Your browser is old and dusty. Try Google Chrome!

Details for slr1881

ORF slr1881
Accession NP_441015.1
Symbol natE
Category ATP-binding subunit of the ABC-type Nat permease for neutral amino acids
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -280 -266 -1.18038 0.252
NP_441818.1_9 Forward -114 -95 -7.08038 0.268
NP_440226.1_1 Forward -196 -177 1.96607 0.282
NP_440996.1_5 Reverse -14 -23 14.7878 0.259
NP_441816.1_6 Forward -112 -100 19.0169 0.218
NP_442655.1_10 Forward -176 -157 -19.1751 0.282
NP_443002.1_5 Reverse -179 -197 10.4414 0.256
NP_442173.1_1 Forward -228 -220 7.8859 0.134
NP_440074.1_6 Forward -340 -321 9.7334 0.27
NP_441225.1_1 Forward -194 -175 7.47261 0.0498
NP_442909.1_7 Reverse -287 -301 6.68548 0.242
NP_441054.1_2 Forward -31 -12 12.4875 0.229
NP_441054.1_2 Reverse -159 -178 9.93088 0.284
NP_440878.1_9 Forward -197 -178 0.884433 0.187
NP_440761.1_9 Reverse -340 -359 12.6841 0.195
NP_441859.1_3 Forward -266 -247 4.71854 0.215
NP_441619.1_8 Reverse -73 -87 6.29216 0.299
NP_440893.1_3 Forward -276 -257 -0.197979 0.28
NP_441594.1_6 Reverse -200 -219 3.34271 0.231
NP_442110.1_7 Reverse -152 -166 2.35953 0.222
NP_441082.1_10 Forward -113 -100 9.16406 0.256
NP_442827.1_8 Forward -273 -254 0.490334 0.206
NP_442827.1_8 Forward -36 -17 -1.8696 0.26
NP_441434.1_7 Forward -194 -180 2.85119 0.268
NP_442889.1_8 Forward -91 -77 7.3738 0.152
NP_440447.1_5 Forward -41 -31 12.9597 0.291
NP_441770.1_4 Reverse -231 -250 -0.787193 0.184
NP_441025.1_6 Forward -386 -367 3.92987 0.237
NP_441716.1_1 Forward -155 -141 6.48943 0.198
NP_441598.1_3 Forward -259 -240 12.0919 0.277
NP_441624.1_7 Forward -331 -317 8.25939 0.24
NP_440438.2_8 Forward -388 -369 1.0811 0.282
NP_440747.1_1 Forward -247 -229 8.57394 0.246
NP_442973.1_5 Forward -316 -297 9.93088 0.287
NP_442973.1_8 Forward -199 -181 17.7187 0.179
NP_443017.1_1 Reverse -371 -390 14.8375 0.274
NP_441014.1_8 Reverse -153 -172 -2.0655 0.231
NP_442848.1_9 Reverse -147 -166 5.11266 0.202
NP_443018.1_3 Forward -306 -299 4.36568 0.254
NP_443018.1_3 Reverse -299 -306 4.07068 0.299
NP_441634.1_9 Forward -117 -98 7.96345 0.294
NP_440376.1_1 Forward -187 -178 2.16301 0.233
NP_441077.1_6 Reverse -346 -362 4.34438 0.255
NP_440066.1_5 Forward -293 -274 7.96345 0.256
NP_442485.1_3 Reverse -287 -306 1.27776 0.23
NP_441013.1_3 Reverse -254 -273 16.3224 0.201
NP_441013.1_7 Reverse -149 -168 24.2863 0.0124
NP_442658.1_1 Forward -309 -299 11.1893 0.0915
NP_442658.1_1 Reverse -185 -195 5.28945 0.274
NP_441855.2_4 Reverse -179 -198 9.71588 0.275
NP_442782.1_2 Forward -307 -293 9.2427 0.198
NP_442782.1_2 Forward -112 -98 3.34284 0.265
NP_441414.1_2 Forward -292 -273 9.63589 0.264
NP_440180.1_1 Forward -309 -290 17.2074 0.179
