334 14.1988 0.0123
NP_442262.1_10 Reverse -334 -341 14.1988 0.0123
NP_442262.1_10 Reverse -161 -168 8.59391 0.22
NP_441689.1_5 Reverse -331 -341 17.8758 0.0158
NP_440344.1_6 Forward -337 -323 16.2242 0.271
NP_440531.1_1 Forward -221 -202 1.96607 0.251
NP_440531.1_6 Reverse -91 -110 12.9791 0.048
NP_440531.1_6 Reverse -81 -100 -2.16383 0.246
NP_440562.1_3 Forward -341 -324 4.56207 0.192
NP_441640.1_8 Forward -341 -322 1.86774 0.168
NP_440297.1_9 Forward -341 -331 9.22315 0.0917
NP_442187.1_3 Reverse -332 -342 15.0247 0.12
NP_441592.1_4 Reverse -99 -118 7.47261 0.124
NP_440999.1_9 Forward -309 -295 0.88457 0.174
NP_440888.1_2 Forward -342 -328 16.9119 0.00511
NP_440888.1_2 Forward -281 -267 7.57046 0.19
NP_440792.1_5 Reverse -334 -353 7.86593 0.237
NP_440600.1_4 Forward -350 -332 -7.65067 0.293
NP_442948.1_2 Reverse -332 -351 9.93088 0.166
NP_442077.1_9 Forward -165 -146 -3.83545 0.22
NP_441543.1_2 Forward -341 -332 15.9293 0.00518
NP_441543.1_2 Reverse -334 -343 6.39124 0.153
NP_441543.1_2 Forward -280 -271 5.70292 0.181
NP_442845.1_2 Reverse -327 -341 12.3893 0.112
NP_442845.1_2 Forward -348 -334 7.76774 0.195
NP_442845.1_2 Forward -114 -100 5.50613 0.231
NP_441469.1_8 Reverse -332 -341 6.5879 0.227
NP_441469.1_8 Forward -343 -334 5.89959 0.246
NP_442578.1_7 Forward -341 -334 14.5921 0.026
NP_442578.1_7 Reverse -334 -341 14.5921 0.026
NP_441462.1_2 Reverse -333 -343 17.9746 0.00406
NP_441462.1_2 Forward -342 -332 10.4031 0.011
NP_441462.1_2 Reverse -272 -282 0.668351 0.135
NP_441621.1_7 Reverse -331 -345 -3.44199 0.188
NP_443062.1_1 Forward -342 -324 12.8362 0.0725
NP_440519.1_8 Forward -324 -308 5.07341 0.21
NP_442204.1_1 Reverse -329 -340 9.89177 0.0736
NP_442204.1_5 Reverse -96 -115 1.57275 0.232
NP_440255.1_3 Forward -157 -147 16.6368 0.298
NP_440516.1_8 Reverse -333 -342 18.9776 0.00442
NP_440516.1_8 Forward -342 -333 7.07956 0.0867
NP_442428.1_5 Forward -341 -334 15.8704 0.0124
NP_442428.1_5 Reverse -334 -341 15.8704 0.0124
NP_440673.1_3 Reverse -335 -342 13.1171 0.0426
NP_440673.1_3 Forward -340 -333 12.4288 0.0426
NP_440673.1_8 Forward -334 -317 15.3785 0.253
NP_441052.1_2 Forward -342 -332 10.9931 0.0285
NP_441052.1_2 Forward -281 -271 7.35486 0.0742
NP_441052.1_2 Reverse -333 -343 0.668351 0.256
NP_442219.1_9 Reverse -334 -343 8.84951 0.0681
NP_442219.1_9 Forward -341 -332 8.25953 0.0681
NP_440436.1_4 Forward -341 -332 9.24241 0.0871
NP_441884.1_9 Forward -284 -265 -15.1435 0.138
NP_440314.1_9 Reverse -334 -353 -10.1286 0.286
NP_441719.1_4 Forward -341 -334 16.3621 0.0124
NP_441719.1_4 Reverse -334 -341 16.3621 0.0124
NP_441004.1_4 Reverse -217 -227 13.648 0.216