NP_442486.1_6 Reverse -280 -299 -5.60541 0.279
NP_439905.1_2 Forward -280 -266 16.4209 0.188
NP_439905.1_2 Reverse -287 -301 9.63603 0.23
NP_440984.1_7 Reverse -288 -302 9.14437 0.131
NP_441580.1_6 Forward -207 -188 -0.590531 0.168
NP_443044.1_1 Reverse -145 -164 8.16093 0.233
NP_441099.1_5 Reverse -282 -301 -11.2103 0.273
NP_442002.1_1 Reverse -263 -281 -8.73231 0.27
NP_442002.1_9 Reverse -165 -172 12.2322 0.185
NP_440809.1_2 Forward -177 -158 -3.93378 0.283
NP_440879.1_6 Forward -234 -215 3.04771 0.231
NP_440377.1_1 Forward -374 -357 13.5929 0.231
NP_441000.1_6 Reverse -297 -311 -3.147 0.221
NP_442771.1_4 Forward -324 -310 19.8624 0.23
NP_440465.1_10 Forward -305 -286 -1.08219 0.29
NP_441041.1_4 Forward -301 -282 -10.227 0.228
NP_439966.1_7 Reverse -185 -195 4.60114 0.265
NP_439966.1_9 Reverse -185 -194 9.93116 0.186
NP_442281.1_1 Forward -243 -229 2.45727 0.266
NP_442575.1_8 Forward -174 -155 -6.78538 0.286
NP_440647.1_9 Forward -297 -279 6.01734 0.228
NP_442068.1_4 Forward -211 -192 7.86512 0.23
NP_442554.1_9 Reverse -226 -245 12.4065 0.279
NP_441762.1_7 Forward -197 -185 5.74217 0.0331
NP_442142.1_4 Forward -242 -229 3.16532 0.265
NP_441024.1_6 Reverse -302 -321 9.97848 0.219
NP_443009.1_3 Forward -286 -268 18.5054 0.275
NP_443009.1_6 Forward -198 -179 28.5154 0.0000204
NP_443009.1_7 Forward -154 -135 23.5006 0.0128
NP_443009.1_8 Forward -218 -199 18.7807 0.0619
NP_443009.1_9 Forward -178 -159 14.2574 0.0431
NP_440183.1_9 Forward -309 -290 -20.3551 0.282
NP_441468.1_1 Forward -306 -299 4.36568 0.237
NP_441015.1_1 Forward -333 -315 30.9934 0.000109
NP_441015.1_2 Forward -309 -290 33.2353 0.00000788
NP_441015.1_3 Forward -202 -183 34.5136 0.0000162
NP_441015.1_4 Forward -172 -153 31.662 0.000107
NP_441015.1_5 Forward -280 -261 29.9904 0.000183
NP_441015.1_6 Forward -226 -207 35.5953 0.00000168
NP_441015.1_7 Forward -145 -126 28.5154 0.000539
NP_441015.1_8 Forward -259 -240 16.7157 0.105
NP_441172.1_1 Reverse -289 -307 1.10079 0.282
NP_441330.1_1 Reverse -161 -180 -8.16202 0.183
NP_442719.1_2 Forward -383 -365 -6.37307 0.225
NP_441251.1_8 Reverse -4 -17 15.5315 0.254
NP_442677.1_5 Reverse -274 -293 13.7658 0.251
NP_441612.1_2 Forward -248 -238 8.74291 0.21
NP_442227.1_2 Reverse -96 -115 -0.000545616 0.253
NP_442227.1_2 Reverse -95 -114 -3.63879 0.294
NP_440789.1_8 Reverse -176 -195 15.5357 0.197
NP_442427.1_8 Reverse -366 -385 6.98095 0.224
NP_441315.1_2 Forward -317 -299 15.0845 0.245
NP_440038.1_5 Reverse -211 -230 16.8141 0.209
NP_440558.1_2 Reverse -143 -162 0.491109 0.19
NP_440558.1_2 Reverse -289 -308 -2.75381 0.229
NP_440558.1_2 Reverse -199 -218 -7.37537 0.293
NP_440558.1_8 Reverse -181 -200 18.289 0.0827
NP_440162.1_2 Forward -113 -94 5.60432 0.282
NP_442593.1_6 Reverse -260 -279 16.5608 0.279
NP_442503.1_9 Forward -188 -169 6.68596 0.272
NP_442066.2_4 Reverse -187 -206 -0.39387 0.173
NP_442777.1_3 Reverse -279 -297 0.116744 0.297
NP_442419.1_2 Forward -201 -182 10.3242 0.122
NP_440084.1_8 Forward -362 -348 15.1948 0.18
NP_441739.1_2 Forward -94 -78 5.36772 0.228
NP_441739.1_2 Forward -375 -359 3.59778 0.264
NP_440101.1_10 Reverse -287 -306 3.44104 0.236
NP_442183.1_5 Forward -74 -55 20.7473 0.202
NP_440356.1_10 Reverse -139 -157 11.5239 0.253
NP_441574.1_1 Reverse -175 -194 6.4893 0.112
NP_442645.1_2 Forward -304 -285 -22.5183 0.291
NP_441633.1_3 Forward -267 -254 13.9823 0.018
NP_442590.1_10 Forward -235 -216 5.60432 0.258
NP_442998.1_5 Forward -377 -367 10.2065 0.222
NP_440899.1_1 Reverse -287 -306 6.16283 0.287
NP_440299.1_1 Forward -237 -224 2.67367 0.279
NP_441799.1_1 Reverse -294 -308 9.34041 0.0942
NP_442852.1_2 Forward -205 -186 20.354 0.0524
NP_441559.1_8 Forward -270 -256 -3.04867 0.197
NP_440915.1_6 Forward -145 -131 -0.295402 0.189
NP_440695.1_6 Reverse -64 -78 18.3619 0.102
NP_441494.1_6 Forward -146 -133 9.36073 0.227
NP_442386.1_9 Forward -308 -299 10.324 0.132
NP_441750.1_4 Reverse -286 -305 3.14605 0.233
NP_441340.1_5 Reverse -299 -306 3.97235 0.274
NP_443028.1_4 Reverse -54 -73 7.48206 0.293
NP_441160.1_1 Forward -149 -130 -11.3086 0.292
NP_440586.1_8 Forward -306 -299 5.8403 0.283
NP_442251.1_6 Forward -195 -188 8.69224 0.199
NP_442959.1_5 Forward -376 -357 8.55425 0.224
NP_440027.1_3 Forward -266 -248 5.32826 0.245
NP_439937.1_9 Forward -189 -172 -2.61678 0.152
NP_442294.1_3 Reverse -233 -247 13.7653 0.252
NP_441167.1_1 Forward -390 -371 8.06259 0.213
NP_440819.1_5 Forward -248 -240 17.424 0.185
NP_440316.1_10 Reverse -265 -275 6.96153 0.251
NP_441803.1_2 Reverse -248 -267 0.786102 0.244
NP_441803.1_2 Reverse -170 -189 -0.000545616 0.263
NP_439977.1_5 Forward -287 -268 0.294447 0.211
NP_439977.1_5 Reverse -286 -305 -1.67217 0.257
NP_441572.1_1 Reverse -227 -246 -3.54046 0.212
NP_440267.1_2 Reverse -14 -28 10.2254 0.145
NP_441877.1_5 Forward -24 -5 -2.16383 0.296
NP_442790.1_4 Forward -196 -177 -1.57384 0.104
NP_442790.1_4 Forward -316 -297 -14.0619 0.271
NP_442244.1_6 Forward -289 -270 10.8159 0.225
NP_440531.1_8 Reverse -328 -347 4.42435 0.269
NP_440297.1_9 Reverse -33 -43 0.176696 0.282
YP_680420.1_4 Forward -124 -105 18.584 0.299
NP_440888.1_2 Forward -281 -267 9.53707 0.123
NP_440803.1_8 Reverse -164 -183 13.7658 0.238
NP_442818.1_3 Reverse -8 -25 -4.48438 0.243
NP_442077.1_8 Reverse -227 -246 11.7983 0.26
NP_441543.1_2 Reverse -188 -197 4.52295 0.234
NP_441543.1_3 Reverse -96 -110 8.16044 0.286
NP_440208.1_1 Reverse -216 -235 -10.522 0.257
NP_441304.1_10 Forward -158 -149 14.356 0.175
NP_442710.1_8 Reverse -265 -284 17.0107 0.248