NP_442813.1_4 Forward -130 -111 -3.54046 0.292
NP_441115.1_4 Forward -343 -325 9.55647 0.21
NP_442694.1_4 Forward -319 -310 14.1594 0.2
NP_442206.1_10 Reverse -333 -348 5.19144 0.178
NP_442515.1_1 Reverse -271 -285 -3.24533 0.289
NP_441396.1_5 Reverse -355 -364 15.1427 0.205
NP_441396.1_5 Forward -149 -140 9.4395 0.205
NP_441349.1_10 Forward -352 -333 3.44104 0.0669
NP_441349.1_10 Forward -118 -99 -4.52377 0.173
NP_441409.1_6 Forward -348 -329 -4.72043 0.0943
NP_441409.1_6 Reverse -327 -346 -6.29373 0.124
NP_440432.1_9 Forward -341 -326 3.81481 0.0824
NP_442843.1_1 Reverse -355 -374 -1.08219 0.192
NP_440474.1_8 Forward -168 -154 5.89884 0.237
NP_440474.1_8 Forward -341 -327 4.03056 0.294
NP_440396.1_7 Reverse -208 -227 15.5349 0.283
NP_440431.1_3 Reverse -298 -317 -12.0953 0.296
NP_442450.1_5 Reverse -331 -341 9.41981 0.115
NP_442450.1_5 Forward -344 -334 7.94484 0.13
NP_442168.1_4 Forward -223 -209 17.8958 0.252
NP_440588.1_2 Forward -351 -332 6.88262 0.0535
NP_440588.1_2 Forward -117 -98 -2.65548 0.17
NP_441003.1_9 Reverse -263 -282 9.24257 0.215
NP_441570.1_1 Forward -281 -263 -7.06068 0.0841
NP_441570.1_1 Reverse -333 -351 -7.45401 0.0895
NP_441078.1_4 Reverse -333 -342 9.93116 0.0203
NP_441078.1_4 Forward -342 -333 9.83282 0.0226
NP_441078.1_4 Forward -281 -272 8.45619 0.0281
NP_441078.1_4 Reverse -272 -281 7.37455 0.0688
NP_441078.1_4 Reverse -105 -114 6.09625 0.0863
NP_442729.1_8 Reverse -268 -281 7.39411 0.153
NP_442348.1_2 Reverse -363 -372 10.6195 0.259
NP_442443.1_1 Reverse -356 -375 -1.37718 0.233
NP_440526.1_3 Forward -341 -330 1.82816 0.267
NP_441432.1_8 Reverse -332 -341 16.8143 0.00595
NP_441432.1_8 Forward -343 -334 6.98123 0.112
NP_441432.1_8 Reverse -98 -107 3.34298 0.248
NP_442320.1_8 Reverse -327 -341 13.8643 0.0144
NP_442320.1_8 Reverse -266 -280 -6.19526 0.269
NP_441732.1_2 Reverse -329 -345 -16.4611 0.167
NP_441732.1_2 Forward -346 -330 -17.7394 0.292
NP_440760.1_1 Reverse -272 -291 -10.9153 0.0849
NP_440760.1_1 Forward -281 -262 -16.9135 0.189
NP_440760.1_10 Reverse -92 -102 18.7612 0.284
NP_440199.1_10 Reverse -330 -340 14.238 0.0861
NP_440199.1_10 Reverse -293 -303 12.9597 0.114
NP_441057.1_3 Reverse -203 -222 -11.6036 0.237
NP_442178.1_10 Forward -254 -235 17.699 0.281
NP_442353.1_4 Forward -104 -85 0.490334 0.268
NP_440713.1_4 Forward -335 -316 1.76941 0.279
NP_442489.1_7 Reverse -333 -342 10.4228 0.0151
NP_442489.1_7 Forward -342 -333 10.3245 0.0193
NP_442489.1_7 Reverse -272 -281 1.1797 0.101
NP_442489.1_7 Forward -281 -272 0.491382 0.178
NP_440559.1_1 Forward -341 -332 8.65285 0.0586
NP_441659.2_8 Forward -342 -332 11.3864 0.0184
NP_441659.2_8 Reverse -333 -343 11.3864 0.0184
NP_441659.2_8 Reverse -272 -282 -0.118297 0.287
NP_441022.1_1 Forward -206 -197 12.6973 0.232
NP_441040.1_2 Forward -123 -104 -11.8986 0.255
NP_441040.1_2 Reverse -202 -221 -14.5535 0.286
NP_441040.1_5 Forward -226 -207 6.19431 0.229
NP_442346.1_5 Forward -343 -333 12.4681 0.0421
NP_442346.1_5 Reverse -332 -342 7.84651 0.156
NP_442346.1_5 Forward -282 -272 4.60159 0.281
NP_440545.1_3 Forward -346 -329 2.59545 0.0976
NP_440025.1_3 Forward -376 -362 13.2247 0.247
NP_440831.1_1 Forward -341 -322 15.5357 0.232
NP_441629.1_3 Reverse -308 -327 -0.886293 0.25
NP_440004.1_5 Reverse -328 -347 15.3391 0.293
NP_440459.1_2 Reverse -324 -341 8.49531 0.259
NP_442137.1_1 Reverse -204 -223 6.09597 0.26
NP_440847.1_3 Forward -371 -357 14.6503 0.198
NP_442603.1_7 Forward -305 -291 8.06211 0.187
NP_442603.1_7 Forward -281 -267 6.98048 0.221
NP_441050.1_5 Forward -325 -307 0.904127 0.234
NP_440449.1_6 Reverse -325 -343 8.45036 0.201
NP_441833.1_4 Forward -341 -334 15.9687 0.0124
NP_441833.1_4 Reverse -334 -341 15.9687 0.0124
NP_441112.1_6 Reverse -305 -324 8.35759 0.135
NP_442162.1_9 Forward -341 -334 16.2637 0.0124
NP_442162.1_9 Reverse -334 -341 16.2637 0.0124
NP_440671.1_4 Reverse -327 -341 15.4376 0.0442
NP_443026.1_5 Forward -328 -309 0.491109 0.283
NP_440224.1_1 Reverse -322 -341 7.66927 0.0928
NP_441044.1_4 Reverse -310 -328 14.4738 0.223
NP_442140.1_3 Reverse -334 -344 8.4365 0.119
NP_442021.1_3 Forward -287 -268 -7.08038 0.261
NP_440875.1_9 Forward -340 -330 7.59334 0.255
NP_441813.1_5 Reverse -331 -341 15.9097 0.01
NP_441813.1_5 Forward -344 -334 8.63316 0.0367
NP_440590.1_4 Forward -341 -328 4.05085 0.0642
NP_440567.1_1 Forward -341 -327 14.3559 0.0187
NP_440567.1_1 Reverse -334 -348 7.66941 0.067
NP_442497.1_10 Forward -341 -332 17.601 0.00813
NP_442497.1_10 Reverse -334 -343 8.55452 0.0294
NP_442497.1_10 Reverse -273 -282 0.393051 0.175
NP_440821.1_4 Reverse -331 -341 11.0914 0.0146
NP_440821.1_4 Forward -344 -334 -0.118297 0.229
NP_441239.1_9 Forward -344 -332 10.8554 0.0714
NP_442691.1_2 Reverse -313 -332 5.40766 0.247
NP_441892.1_1 Forward -101 -84 14.0018 0.034
NP_441892.1_1 Forward -64 -47 -4.28772 0.258
NP_441508.1_4 Reverse -307 -321 13.285 0.297
NP_442629.1_3 Reverse -156 -175 7.27595 0.255
NP_441874.1_1 Forward -333 -319 9.73436 0.276
NP_442216.1_4 Forward -370 -362 8.08217 0.255
NP_440876.1_5 Forward -176 -157 5.80098 0.283
NP_440546.1_4 Reverse -333 -343 14.7 0.0459
NP_440546.1_4 Forward -342 -332 10.8217 0.104
NP_440546.1_7 Reverse -90 -100 13.8447 0.295
NP_440462.1_6 Reverse -331 -341 16.893 0.00853
NP_440462.1_6 Forward -344 -334 9.51814 0.043
NP_442340.1_3 Forward -370 -351 -4.52377 0.217