NP_441469.1_8 Forward -308 -299 5.89959 0.246
NP_442204.1_1 Reverse -75 -86 4.77856 0.238
NP_442204.1_1 Reverse -28 -39 2.91027 0.266
NP_442204.1_1 Forward -257 -246 0.353664 0.281
NP_440516.1_2 Reverse -93 -111 -1.94747 0.295
NP_442428.1_5 Forward -306 -299 4.759 0.223
NP_440783.1_5 Forward -205 -186 -4.32711 0.276
NP_441443.1_1 Forward -164 -145 -5.11376 0.297
NP_441443.1_2 Reverse -285 -304 -5.40875 0.29
NP_441443.1_7 Forward -158 -139 14.4541 0.0924
NP_442120.1_10 Forward -193 -174 -16.1268 0.296
NP_440673.1_2 Forward -206 -187 10.0969 0.224
NP_440673.1_3 Forward -194 -187 10.4622 0.139
NP_440865.1_9 Forward -161 -142 -3.54046 0.194
NP_442219.1_8 Forward -394 -375 6.42771 0.298
NP_441884.1_8 Reverse -186 -205 -5.01543 0.172
NP_441884.1_9 Reverse -149 -168 -20.8467 0.211
NP_440689.1_7 Forward -191 -173 14.2763 0.3
NP_440222.1_6 Forward -128 -115 20.5705 0.0977
NP_441719.1_4 Reverse -188 -195 3.77569 0.285
NP_441733.1_10 Reverse -184 -197 4.34585 0.266
NP_441004.1_1 Forward -173 -154 -16.6185 0.286
NP_441004.1_5 Reverse -253 -267 10.816 0.241
NP_442139.1_7 Reverse -261 -280 7.27595 0.287
NP_440129.1_10 Forward -260 -246 4.12949 0.185
NP_442694.1_9 Forward -349 -330 11.7992 0.207
NP_441542.1_4 Reverse -140 -154 5.60446 0.264
NP_442898.1_2 Reverse -57 -76 16.1249 0.287
NP_442709.1_3 Reverse -126 -145 25.3688 0.0063
NP_442843.1_1 Forward -161 -142 -3.83545 0.23
NP_442843.1_1 Forward -117 -98 -9.24366 0.264
NP_442843.1_1 Forward -237 -218 -11.8003 0.293
NP_440431.1_3 Forward -327 -308 -6.78538 0.195
NP_441031.1_1 Forward -392 -373 9.61851 0.212
NP_442006.1_2 Reverse -178 -195 -16.7758 0.264
NP_440483.1_1 Forward -168 -149 -5.80207 0.234
NP_441663.1_8 Forward -148 -129 9.3409 0.0868
NP_442348.1_2 Reverse -365 -374 7.17789 0.285
NP_442348.1_2 Reverse -329 -338 6.5879 0.299
NP_440707.1_9 Forward -166 -147 0.294447 0.293
NP_442443.1_1 Forward -148 -129 5.89931 0.157
NP_442320.1_8 Forward -202 -188 -5.11362 0.206
NP_442320.1_8 Reverse -214 -228 -6.58858 0.296
NP_441057.1_4 Forward -156 -138 -2.53746 0.274
NP_440913.1_1 Reverse -30 -48 9.55725 0.178
NP_440713.1_4 Forward -118 -99 6.78429 0.185
NP_440713.1_4 Forward -113 -94 5.211 0.214
NP_442079.1_7 Forward -195 -176 5.70265 0.17
NP_442749.1_5 Forward -373 -356 6.58478 0.298
NP_440708.1_6 Reverse -138 -157 -10.3253 0.278
NP_441856.1_8 Forward -282 -263 14.1591 0.215
NP_440025.1_4 Reverse -136 -155 12.5858 0.233
NP_440831.1_3 Reverse -136 -155 8.81407 0.221
NP_441126.1_6 Reverse -6 -20 13.567 0.3
NP_440250.1_4 Forward -85 -66 4.12856 0.264
NP_440459.1_2 Reverse -284 -301 7.41366 0.291
NP_441653.1_2 Forward -306 -287 3.14308 0.274
NP_441943.1_5 Reverse -55 -74 13.882 0.288
NP_442137.1_1 Forward -290 -271 17.7974 0.0601