NP_442340.1_3 Forward -371 -352 -10.227 0.284
NP_442592.1_7 Reverse -226 -245 16.5191 0.224
NP_440868.1_4 Forward -346 -334 14.1986 0.019
NP_440868.1_4 Reverse -329 -341 -0.846001 0.282
NP_440401.1_9 Reverse -109 -116 12.6251 0.287
NP_440374.1_6 Forward -338 -319 11.1109 0.174
NP_442402.1_4 Reverse -205 -224 -6.49113 0.259
NP_442402.1_10 Forward -369 -359 10.206 0.299
NP_441848.1_7 Reverse -150 -169 2.6536 0.219
NP_441084.1_6 Reverse -374 -388 10.7985 0.228
NP_442039.1_4 Forward -341 -334 15.1821 0.0124
NP_442039.1_4 Reverse -334 -341 15.1821 0.0124
NP_442039.1_4 Reverse -273 -280 8.29892 0.213
NP_442039.1_7 Forward -167 -157 14.533 0.211
NP_441811.1_1 Forward -372 -353 6.29264 0.28
NP_441811.1_1 Reverse -210 -229 5.99764 0.28
NP_441926.1_3 Forward -342 -326 5.76173 0.17
NP_442696.1_6 Forward -102 -83 -6.98204 0.235
NP_442837.1_3 Forward -341 -334 15.7721 0.0124
NP_442837.1_3 Reverse -334 -341 15.7721 0.0124
NP_442053.1_1 Reverse -333 -342 17.601 0.00138
NP_442053.1_1 Forward -342 -333 16.2243 0.00451
NP_442053.1_1 Forward -281 -272 4.91628 0.218
NP_440505.1_3 Reverse -331 -341 15.123 0.014
NP_440505.1_3 Reverse -270 -280 6.07655 0.197
NP_441102.1_1 Forward -341 -322 15.1424 0.097
NP_441252.1_6 Forward -223 -216 11.9372 0.25
NP_442532.1_7 Reverse -333 -347 1.47456 0.285
NP_440914.1_1 Reverse -333 -343 15.0561 0.00832
NP_440914.1_1 Forward -342 -332 13.7874 0.0256
NP_440914.1_1 Forward -220 -210 7.73678 0.224
NP_441011.1_8 Forward -341 -332 16.6177 0.00602
NP_441011.1_8 Reverse -334 -343 15.0444 0.0176
NP_442101.1_10 Forward -350 -331 -5.99873 0.181
NP_442533.1_6 Reverse -333 -342 7.86621 0.0862
NP_442533.1_6 Forward -342 -333 7.37455 0.0898
NP_442533.1_6 Reverse -99 -108 2.85133 0.236
NP_442322.1_4 Reverse -306 -323 -8.71327 0.286
NP_442535.1_2 Forward -327 -308 6.4893 0.266
NP_441482.1_7 Reverse -327 -341 -1.18038 0.0637
NP_441482.1_7 Reverse -99 -113 -11.4068 0.262
NP_439944.1_9 Forward -341 -331 17.6796 0.00347
NP_439944.1_9 Forward -280 -270 12.5664 0.0887
NP_441028.1_6 Forward -304 -294 10.1076 0.21
NP_440116.1_8 Forward -341 -322 5.70265 0.0622
NP_440116.1_8 Reverse -334 -353 -1.27885 0.117
NP_440007.1_9 Reverse -329 -343 20.3541 0.0702
NP_441106.1_1 Reverse -332 -341 18.486 0.0028
NP_441106.1_1 Forward -343 -334 9.34117 0.0333
NP_441286.1_1 Reverse -271 -283 -3.99259 0.148
NP_441286.1_1 Forward -343 -331 -4.28759 0.154
NP_441286.1_1 Reverse -332 -344 -4.48425 0.161
NP_442674.1_3 Forward -100 -81 9.93006 0.174
NP_440670.1_8 Reverse -333 -342 9.04618 0.0606
NP_440670.1_8 Forward -342 -333 8.75118 0.0606
NP_440670.1_8 Forward -281 -272 5.3096 0.167
NP_440886.1_7 Forward -343 -333 8.04271 0.0805
NP_440886.1_7 Reverse -332 -342 6.76441 0.114
NP_440886.1_7 Forward -282 -272 5.58445 0.175
NP_440460.1_10 Forward -282 -263 16.2241 0.234
NP_442072.1_9 Forward -343 -325 -3.52077 0.0363
NP_440907.2_8 Forward -341 -331 9.51767 0.103
NP_440907.2_8 Reverse -334 -344 6.76441 0.15
NP_440841.1_4 Forward -222 -203 -4.42544 0.187
NP_440841.1_4 Reverse -331 -350 -10.522 0.283
NP_441463.1_3 Forward -352 -333 -0.197208 0.132
NP_442842.1_4 Forward -341 -322 9.3409 0.223
NP_441626.1_2 Forward -341 -334 15.7721 0.0124
NP_441626.1_2 Reverse -334 -341 15.7721 0.0124
NP_442794.1_1 Forward -346 -334 3.77555 0.286
NP_441401.1_2 Forward -307 -288 15.9291 0.15
NP_442615.1_1 Forward -351 -333 -2.53746 0.145
NP_442615.1_1 Reverse -324 -342 -5.97904 0.231
NP_441962.1_4 Forward -286 -267 -7.57203 0.191
NP_440387.1_1 Reverse -333 -349 -2.10475 0.146
NP_440387.1_1 Reverse -272 -288 -3.08806 0.155
NP_440387.1_1 Forward -281 -265 -5.05468 0.212
NP_441488.1_8 Reverse -328 -342 10.2254 0.146
NP_441836.1_2 Reverse -87 -106 -5.01543 0.269
NP_441993.1_1 Reverse -327 -346 4.18821 0.223
NP_440114.1_10 Forward -342 -328 10.1277 0.153
NP_440114.1_10 Reverse -333 -347 7.17775 0.243
NP_441206.1_6 Forward -334 -315 13.0775 0.278
NP_442324.1_3 Forward -92 -73 13.1758 0.194
NP_440293.1_1 Forward -236 -217 13.6675 0.163
NP_440766.1_4 Reverse -329 -343 8.75105 0.0871
NP_439910.1_2 Reverse -325 -342 -12.9408 0.113
NP_442867.1_8 Reverse -91 -110 5.30933 0.276
NP_440457.1_1 Reverse -329 -341 7.11881 0.105
NP_440798.1_6 Reverse -334 -347 1.10092 0.234
NP_442680.1_5 Reverse -177 -196 -0.806985 0.294
NP_442509.1_9 Reverse -105 -115 6.66608 0.259
NP_442509.1_9 Reverse -333 -343 6.56775 0.263
NP_440554.1_4 Forward -341 -331 16.1063 0.0189
NP_440554.1_4 Reverse -334 -344 2.24165 0.271
NP_441885.1_5 Forward -281 -271 10.1081 0.0145
NP_441885.1_5 Reverse -333 -343 2.24165 0.0822
NP_441885.1_5 Forward -342 -332 1.55333 0.109
NP_441885.1_5 Reverse -99 -109 -0.806614 0.228
NP_441885.1_5 Reverse -105 -115 -1.59326 0.273
NP_442341.1_7 Forward -282 -268 12.9793 0.0392
NP_442341.1_9 Reverse -331 -345 16.9119 0.0319
NP_442341.1_9 Forward -344 -330 13.7653 0.0763
NP_441756.1_5 Forward -364 -345 1.67108 0.215
NP_441173.1_9 Forward -367 -359 10.1471 0.261
NP_440423.1_10 Reverse -289 -308 9.83255 0.259
NP_443000.1_7 Reverse -331 -341 17.4829 0.00719
NP_443000.1_7 Forward -344 -334 1.65166 0.235
NP_441842.1_10 Reverse -326 -340 7.66941 0.249
NP_440275.1_3 Reverse -331 -341 9.12481 0.055
NP_440091.1_1 Reverse -329 -341 1.41561 0.197
NP_441397.1_8 Forward -211 -198 11.8073 0.289
NP_441122.1_1 Forward -59 -44 6.27308 0.28
NP_440866.1_2 Reverse -100 -119 18.0915 0.176
NP_440149.1_8 Forward -281 -262 -7.96535 0.296
NP_441105.1_3 Reverse -322 -341 -6.98204 0.243
NP_441105.1_3 Reverse -94 -113 -8.65367 0.275
NP_440216.1_1 Forward -342 -328 -1.8687 0.0412
NP_440216.1_1 Reverse -333 -347 -4.32697 0.107
NP_440216.1_9 Forward -91 -82 6.5879 0.289
NP_440172.1_1 Reverse -333 -343 18.5646 0.00421
NP_440172.1_1 Forward -342 -332 7.74818 0.0738
NP_440172.1_1 Forward -281 -271 3.51995 0.224
NP_441226.1_7 Forward -341 -334 14.4934 0.0123
NP_441226.1_7 Reverse -334 -341 14.4934 0.0123
NP_441226.1_7 Reverse -220 -227 6.52862 0.253
NP_441226.1_7 Reverse -280 -287 5.34865 0.289
NP_441111.1_7 Forward -341 -333 18.7023 0.00294
NP_441111.1_7 Reverse -334 -342 8.96754 0.0463
NP_442379.1_10 Reverse -326 -343 2.89044 0.204
NP_441766.1_2 Forward -342 -333 18.2893 0.00297
NP_441766.1_2 Reverse -333 -342 9.14451 0.0337
NP_441766.1_2 Forward -281 -272 3.83464 0.202
NP_442417.1_5 Forward -342 -328 10.3243 0.12
NP_442417.1_5 Reverse -333 -347 6.6861 0.211
NP_440416.1_1 Reverse -333 -352 -2.0655 0.116
NP_440845.1_1 Forward -310 -291 -3.93378 0.206
NP_442403.1_8 Forward -326 -307 -1.96717 0.263
NP_440261.1_5 Forward -341 -328 -10.6005 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAGAGCCTACTGTGCAATCTTGGTTTGAGCCAATTCCCCCCACGGAACCCTGTAACTACGCGATCGCCTTTGGATTAGGGGCGGCTTTTTGGGGCATTGATCTCCATCAAAGTGGGTTGGGCTATCTCCACAGTTGGGCTAATAACCTAATTTCGGCGGGGTTAAGACTGATTCCGTTGGGGCAAACCGCAGGTCAAAAATTGTTATTGCATTTAACACCCACCATTTTGCATCAATGGCAGCAAATTTTATTGCTGGGGGATGATGATTTGTACAGTTGTAGTTGGGGGTTAGCCCTAGCCAGCATGGGCCATGAAAGTCAATACACTAGATTATTCCGGAGTTAGCTATGGATAAGTAGTAGACAAATAATTGTCTATGCAAAGCATTGTGAGATTAC

CDS

ATGGGGAGTTATAGCCAATTAGACCTAGATATATCCCTTTGCACAAAGTACCGGCTCCTATGTAATGCTGGTGATAGCCTAATTAGTCTATTACCTCATCCTATGACTGCTACTGTTACAGCCCAAGAAGCCTTCCGAGCCGCCTATGAAAACCGCTACACCTGGGACGAAAATTTTCCCGGTTATCGGGCCCATCTCACCGTCACCCAAGGGGATGAACGCTACGAAGGGGAAGTGGAGGTGAAGGCGGACTACACTGTCACCGTGACTGGTTTTAGTGACGAGACGGTACAGGAAAGCGTTTATAACCAAATGCGGGACATTGTTACCCACCGCAAACAAGGGAATTTTGAAAAGTCCCACGGCAAAAATGAGTTTAGCTTTGGGGAAACCGATGCTTCCGGGGCGATCGCCATTGATGTGAAGGGAGATGCCATGGGGTCGAACTATAAAATCCGGGGCACGGAAATTTGTCAGGTCAGTCGGGTGATGGGGCCGGTGGCTTTCACCATCAACACCGAAGAAAGTTTGGATACTGGTTCCGGCTACATTGCCATCAAATATAATGCCATTTTTAAAGACCCTAAAACTGATACCCTCAAAGGCAAACGGGACTTCACCGAAACCTATGGGGAATTGGGGGGCTATTACCTACCCACTCAACAAACCGTAGAGGCGATCGCCGCTGGGGGAGAAAAAATCTTCACCGATTTTAGCTTCACTAATCTAGAACTTTTGGCATAG

Protein

MGSYSQLDLDISLCTKYRLLCNAGDSLISLLPHPMTATVTAQEAFRAAYENRYTWDENFPGYRAHLTVTQGDERYEGEVEVKADYTVTVTGFSDETVQESVYNQMRDIVTHRKQGNFEKSHGKNEFSFGETDASGAIAIDVKGDAMGSNYKIRGTEICQVSRVMGPVAFTINTEESLDTGSGYIAIKYNAIFKDPKTDTLKGKRDFTETYGELGGYYLPTQQTVEAIAAGGEKIFTDFSFTNLELLA