NP_440847.1_3 Reverse -96 -110 11.9953 0.254
NP_442603.1_9 Forward -309 -291 15.5554 0.173
NP_442603.1_9 Reverse -139 -157 6.70565 0.279
NP_440946.1_6 Reverse -176 -195 2.75272 0.294
NP_441047.1_1 Forward -204 -185 0.392778 0.269
NP_442162.1_9 Forward -228 -221 5.93897 0.214
NP_440224.1_4 Reverse -223 -242 1.57275 0.244
NP_440875.1_9 Reverse -300 -310 7.59334 0.255
NP_442547.1_7 Forward -269 -250 13.9211 0.177
NP_441813.1_5 Forward -309 -299 -0.511621 0.247
NP_440590.1_4 Forward -238 -225 0.412608 0.157
NP_441239.1_9 Forward -304 -292 3.18557 0.292
NP_441239.1_9 Forward -90 -78 3.18557 0.292
NP_442044.1_1 Forward -253 -234 -14.4552 0.291
NP_442643.1_5 Forward -226 -207 -6.09707 0.293
NP_442629.1_3 Reverse -183 -202 5.11266 0.272
NP_440354.1_7 Forward -202 -184 5.72234 0.297
NP_440462.1_6 Reverse -185 -195 4.0116 0.219
NP_442899.1_4 Reverse -48 -64 6.15437 0.259
NP_442402.1_2 Forward -22 -8 14.3553 0.263
NP_441848.1_7 Forward -22 -3 4.03023 0.217
NP_440653.1_5 Reverse -179 -198 7.17762 0.271
NP_439942.1_5 Reverse -348 -362 18.4416 0.173
NP_440696.1_3 Forward -222 -204 -2.14413 0.274
NP_442380.1_10 Reverse -258 -276 10.8356 0.242
NP_441926.1_3 Reverse -230 -246 2.8118 0.256
NP_441102.1_2 Reverse -357 -376 12.8808 0.159
NP_441102.1_2 Forward -108 -89 5.40766 0.298
NP_441203.1_1 Reverse -20 -39 -17.3068 0.288
NP_440914.1_1 Reverse -203 -213 6.66328 0.269
NP_441011.1_8 Forward -306 -297 7.96454 0.163
NP_442533.1_6 Reverse -293 -302 4.42462 0.179
NP_442533.1_6 Reverse -132 -141 2.85133 0.236
NP_442541.1_10 Reverse -152 -166 2.16228 0.265
NP_442541.1_10 Forward -212 -198 2.06395 0.269
NP_442322.1_4 Forward -126 -109 -4.38673 0.259
NP_442322.1_4 Reverse -96 -113 -9.30325 0.29
NP_442322.1_4 Forward -289 -272 -9.30325 0.29
NP_442202.1_10 Forward -276 -262 13.8643 0.222
NP_442664.1_3 Forward -116 -102 17.6992 0.223
NP_440116.1_8 Forward -264 -245 -6.98204 0.22
NP_441106.1_1 Reverse -78 -87 2.94966 0.248
NP_441106.1_3 Forward -390 -371 12.3892 0.217
NP_441825.1_4 Reverse -113 -123 15.713 0.195
NP_442306.1_10 Reverse -173 -192 -20.5517 0.213
NP_442674.1_2 Forward -78 -59 7.27595 0.283
NP_440886.1_7 Reverse -154 -164 4.7978 0.218
NP_440828.1_1 Forward -237 -218 2.6536 0.231
NP_440513.1_4 Forward -154 -135 7.7676 0.295
NP_441808.1_8 Reverse -185 -204 11.3075 0.222
NP_441021.1_1 Reverse -287 -306 -6.68705 0.18
NP_442221.1_6 Forward -139 -122 14.4935 0.177
NP_441962.1_4 Forward -146 -127 -13.7669 0.277
NP_441431.1_2 Forward -232 -218 10.0287 0.17
NP_441993.1_1 Forward -289 -270 3.11618 0.241
NP_441174.1_1 Reverse -264 -279 11.7796 0.247
NP_440114.1_10 Reverse -146 -160 9.34103 0.177
NP_441425.1_3 Reverse -357 -367 16.4996 0.273
NP_442323.1_7 Forward -228 -209 5.99684 0.201
NP_440293.1_3 Forward -115 -96 -0.590531 0.232
NP_439988.1_3 Reverse -318 -332 5.80112 0.278
NP_439988.1_3 Forward -192 -178 4.03116 0.296
NP_441531.1_7 Forward -174 -155 14.3558 0.272
NP_440457.1_1 Forward -146 -134 0.530633 0.25
NP_441332.1_4 Reverse -2 -21 6.58763 0.261
NP_441332.1_6 Forward -276 -266 12.8085 0.209
NP_441332.1_6 Forward -332 -322 10.8723 0.282
NP_442509.1_9 Forward -142 -132 12.5659 0.0871
NP_442514.1_5 Reverse -152 -171 -3.14789 0.222
NP_440554.1_4 Reverse -299 -309 5.28991 0.153
NP_441173.1_9 Reverse -371 -379 11.8187 0.222
NP_440191.1_4 Forward -16 -6 14.2146 0.266
NP_441307.1_4 Forward -231 -212 -1.08219 0.273
NP_442638.1_2 Reverse -317 -336 16.8141 0.0728
NP_439962.1_4 Forward -204 -185 0.294447 0.197
NP_439962.1_4 Reverse -179 -198 -7.4737 0.289
NP_441105.1_3 Reverse -147 -166 -7.4737 0.254
NP_441105.1_3 Forward -337 -318 -9.24366 0.286
NP_440172.1_1 Forward -295 -285 3.02829 0.251
NP_441226.1_7 Reverse -100 -107 5.34865 0.289
NP_440198.1_3 Reverse -149 -168 14.2566 0.277
NP_440416.1_9 Reverse -291 -310 -15.7335 0.198
NP_443052.1_9 Reverse -130 -149 -2.85214 0.242
NP_443052.1_9 Forward -204 -185 -5.31042 0.266
NP_441940.1_4 Reverse -130 -149 8.35759 0.266
NP_440591.1_9 Forward -314 -296 4.54237 0.275
NP_440988.1_10 Reverse -195 -209 4.99564 0.247
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTACCCTTAGAACTGTGACGATTTGTAAAAATCCGCCCAATTTTTAAATTCTGATTCCGGCGAAATATGCCCCATACCATTGTTACGGAAACCTGCGAAGGCGTGGCCGACTGCGTTGAAGCCTGCCCCGTAGCCTGCATTCACCCCGGAGACGGGAAAAACACCATTGGCACCGATTGGTACTGGATTGACTTTGCCACCTGCATCGATTGCGGCATCTGCCTCCAAGTTTGCCCGGTGGAAGGGGCCATTCTGCCGGAGGAACGGCCTGATTTACAGAAAAGCCCTGCCTAGGGTTGGGAGGGGTCTAACTGCCCTCGACTAGCTTAAATTTTGCTGGTTGACTGATATTCACTAAGTTCCGTGGCCTGGGTCGATCAAACTTTTCCACCCTTTATCT

CDS

ATGTCTGACCTCCTCGTTGTTAAGGACGTATTCGCTGGCTATGTGGCTGATGTGCCCATTTTGCAGGGTATTAATTTCTCCATTGCGCCGGGGGAGTTGGTCACAGTTATCGGCCCCAACGGAGCGGGAAAGTCCACCCTAGCCAAAACTATTTTTGGCCTACTCACTCCAAGCCAGGGGGAGATTATTTTTAAAGGGGAAAATATTACCGGCCTTGGTTCTGACCAAATTGTGCGTCGGGGAATGTGCTATGTGCCCCAGGTTTGTAATGTGTTTGGCAGCCTAACAGTGGCAGAGAATTTGGATATGGGGGCCTTTCTACACCAGGGTCCTACCCAAACCCTAAAGGACCGCATCTATACCATGTTTCCCAAATTAGCCCAACGCCGCAACCAGAGGGCTGGGACTTTATCGGGGGGAGAACGGCAAATGTTGGCCATGGGTCGGGCTTTGATGTTAGACCCGGATTTGTTGTTGCTAGATGAACCGTCGGCGGCCCTATCCCCCATTTTGGTCAAGGATGTGTTCGCCCAAATTAAGGCCATTAATGCAACTGGTAAGGCAATTATTCTAGTGGAGCAAAATGCCAAACAGGCCTTGATGATGGCTGATCGGGGTTACGTGCTAGAAAATGGCCGGGATAAGTTGGAAGGATCGGGGCAAAGTCTACTCAATGATCCTTTGGTGGGAGAACTTTATTTGGGGGCAGCGTATCACAACTAA

Protein

MSDLLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEIIFKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKDRIYTMFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIKAINATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLGAAYHN