Your browser is old and dusty. Try Google Chrome!

Details for slr1880

ORF slr1880
Accession NP_441012.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -167 -181 1.17956 0.193
NP_441061.1_2 Reverse -281 -295 -0.197071 0.223
NP_440795.1_7 Forward -174 -167 14.6904 0.0123
NP_440795.1_7 Reverse -167 -174 14.6904 0.0123
NP_441418.1_6 Forward -307 -288 -20.3551 0.111
NP_441418.1_6 Forward -225 -206 -29.8932 0.245
NP_441453.1_4 Reverse -166 -174 16.6374 0.00633
NP_441453.1_4 Forward -175 -167 16.539 0.00633
NP_442151.1_6 Reverse -166 -180 12.1926 0.0792
NP_442173.1_1 Forward -174 -166 17.3257 0.00633
NP_442173.1_1 Reverse -167 -175 15.4574 0.00633
NP_442173.1_4 Forward -292 -273 10.2259 0.255
NP_442752.1_4 Forward -175 -168 13.8055 0.0199
NP_443027.1_4 Forward -177 -167 15.3197 0.0437
NP_443027.1_4 Reverse -164 -174 14.7297 0.0452
NP_442975.1_10 Forward -179 -165 11.012 0.0516
NP_442975.1_10 Reverse -184 -198 9.34041 0.0722
NP_440784.1_7 Forward -174 -167 15.9687 0.0123
NP_440784.1_7 Reverse -167 -174 15.9687 0.0123
NP_440061.1_9 Forward -338 -324 4.91554 0.3
NP_442062.1_8 Forward -175 -165 10.0098 0.0527
NP_442062.1_8 Reverse -166 -176 7.84651 0.0871
NP_440761.1_4 Forward -180 -161 -5.50708 0.149
NP_441900.1_2 Reverse -279 -297 -4.99644 0.288
NP_441859.1_3 Reverse -366 -385 4.91521 0.211
NP_441859.1_5 Forward -304 -285 0.982764 0.3
NP_440304.1_4 Forward -177 -167 18.9579 0.00406
NP_440304.1_10 Reverse -257 -275 12.6055 0.233
NP_442242.1_4 Forward -174 -167 14.3954 0.0124
NP_442242.1_4 Reverse -167 -174 14.3954 0.0124
NP_440044.1_8 Reverse -167 -186 10.1275 0.0598
NP_440044.1_8 Forward -174 -155 0.687771 0.193
NP_440908.1_7 Reverse -282 -292 18.2696 0.285
NP_441200.1_4 Forward -313 -294 5.30933 0.295
NP_441935.1_1 Forward -225 -206 8.94757 0.225
NP_441594.1_6 Reverse -280 -299 0.982764 0.276
NP_441594.1_6 Forward -268 -249 -0.0988766 0.297
NP_442196.1_10 Reverse -164 -183 18.9773 0.117
NP_442110.1_7 Reverse -166 -180 20.7474 0.013
NP_442726.1_1 Forward -230 -211 20.2556 0.0708
NP_441925.1_4 Reverse -279 -298 -12.096 0.253
NP_440856.1_4 Reverse -159 -178 11.7992 0.0432
NP_441083.1_5 Reverse -166 -176 2.04498 0.195
NP_441083.1_5 Forward -175 -165 1.455 0.205
NP_441434.1_1 Forward -136 -122 8.41491 0.257
NP_441738.1_2 Reverse -168 -175 15.28 0.0102
NP_441738.1_2 Forward -173 -166 11.5435 0.084
NP_441558.1_5 Reverse -164 -183 12.4875 0.0677
NP_441558.1_5 Forward -177 -158 7.66927 0.174
NP_440209.1_1 Forward -175 -167 18.1123 0.00295
NP_440209.1_1 Reverse -166 -174 8.57422 0.0425
NP_441713.1_1 Forward -181 -162 -8.35868 0.148
NP_441770.1_4 Forward -196 -177 4.22769 0.12
NP_440178.1_7 Reverse -165 -184 -13.7669 0.143
NP_442570.1_3 Forward -218 -199 -8.06369 0.279
NP_441716.1_1 Reverse -256 -270 2.65453 0.298
NP_441327.1_5 Forward -140 -131 13.9627 0.261
NP_442111.1_4 Reverse -165 -179 9.2427 0.0619
NP_442111.1_4 Forward -176 -162 8.65272 0.0709
NP_441163.1_1 Reverse -200 -217 6.92128 0.254
NP_441831.1_4 Forward -350 -331 10.9142 0.25
NP_440906.1_5 Forward -174 -167 15.8704 0.0124
NP_440906.1_5 Reverse -167 -174 15.8704 0.0124
NP_442596.1_10 Forward -216 -197 6.39097 0.293
NP_440747.1_10 Reverse -163 -175 7.4138 0.00422
NP_440747.1_10 Forward -178 -166 -11.7607 0.142
NP_441854.1_10 Forward -218 -199 2.26107 0.282
NP_441880.2_10 Forward -196 -178 11.8189 0.142
NP_442634.1_4 Forward -177 -163 16.4209 0.0108
NP_442634.1_4 Reverse -164 -178 5.50613 0.0561
NP_441265.1_3 Forward -181 -167 3.04785 0.181
NP_440403.1_10 Reverse -280 -299 6.98095 0.212
NP_440842.1_10 Forward -206 -192 1.37622 0.294
NP_441014.1_8 Forward -340 -321 -7.27704 0.276
NP_442848.1_1 Forward -181 -167 -3.147 0.263
NP_442848.1_4 Reverse -193 -207 8.45605 0.282
NP_442848.1_5 Reverse -200 -218 -1.25915 0.276
NP_442848.1_5 Reverse -178 -196 -2.83245 0.286
NP_441012.1_1 Forward -300 -281 21.1406 0.149
NP_441012.1_4 Forward -338 -325 17.5222 0.117
NP_443018.1_3 Forward -174 -167 14.8871 0.0123
NP_443018.1_3 Reverse -167 -174 14.8871 0.0123
NP_441634.1_8 Forward -300 -286 -3.54032 0.295
NP_441634.1_8 Reverse -164 -178 -3.93365 0.295
NP_440376.1_1 Reverse -166 -175 9.73449 0.0365
NP_440376.1_1 Forward -175 -166 9.63616 0.0385
NP_440376.1_1 Reverse -325 -334 2.26134 0.228
NP_441588.1_4 Reverse -168 -178 6.66654 0.185
NP_440266.1_1 Forward -112 -93 14.3558 0.247
NP_442687.1_7 Forward -176 -166 8.04317 0.116
NP_442191.1_4 Reverse -167 -181 14.8714 0.073
NP_442946.1_6 Reverse -146 -165 17.1404 0.291
NP_442483.1_6 Reverse -212 -231 14.0599 0.25
NP_440360.1_9 Reverse -19 -38 5.60432 0.282
NP_442658.1_1 Forward -177 -167 15.9091 0.00966
NP_442658.1_1 Reverse -164 -174 13.3526 0.04
NP_440141.1_8 Forward -255 -236 18.9773 0.115
NP_440141.1_8 Forward -304 -285 6.39097 0.261
NP_442782.1_2 Forward -175 -161 20.0591 0.112
NP_442782.1_2 Forward -215 -201 0.294584 0.291
NP_440720.1_1 Forward -186 -167 2.3594 0.263
NP_440607.1_8 Forward -306 -287 6.39097 0.206
NP_441958.1_5 Forward -176 -166 19.9412 0.00158
NP_441958.1_5 Reverse -165 -175 11.4848 0.00522
NP_441127.1_5 Forward -218 -199 12.6001 0.284
NP_440984.1_7 Forward -180 -166 9.73436 0.127
NP_440984.1_7 Reverse -190 -204 5.1128 0.27
NP_441162.1_3 Reverse -288 -307 10.0292 0.22
NP_439990.1_5 Forward -180 -167 8.57408 0.168
NP_442690.1_1 Forward -43 -24 -6.58872 0.168
NP_442911.1_2 Reverse -156 -175 -5.31042 0.155
NP_441580.1_6 Forward -186 -167 -7.17871 0.236
NP_440153.1_5 Reverse -167 -181 5.21113 0.191
NP_440153.1_8 Reverse -283 -296 -3.4223 0.295
NP_442119.1_9 Forward -365 -346 11.1109 0.248
NP_440200.1_5 Forward -327 -308 9.0459 0.231
NP_443055.1_6 Reverse -362 -380 3.06666 0.2
NP_440993.1_2 Reverse -161 -177 16.4798 0.0617
NP_440993.1_2 Forward -180 -164 3.99177 0.256
NP_440993.1_4 Reverse -201 -218 4.16874 0.277
NP_441913.1_1 Reverse -138 -154 14.6911 0.246
NP_441099.1_5 Forward -185 -166 -11.8986 0.291
NP_440809.1_9 Reverse -157 -175 -8.04399 0.225
NP_442438.1_10 Reverse -161 -175 3.8345 0.156
NP_442431.1_10 Forward -301 -283 3.3624 0.218
NP_441000.1_6 Forward -176 -162 -3.73699 0.225
NP_440147.1_4 Reverse -164 -177 17.0305 0.00838
NP_440147.1_4 Forward -177 -164 8.67241 0.0475
NP_441550.1_8 Forward -177 -167 17.4824 0.00754
NP_441550.1_8 Reverse -164 -174 10.9926 0.0578
NP_441916.1_7 Reverse -166 -176 19.6462 0.00144
NP_441916.1_7 Forward -175 -165 16.893 0.00407
NP_440465.1_10 Forward -298 -279 -0.983855 0.29
NP_441041.1_4 Reverse -166 -185 -2.85214 0.117
NP_441041.1_7 Forward -178 -166 14.9975 0.0309
NP_441041.1_7 Reverse -163 -175 12.4708 0.0611
NP_442642.1_9 Forward -253 -236 0.333834 0.271
NP_440703.1_9 Reverse -202 -215 5.52525 0.292
NP_441725.1_4 Reverse -161 -175 3.44058 0.279
NP_441725.1_5 Reverse -167 -177 8.92815 0.0553
NP_439966.1_7 Forward -177 -167 13.8442 0.0234
NP_439966.1_7 Reverse -164 -174 6.0761 0.195
NP_439966.1_9 Forward -177 -168 0.983037 0.253
NP_442941.1_3 Forward -174 -164 16.6963 0.0112
NP_442941.1_3 Reverse -167 -177 10.9931 0.0116
NP_440289.1_2 Forward -178 -165 -4.40561 0.288
NP_440983.1_5 Reverse -283 -302 7.66927 0.151
NP_440260.1_8 Forward -219 -201 -3.02911 0.246
NP_440260.1_8 Reverse -271 -289 -4.01242 0.263
NP_442281.1_1 Forward -180 -166 11.012 0.0511
NP_442281.1_1 Reverse -161 -175 9.14375 0.0736
NP_441334.1_7 Reverse -164 -183 5.99764 0.0276
NP_441334.1_7 Forward -177 -158 -11.5053 0.122
NP_442256.1_2 Reverse -164 -182 -5.38906 0.214
NP_440437.1_1 Reverse -160 -179 5.80098 0.0837
NP_441457.1_7 Forward -199 -180 6.4893 0.171
NP_441457.1_7 Reverse -164 -183 6.4893 0.171
NP_442068.1_4 Forward -339 -320 9.83173 0.183
NP_441644.1_6 Reverse -166 -176 16.6958 0.00284
NP_441644.1_6 Forward -175 -165 9.616 0.0728
NP_441644.1_6 Reverse -111 -121 8.92768 0.0895
NP_442215.1_2 Reverse -323 -339 -4.07137 0.227
NP_440253.1_2 Reverse -166 -184 -0.669169 0.218
NP_440929.1_8 Reverse -166 -175 9.93116 0.0249
NP_440929.1_8 Forward -175 -166 9.83282 0.0254
NP_442933.1_10 Forward -175 -166 17.601 0.00325
NP_442933.1_10 Reverse -166 -175 17.601 0.00325
NP_441751.2_8 Forward -174 -160 -2.55701 0.132
NP_441751.2_8 Reverse -167 -181 -4.4253 0.173
NP_442554.1_8 Reverse -167 -177 19.1546 0.00369
NP_442554.1_8 Forward -174 -164 7.64985 0.0853
NP_442554.1_8 Reverse -112 -122 4.69992 0.176
NP_442554.1_8 Reverse -257 -267 4.50326 0.184
NP_441762.1_7 Reverse -165 -177 4.46387 0.0477
NP_442313.1_3 Reverse -306 -325 8.75091 0.224
NP_442142.1_4 Forward -178 -165 10.6384 0.0697
NP_442142.1_4 Reverse -286 -299 8.77016 0.108
NP_442142.1_4 Reverse -163 -176 6.60689 0.16
NP_442142.1_4 Reverse -185 -198 4.93527 0.206
NP_442292.1_1 Reverse -167 -176 17.5026 0.00435
NP_442292.1_1 Forward -174 -165 8.55452 0.035
NP_442476.1_6 Forward -174 -160 0.982901 0.233
NP_443009.1_5 Forward -176 -165 14.7094 0.02
NP_443009.1_5 Reverse -165 -176 11.7595 0.0602
NP_441715.1_4 Forward -174 -164 15.5163 0.0194
NP_441715.1_4 Reverse -167 -177 7.25653 0.108
NP_440183.1_9 Reverse -258 -277 -2.85214 0.175
NP_441198.1_5 Reverse -168 -181 14.2767 0.206
NP_441198.1_8 Forward -177 -167 15.4199 0.0427
NP_441468.1_1 Forward -174 -167 15.8704 0.0124
NP_441468.1_1 Reverse -167 -174 15.8704 0.0124
NP_441020.2_6 Forward -177 -160 11.7402 0.112
NP_441015.1_10 Forward -297 -278 4.03102 0.13
NP_441015.1_10 Forward -180 -161 -3.73712 0.191
NP_441015.1_10 Forward -215 -196 -3.93378 0.195
NP_441015.1_10 Forward -303 -284 -9.24366 0.281
NP_441015.1_10 Forward -300 -281 -10.0303 0.282
NP_441673.1_1 Reverse -166 -175 11.1111 0.0121
NP_441673.1_1 Forward -175 -166 11.0128 0.018
NP_441096.1_9 Forward -28 -9 16.5191 0.227
NP_441826.1_2 Forward -181 -167 7.17775 0.0899
NP_441826.1_2 Reverse -283 -297 2.45787 0.127
NP_441330.1_1 Reverse -161 -180 -12.9802 0.183
NP_441637.1_9 Reverse -230 -248 -2.73412 0.292
NP_442490.1_9 Reverse -256 -275 -6.09707 0.273
NP_441764.1_4 Reverse -25 -42 9.59972 0.282
NP_442868.1_6 Forward -177 -167 8.63316 0.0555
NP_442868.1_6 Reverse -164 -174 1.55333 0.205
NP_442719.1_2 Forward -314 -296 -10.6013 0.278
NP_442361.1_3 Forward -181 -168 10.639 0.272
NP_442808.1_1 Reverse -288 -298 5.97777 0.134
NP_440145.1_3 Forward -185 -166 -0.787193 0.143
NP_441906.1_5 Reverse -285 -304 23.303 0.0241
NP_442542.1_9 Forward -182 -168 10.0287 0.124
NP_442542.1_9 Forward -204 -190 5.80051 0.256
NP_442050.1_5 Forward -177 -167 17.1874 0.00812
NP_442050.1_5 Reverse -164 -174 15.0242 0.0169
NP_440601.1_8 Reverse -246 -265 17.3761 0.148
NP_442789.1_4 Forward -291 -272 6.09597 0.135
NP_441878.1_6 Reverse -165 -175 0.766681 0.134
NP_441878.1_6 Forward -176 -166 0.668351 0.139
NP_441036.1_8 Reverse -165 -175 15.418 0.00944
NP_441036.1_8 Forward -176 -166 11.7798 0.106
NP_441557.1_5 Forward -175 -166 18.6826 0.0015
NP_441557.1_5 Reverse -166 -175 10.5211 0.00695
NP_441445.1_1 Forward -304 -285 5.89931 0.162
NP_441590.1_4 Forward -339 -320 7.17681 0.25
NP_441590.1_4 Forward -344 -325 1.76863 0.299
NP_442066.2_4 Reverse -166 -185 2.55606 0.134
NP_442066.2_4 Reverse -188 -207 1.17943 0.152
NP_442066.2_9 Forward -179 -166 7.78743 0.208
NP_441433.1_8 Forward -150 -131 -3.14714 0.276
NP_441308.1_8 Forward -177 -167 12.4681 0.218
NP_440101.1_3 Reverse -161 -180 4.916 0.207
NP_442183.1_1 Reverse -166 -180 8.94771 0.105
NP_441407.1_5 Forward -185 -166 2.65439 0.293
NP_442166.1_7 Forward -174 -160 13.0776 0.175
NP_442397.1_1 Forward -152 -138 17.4803 0.191
NP_441574.1_1 Forward -298 -279 -0.4922 0.206
NP_442170.1_5 Reverse -166 -185 2.65439 0.173
NP_442347.1_2 Reverse -232 -241 8.06287 0.116
NP_442347.1_2 Reverse -167 -176 3.34298 0.284
NP_441037.1_4 Forward -177 -167 16.5761 0.0168
NP_441633.1_3 Reverse -164 -177 -1.45568 0.158
NP_441633.1_3 Reverse -284 -297 -5.58558 0.236
NP_441633.1_3 Reverse -278 -291 -6.37223 0.248
NP_440136.1_2 Forward -174 -167 15.9687 0.0123
NP_440136.1_2 Reverse -167 -174 15.9687 0.0123
NP_442590.1_10 Forward -223 -204 9.53756 0.196
NP_442998.1_5 Forward -249 -239 9.41981 0.241
NP_442998.1_5 Reverse -141 -151 8.82982 0.261
NP_442998.1_10 Reverse -168 -175 15.5754 0.0102
NP_442998.1_10 Reverse -190 -197 10.4622 0.0819
NP_442998.1_10 Forward -173 -166 5.74231 0.255
NP_440899.1_1 Forward -228 -209 9.28577 0.217
NP_440899.1_5 Forward -344 -325 7.27595 0.242
NP_440299.1_1 Forward -179 -166 4.54195 0.207
NP_440299.1_1 Reverse -162 -175 3.95196 0.224
NP_440299.1_1 Reverse -285 -298 2.87033 0.269
NP_440299.1_8 Reverse -109 -127 19.292 0.145
NP_441799.1_1 Reverse -162 -176 15.7319 0.0167
NP_441799.1_1 Forward -179 -165 5.1122 0.223
NP_440640.1_6 Forward -307 -288 16.6174 0.11
NP_441007.1_10 Forward -180 -167 12.409 0.0499
NP_441007.1_10 Forward -303 -290 5.62415 0.18
NP_441007.1_10 Forward -294 -281 0.805932 0.216
NP_440256.1_1 Reverse -163 -182 8.35759 0.0236
NP_440256.1_1 Forward -178 -159 6.58763 0.0296
NP_441512.1_4 Reverse -162 -181 8.25926 0.264
NP_441559.1_4 Reverse -322 -341 11.8975 0.102
NP_441559.1_8 Reverse -245 -259 1.57289 0.155
NP_441559.1_8 Reverse -161 -175 -1.08205 0.18
NP_442302.1_6 Forward -250 -231 10.9142 0.274
NP_440915.1_6 Reverse -162 -176 15.0442 0.0183
NP_440915.1_6 Forward -179 -165 13.6676 0.0187
NP_441866.1_6 Forward -322 -303 10.4217 0.22
NP_442866.1_1 Reverse -161 -180 -1.96717 0.205
NP_440748.1_5 Forward -179 -160 3.44104 0.21
NP_441464.1_10 Forward -300 -286 7.86607 0.287
NP_440702.1_2 Forward -303 -284 -3.63879 0.257
NP_440787.1_7 Reverse -316 -332 20.9047 0.109
NP_441939.1_3 Forward -174 -155 7.7676 0.19
NP_441939.1_3 Reverse -167 -186 5.50599 0.273
NP_441494.1_6 Forward -180 -167 7.09911 0.267
NP_442386.1_9 Reverse -165 -174 7.37413 0.219
NP_442386.1_9 Forward -146 -137 6.9808 0.219
NP_442386.1_9 Forward -176 -167 6.39082 0.219
NP_441750.1_1 Forward -298 -279 -4.6221 0.204
NP_441750.1_4 Reverse -162 -181 8.75091 0.159
NP_441340.1_5 Forward -174 -167 15.6737 0.0124
NP_441340.1_5 Reverse -167 -174 15.6737 0.0124
NP_442791.1_5 Forward -312 -293 -11.5053 0.29
NP_441132.1_5 Forward -325 -306 15.4374 0.252
NP_442240.1_2 Reverse -167 -186 -12.8819 0.163
NP_442240.1_2 Forward -174 -155 -19.3717 0.295
NP_441160.1_5 Forward -309 -290 -4.6221 0.288
NP_440586.1_1 Forward -207 -188 -4.91709 0.278
NP_440586.1_1 Reverse -321 -340 -5.21209 0.282
NP_440586.1_8 Forward -174 -167 13.2151 0.026
NP_440586.1_8 Reverse -167 -174 13.2151 0.026
NP_440586.1_8 Reverse -257 -264 5.8403 0.283
NP_440586.1_8 Reverse -112 -119 5.8403 0.283
NP_442251.1_6 Forward -174 -167 15.2804 0.0124
NP_442251.1_6 Reverse -167 -174 15.2804 0.0124
NP_441262.1_3 Forward -175 -168 14.7888 0.0223
NP_441262.1_3 Reverse -166 -173 13.9038 0.0336
NP_440027.1_3 Reverse -295 -313 2.57501 0.289
NP_443051.1_1 Forward -176 -167 19.5676 0.00335
NP_443051.1_1 Reverse -165 -174 10.2261 0.00842
NP_439937.1_8 Forward -297 -278 0.294447 0.235
NP_439937.1_9 Forward -338 -321 -10.8765 0.236
NP_439937.1_9 Reverse -285 -302 -11.0732 0.241
NP_440408.1_7 Forward -265 -246 9.73422 0.255
NP_440439.1_1 Forward -178 -165 10.7374 0.0348
NP_440439.1_1 Reverse -163 -176 8.08242 0.0559
NP_442239.1_8 Forward -308 -289 5.30933 0.28
NP_439943.1_1 Forward -126 -107 -10.817 0.29
NP_440372.1_2 Forward -174 -167 16.3621 0.0124
NP_440372.1_2 Reverse -167 -174 16.3621 0.0124
NP_440316.1_10 Reverse -330 -340 15.713 0.165
NP_439977.1_5 Reverse -160 -179 8.16093 0.107
NP_441572.1_7 Forward -181 -162 6.29264 0.0812
NP_440267.1_2 Reverse -161 -175 21.5334 0.00946
NP_442384.1_10 Forward -175 -162 8.08242 0.0692
NP_442384.1_10 Reverse -166 -179 1.49425 0.257
NP_442035.1_8 Reverse -286 -300 13.3726 0.237
NP_442114.1_4 Reverse -166 -177 10.1868 0.17
NP_442572.1_1 Reverse -257 -276 6.4893 0.254
NP_441018.1_7 Forward -220 -201 8.84924 0.239
NP_441018.1_7 Forward -302 -283 8.75091 0.241
NP_442262.1_10 Forward -174 -167 14.1988 0.0123
NP_442262.1_10 Reverse -167 -174 14.1988 0.0123
NP_441689.1_5 Reverse -164 -174 10.5993 0.132
NP_441689.1_5 Forward -177 -167 8.43603 0.132
NP_441689.1_5 Reverse -147 -157 5.09279 0.285
NP_440282.1_10 Forward -214 -195 -4.22878 0.25
NP_440531.1_6 Reverse -187 -206 16.4207 0.0353
NP_440531.1_8 Forward -310 -291 6.58763 0.241
NP_442123.1_3 Forward -175 -156 15.1424 0.125
NP_440562.1_3 Reverse -167 -184 16.3618 0.052
NP_441965.1_10 Forward -178 -162 8.02334 0.135
NP_442693.1_6 Reverse -160 -179 9.0459 0.278
NP_440297.1_9 Reverse -167 -177 -0.314959 0.282
NP_442187.1_3 Forward -299 -289 13.5497 0.245
NP_441592.1_4 Reverse -2 -21 -1.27885 0.253
NP_440999.1_1 Forward -331 -312 2.6536 0.249
NP_440999.1_9 Reverse -285 -299 11.0127 0.0482
NP_440999.1_9 Forward -179 -165 1.57289 0.162
NP_440999.1_9 Reverse -162 -176 -1.5737 0.242
NP_440888.1_2 Reverse -166 -180 18.0918 0.00261
NP_440888.1_2 Forward -175 -161 10.717 0.0861
NP_440600.1_4 Reverse -158 -176 -0.7675 0.155
NP_439969.1_3 Forward -180 -161 1.86774 0.249
NP_442277.1_4 Reverse -157 -176 16.7149 0.0313
NP_442277.1_4 Forward -184 -165 14.0599 0.0467
NP_442033.1_10 Reverse -186 -205 -9.047 0.211
NP_440575.1_8 Reverse -126 -145 0.0977854 0.185
NP_441917.1_2 Reverse -108 -126 14.3755 0.152
NP_441543.1_2 Reverse -167 -176 15.9293 0.00518
NP_441543.1_2 Forward -174 -165 12.8811 0.0311
NP_442845.1_2 Reverse -325 -339 5.1128 0.243
NP_442845.1_2 Forward -181 -167 3.8345 0.275
NP_442845.1_2 Reverse -105 -119 3.24451 0.298
NP_441469.1_8 Forward -176 -167 6.5879 0.227
NP_442315.1_2 Reverse -320 -332 8.88877 0.292
NP_442337.1_6 Forward -299 -280 12.763 0.277
NP_442337.1_8 Forward -222 -203 12.7825 0.131
NP_442578.1_7 Forward -174 -167 14.5921 0.026
NP_442578.1_7 Reverse -167 -174 14.5921 0.026
NP_441462.1_2 Forward -175 -165 19.2529 0.00159
NP_441462.1_2 Reverse -166 -176 10.5014 0.00824
NP_441621.1_7 Forward -177 -163 -3.147 0.188
NP_441621.1_7 Reverse -284 -298 -6.58858 0.298
NP_443062.1_1 Reverse -166 -184 10.3986 0.117
NP_443062.1_1 Forward -175 -157 6.49827 0.198
NP_443062.1_1 Reverse -111 -129 4.15809 0.272
NP_443062.1_6 Forward -303 -284 4.12936 0.221
NP_440349.1_3 Reverse -353 -372 9.63507 0.299
NP_441410.1_3 Reverse -157 -176 3.83436 0.295
NP_440519.1_8 Reverse -325 -341 8.515 0.199
NP_442204.1_1 Forward -179 -168 2.61528 0.266
NP_442204.1_1 Reverse -162 -173 1.63197 0.267
NP_441560.1_3 Reverse -208 -226 14.8671 0.159
NP_440516.1_8 Forward -175 -166 9.4395 0.0183
NP_440516.1_8 Reverse -166 -175 7.17789 0.0754
NP_442428.1_5 Forward -174 -167 15.8704 0.0124
NP_442428.1_5 Reverse -167 -174 15.8704 0.0124
NP_440818.1_3 Reverse -169 -188 9.53756 0.088
NP_441790.1_3 Reverse -167 -186 9.73422 0.0922
NP_442120.1_4 Reverse -281 -300 16.1257 0.0728
NP_442823.1_8 Forward -175 -156 11.3075 0.286
NP_440673.1_2 Forward -185 -166 12.048 0.156
NP_440673.1_2 Forward -308 -289 9.99938 0.226
NP_440673.1_3 Forward -173 -166 14.0021 0.0426
NP_440673.1_3 Reverse -168 -175 12.4288 0.0426
NP_440673.1_7 Forward -186 -167 4.916 0.185
NP_441052.1_2 Reverse -166 -176 1.94665 0.221
NP_441052.1_2 Forward -175 -165 0.57002 0.256
NP_442219.1_9 Forward -174 -165 8.94785 0.0681
NP_442219.1_9 Reverse -167 -176 8.25953 0.0681
NP_440436.1_4 Reverse -167 -176 9.24241 0.0871
NP_440436.1_4 Forward -174 -165 7.96411 0.119
NP_441884.1_8 Forward -176 -157 -10.817 0.268
NP_440314.1_9 Reverse -167 -186 -10.3253 0.295
NP_442907.1_9 Forward -339 -320 -4.22878 0.275
NP_441719.1_4 Forward -174 -167 16.3621 0.0124
NP_441719.1_4 Reverse -167 -174 16.3621 0.0124
NP_441733.1_8 Forward -243 -224 11.2092 0.274
NP_441733.1_10 Forward -178 -165 9.95071 0.106
NP_441004.1_1 Forward -313 -294 3.24438 0.106
NP_441004.1_1 Forward -304 -285 -15.6352 0.276
NP_441004.1_1 Forward -203 -184 -15.8318 0.279
NP_441004.1_1 Reverse -361 -380 -17.7985 0.294
NP_441004.1_5 Forward -311 -297 8.25939 0.276
NP_442366.1_3 Reverse -165 -183 -5.38906 0.287
NP_441115.1_4 Forward -176 -158 18.3079 0.0148
NP_441115.1_4 Reverse -165 -183 11.5231 0.136
NP_442206.1_10 Forward -175 -160 6.07642 0.178
NP_440328.1_4 Forward -181 -162 2.45773 0.201
NP_443054.1_2 Reverse -164 -178 0.491246 0.262
NP_442430.1_10 Forward -185 -166 9.14342 0.297
NP_441851.1_10 Forward -176 -166 9.7148 0.114
NP_442856.1_7 Reverse -328 -347 -5.9004 0.289
NP_441668.1_4 Forward -155 -136 -1.67217 0.278
NP_441668.1_5 Reverse -116 -135 8.84924 0.232
NP_440593.1_3 Reverse -278 -297 0.786102 0.193
NP_440593.1_3 Reverse -190 -209 -1.47551 0.211
NP_440593.1_3 Reverse -196 -215 -2.55715 0.227
NP_440593.1_3 Forward -276 -257 -6.09707 0.27
NP_440593.1_3 Reverse -294 -313 -7.08038 0.285
NP_441982.1_6 Reverse -140 -149 12.6763 0.274
NP_440165.1_5 Forward -176 -157 1.57275 0.125
NP_441046.1_2 Forward -309 -290 0.687771 0.263
NP_441349.1_10 Reverse -156 -175 1.0811 0.0851
NP_440432.1_9 Reverse -167 -182 15.6145 0.0125
NP_440432.1_9 Forward -174 -159 -5.62497 0.26
NP_442843.1_1 Forward -313 -294 3.14605 0.154
NP_442843.1_1 Reverse -257 -276 -11.4069 0.291
NP_440474.1_8 Reverse -167 -181 7.86545 0.196
NP_440588.1_2 Reverse -277 -296 -0.295539 0.15
NP_440588.1_3 Forward -205 -186 10.6192 0.253
NP_440195.1_4 Reverse -202 -221 4.03102 0.297
NP_442006.1_2 Forward -145 -128 -9.20427 0.197
NP_442006.1_2 Reverse -305 -322 -15.3991 0.224
NP_441003.1_9 Forward -154 -135 3.53937 0.291
NP_443047.1_7 Reverse -167 -186 4.12936 0.271
NP_441570.1_1 Forward -175 -157 -17.2871 0.269
NP_441078.1_4 Reverse -166 -175 9.93116 0.0203
NP_441078.1_4 Forward -175 -166 9.83282 0.0226
NP_442729.1_5 Forward -299 -289 15.3197 0.199
NP_442348.1_2 Forward -217 -208 10.1278 0.27
NP_442443.1_1 Reverse -291 -310 -2.16383 0.252
NP_442443.1_4 Forward -142 -132 15.7125 0.174
NP_440526.1_3 Reverse -167 -178 11.6612 0.0646
NP_441432.1_8 Forward -176 -167 16.8143 0.00595
NP_441432.1_8 Reverse -165 -174 7.07956 0.105
NP_441432.1_9 Reverse -242 -255 11.4101 0.227
NP_442320.1_8 Forward -181 -167 5.60446 0.0334
NP_442320.1_9 Forward -302 -288 11.406 0.264
NP_441732.1_2 Forward -124 -108 -15.9694 0.164
NP_441732.1_2 Reverse -162 -178 -16.3627 0.165
NP_442003.1_9 Reverse -167 -186 13.2741 0.167
NP_442797.1_6 Reverse -190 -209 10.455 0.238
NP_442797.1_7 Forward -341 -323 -0.964162 0.291
NP_440578.1_10 Forward -225 -206 9.14423 0.286
NP_441945.1_10 Forward -314 -295 11.4058 0.238
NP_441057.1_4 Forward -299 -281 -2.0458 0.272
NP_440913.1_1 Reverse -164 -182 16.4404 0.0951
NP_440913.1_1 Forward -177 -159 5.82068 0.234
NP_442489.1_2 Reverse -150 -169 6.58763 0.175
NP_442489.1_7 Reverse -166 -175 10.4228 0.0151
NP_442489.1_7 Forward -175 -166 10.3245 0.0193
NP_440559.1_1 Forward -174 -165 8.75118 0.0586
NP_440559.1_1 Reverse -167 -176 8.65285 0.0586
NP_441659.2_8 Reverse -166 -176 18.6629 0.00133
NP_441659.2_8 Forward -175 -165 11.2881 0.0189
NP_441659.2_8 Reverse -111 -121 3.51995 0.157
NP_440426.1_7 Reverse -156 -175 3.44104 0.207
NP_442913.1_10 Forward -184 -165 9.14423 0.0462
NP_441040.1_2 Forward -300 -281 -3.44213 0.144
NP_441040.1_5 Reverse -197 -216 2.16274 0.291
NP_442008.1_2 Forward -178 -159 4.32602 0.24
NP_441800.1_7 Reverse -281 -299 -1.25915 0.242
NP_441800.1_7 Reverse -290 -308 -1.84914 0.255
NP_442776.1_6 Forward -177 -158 6.98095 0.292
NP_440779.1_5 Reverse -166 -183 -4.77938 0.116
NP_442346.1_5 Forward -176 -166 15.8113 0.0045
NP_442346.1_5 Reverse -165 -175 14.1397 0.0164
NP_442346.1_5 Reverse -110 -120 11.1898 0.0735
NP_442346.1_10 Forward -242 -223 13.7658 0.0935
NP_440545.1_3 Forward -179 -162 5.74204 0.0597
NP_440545.1_3 Reverse -162 -179 0.727158 0.133
NP_441856.1_3 Forward -178 -159 -2.36049 0.26
NP_440831.1_1 Reverse -167 -186 10.4225 0.277
NP_440010.1_10 Forward -187 -168 2.65439 0.275
NP_442311.1_5 Reverse -293 -312 13.0775 0.201
NP_440449.1_6 Forward -183 -165 6.79689 0.24
NP_441948.1_4 Reverse -159 -177 -3.42244 0.193
NP_440170.1_6 Reverse -161 -180 19.469 0.0959
NP_441358.1_1 Forward -178 -165 21.0621 0.0303
NP_441833.1_4 Forward -174 -167 15.9687 0.0124
NP_441833.1_4 Reverse -167 -174 15.9687 0.0124
NP_441329.1_6 Forward -83 -64 -3.1994 0.298
NP_442162.1_9 Forward -174 -167 16.2637 0.0124
NP_442162.1_9 Reverse -167 -174 16.2637 0.0124
NP_442199.1_5 Reverse -158 -177 7.17762 0.0719
NP_442199.1_5 Reverse -103 -122 -5.9004 0.255
NP_442140.1_3 Reverse -167 -177 7.94484 0.124
NP_442140.1_3 Forward -297 -287 7.35486 0.142
NP_442140.1_3 Forward -196 -186 4.60159 0.242
NP_442140.1_3 Forward -174 -164 4.40493 0.243
NP_442140.1_3 Reverse -257 -267 4.0116 0.265
NP_440875.1_9 Reverse -168 -178 16.8403 0.0145
NP_440875.1_9 Forward -173 -163 12.9469 0.0911
NP_440875.1_9 Forward -338 -328 10.1241 0.231
NP_441813.1_5 Reverse -164 -174 17.3846 0.00979
NP_441813.1_5 Forward -177 -167 8.73149 0.0367
NP_441813.1_7 Reverse -286 -300 11.9953 0.215
NP_442254.1_1 Forward -132 -113 -6.29373 0.297
NP_440590.1_4 Reverse -167 -180 12.704 0.013
NP_440567.1_1 Reverse -167 -181 16.0275 0.0166
NP_440567.1_1 Forward -174 -160 10.1277 0.0394
NP_440035.1_10 Forward -343 -325 16.8768 0.229
NP_442497.1_10 Reverse -167 -176 17.601 0.00813
NP_442497.1_10 Forward -174 -165 15.7327 0.0087
NP_440821.1_4 Forward -177 -167 10.7964 0.0146
NP_440927.1_4 Reverse -146 -165 12.3892 0.247
NP_441239.1_9 Reverse -164 -176 11.4454 0.0607
NP_441239.1_9 Forward -177 -165 10.7571 0.0723
NP_441239.1_9 Forward -342 -330 3.77555 0.276
NP_441727.1_3 Forward -127 -108 6.19431 0.245
NP_441892.1_1 Forward -184 -167 -5.27103 0.276
NP_441892.1_4 Reverse -255 -274 -1.7705 0.292
NP_440604.1_6 Forward -175 -156 7.57094 0.0953
NP_442643.1_3 Forward -264 -245 1.17943 0.203
NP_441874.1_1 Forward -149 -135 9.93102 0.265
NP_440876.1_5 Reverse -168 -187 5.11266 0.283
NP_441782.1_10 Reverse -303 -317 17.9986 0.123
NP_440546.1_4 Forward -175 -165 15.1848 0.0459
NP_440546.1_4 Reverse -166 -176 14.3121 0.0459
NP_440546.1_4 Reverse -111 -121 10.046 0.109
NP_440546.1_4 Reverse -331 -341 9.3673 0.142
NP_439974.1_4 Forward -186 -167 11.7008 0.228
NP_442041.1_5 Forward -181 -162 -0.983855 0.278
NP_440675.1_1 Reverse -322 -341 8.84924 0.195
NP_440462.1_6 Forward -177 -167 19.4496 0.00371
NP_440462.1_6 Reverse -164 -174 18.0729 0.00578
NP_440868.1_4 Reverse -162 -174 7.11881 0.0756
NP_440868.1_4 Forward -179 -167 0.432302 0.212
NP_442499.1_1 Reverse -281 -300 2.65439 0.286
NP_442479.1_9 Forward -316 -297 -9.83364 0.266
NP_441848.1_4 Reverse -24 -40 8.12362 0.288
NP_441848.1_4 Reverse -135 -151 8.02812 0.288
NP_441843.2_9 Reverse -168 -186 11.8537 0.205
NP_442882.1_7 Reverse -159 -173 13.1753 0.261
NP_442039.1_4 Forward -174 -167 15.1821 0.0124
NP_442039.1_4 Reverse -167 -174 15.1821 0.0124
NP_442039.1_7 Reverse -138 -148 15.3197 0.211
NP_442679.1_1 Forward -287 -268 -3.93378 0.269
NP_442679.1_1 Forward -261 -242 -4.91709 0.286
NP_442837.1_3 Forward -174 -167 15.7721 0.0124
NP_442837.1_3 Reverse -167 -174 15.7721 0.0124
NP_440160.1_2 Reverse -201 -220 -8.35868 0.286
NP_440160.1_2 Forward -216 -197 -9.14533 0.293
NP_442053.1_1 Forward -175 -166 9.24284 0.068
NP_442053.1_1 Reverse -166 -175 8.94785 0.07
NP_440505.1_3 Forward -177 -167 15.418 0.0114
NP_440505.1_3 Forward -199 -189 10.9931 0.0899
NP_440505.1_3 Reverse -164 -174 7.45319 0.154
NP_440505.1_7 Reverse -307 -326 4.12936 0.207
NP_442532.1_4 Reverse -23 -41 13.5885 0.215
NP_442532.1_7 Forward -295 -281 1.86788 0.261
NP_440914.1_1 Reverse -166 -176 15.0561 0.00832
NP_440914.1_1 Forward -175 -165 7.24882 0.242
NP_441699.1_7 Forward -47 -28 5.70185 0.255
NP_441011.1_1 Reverse -195 -214 20.7473 0.0363
NP_441011.1_8 Forward -174 -165 17.896 0.00602
NP_441011.1_8 Reverse -167 -176 16.6177 0.00602
NP_441011.1_10 Reverse -2 -21 21.7306 0.0349
NP_442533.1_1 Reverse -321 -340 -2.0655 0.14
NP_442533.1_1 Reverse -322 -341 -17.2085 0.281
NP_442533.1_6 Forward -175 -166 15.1427 0.00675
NP_442533.1_6 Reverse -166 -175 7.47288 0.0898
NP_442533.1_6 Forward -120 -111 4.91628 0.165
NP_442533.1_6 Forward -334 -325 4.81794 0.172
NP_442541.1_10 Reverse -256 -270 10.422 0.194
NP_442541.1_10 Forward -120 -106 6.88214 0.247
NP_442541.1_10 Forward -340 -326 1.27731 0.287
NP_442322.1_4 Forward -343 -326 -1.14182 0.226
NP_441482.1_7 Forward -181 -167 -10.2268 0.209
NP_439944.1_9 Reverse -167 -177 17.7779 0.00341
NP_439944.1_9 Forward -174 -164 7.45319 0.141
NP_442597.1_9 Forward -134 -115 15.9978 0.284
NP_440816.1_7 Forward -179 -160 9.83255 0.252
NP_441028.1_6 Reverse -67 -77 7.35439 0.229
NP_441028.1_6 Reverse -232 -242 5.48612 0.255
NP_442202.1_4 Reverse -284 -298 15.6471 0.177
NP_440116.1_8 Forward -174 -155 13.2741 0.0277
NP_440116.1_8 Reverse -167 -186 -0.295539 0.106
NP_440116.1_8 Forward -222 -203 -5.31042 0.19
NP_441527.1_7 Reverse -245 -264 15.5349 0.227
NP_440115.1_6 Reverse -163 -173 12.7631 0.089
NP_440115.1_6 Forward -178 -168 7.84651 0.146
NP_440115.1_6 Reverse -325 -335 4.60159 0.293
NP_440007.1_9 Forward -179 -165 3.73617 0.267
NP_440572.1_9 Reverse -61 -80 16.6174 0.209
NP_441602.1_4 Reverse -44 -63 9.83255 0.278
NP_441170.1_4 Reverse -317 -335 4.9357 0.228
NP_441106.1_1 Forward -176 -167 18.486 0.0028
NP_441106.1_1 Reverse -165 -174 17.601 0.00462
NP_441106.1_1 Forward -121 -112 2.16301 0.297
NP_439903.1_6 Reverse -163 -182 0.883656 0.256
NP_441286.1_1 Reverse -165 -177 -3.89426 0.147
NP_440670.1_8 Forward -175 -166 8.94785 0.0606
NP_440670.1_8 Reverse -166 -175 8.84951 0.0606
NP_441479.1_1 Forward -178 -159 10.4225 0.211
NP_440886.1_7 Reverse -285 -295 15.9091 0.0203
NP_440886.1_7 Reverse -288 -298 7.25606 0.0993
NP_442614.1_2 Forward -175 -161 7.9644 0.257
NP_442382.1_8 Forward -307 -288 17.4367 0.265
NP_442072.1_9 Reverse -165 -183 -3.12744 0.0334
NP_442072.1_9 Forward -183 -165 -15.5171 0.183
NP_442072.1_9 Forward -176 -158 -21.3187 0.207
NP_442213.1_5 Reverse -320 -339 -0.0988766 0.276
NP_442022.1_4 Forward -298 -279 16.4207 0.152
NP_440907.2_8 Reverse -167 -177 19.1541 0.00362
NP_440907.2_8 Forward -174 -164 6.76441 0.15
NP_441021.1_1 Reverse -195 -214 -12.1936 0.281
NP_442842.1_4 Reverse -326 -345 3.73603 0.257
NP_441626.1_2 Forward -174 -167 15.7721 0.0124
NP_441626.1_2 Reverse -167 -174 15.7721 0.0124
NP_441460.1_2 Reverse -193 -206 15.6533 0.171
NP_442615.1_1 Reverse -157 -175 15.4571 0.00922
NP_442615.1_1 Forward -184 -166 -5.68405 0.22
NP_441962.1_4 Forward -297 -278 -11.0136 0.236
NP_441962.1_4 Reverse -284 -303 -13.3736 0.272
NP_440387.1_1 Reverse -166 -182 -1.3181 0.142
NP_441431.1_2 Reverse -163 -177 13.8636 0.0784
NP_441431.1_2 Reverse -286 -300 7.3738 0.244
NP_441836.1_2 Forward -298 -279 -2.95047 0.232
NP_441993.1_1 Forward -298 -279 10.5229 0.125
NP_441993.1_1 Forward -181 -162 10.1331 0.13
NP_441993.1_1 Forward -216 -197 1.75177 0.27
NP_441174.1_2 Reverse -163 -177 14.1593 0.176
NP_441174.1_4 Forward -242 -232 10.4031 0.288
NP_440467.1_3 Reverse -155 -174 11.4516 0.275
NP_440114.1_10 Reverse -166 -180 9.93102 0.159
NP_440114.1_10 Forward -175 -161 6.48943 0.269
NP_442323.1_7 Reverse -161 -180 14.2566 0.076
NP_440293.1_9 Forward -216 -202 11.6342 0.257
NP_440766.1_4 Forward -179 -165 8.35772 0.0871
NP_441311.1_2 Forward -181 -167 12.8803 0.23
NP_441311.1_2 Reverse -160 -174 11.307 0.256
NP_441246.1_7 Reverse -326 -345 6.58763 0.199
NP_440324.1_7 Forward -214 -197 15.3785 0.226
NP_441133.1_1 Reverse -325 -344 13.8641 0.24
NP_439910.1_2 Reverse -122 -139 -22.2823 0.22
NP_440457.1_1 Forward -179 -167 5.44718 0.141
NP_440457.1_1 Reverse -162 -174 0.727295 0.25
NP_440798.1_6 Forward -174 -161 1.9859 0.188
NP_440798.1_6 Reverse -167 -180 1.9859 0.188
NP_441436.1_8 Forward -293 -274 6.58763 0.299
NP_440554.1_4 Forward -174 -164 20.0396 0.0131
NP_440554.1_4 Reverse -167 -177 15.418 0.0199
NP_442862.1_3 Reverse -300 -317 8.39697 0.243
NP_441885.1_5 Forward -175 -165 10.1081 0.0145
NP_441885.1_5 Reverse -166 -176 1.65166 0.106
NP_441756.1_5 Forward -179 -160 -4.13045 0.292
NP_441173.1_9 Forward -148 -140 13.2937 0.17
NP_443000.1_7 Reverse -164 -174 19.6462 0.00357
NP_443000.1_7 Forward -177 -167 10.7964 0.0345
NP_442513.1_5 Forward -297 -278 7.76679 0.275
NP_441842.1_10 Forward -182 -168 11.996 0.113
NP_440275.1_3 Forward -177 -167 18.6629 0.0082
NP_440275.1_3 Reverse -164 -174 7.55152 0.0686
NP_440091.1_1 Forward -179 -167 3.2839 0.163
NP_441902.1_3 Forward -96 -86 14.8281 0.205
NP_440679.1_10 Reverse -351 -370 -13.4719 0.222
NP_440679.1_10 Forward -302 -283 -20.2567 0.283
NP_439962.1_4 Reverse -278 -297 -5.9004 0.28
NP_441105.1_3 Forward -169 -150 0.982764 0.118
NP_441105.1_3 Reverse -155 -174 -2.65548 0.165
NP_441105.1_3 Reverse -190 -209 -8.45701 0.272
NP_442373.1_2 Forward -301 -282 -11.0136 0.293
NP_440216.1_1 Forward -175 -161 16.4209 0.00307
NP_440216.1_1 Reverse -166 -180 -1.77037 0.0383
NP_440216.1_9 Forward -263 -254 16.9127 0.116
NP_440216.1_9 Reverse -138 -147 7.57121 0.286
NP_440216.1_9 Forward -143 -134 7.07956 0.289
NP_440172.1_1 Forward -175 -165 19.8429 0.00421
NP_440172.1_1 Reverse -166 -176 7.84651 0.0718
NP_441852.1_7 Forward -219 -200 14.2574 0.297
NP_441226.1_7 Forward -174 -167 14.4934 0.0123
NP_441226.1_7 Reverse -167 -174 14.4934 0.0123
NP_441535.1_10 Forward -179 -161 16.5388 0.159
NP_441111.1_7 Reverse -167 -175 18.7023 0.00294
NP_441111.1_7 Forward -174 -166 8.86921 0.0589
NP_442379.1_10 Reverse -159 -176 7.61033 0.102
NP_442379.1_10 Forward -182 -165 5.15205 0.134
NP_439971.2_9 Reverse -188 -207 16.0274 0.27
NP_441766.1_2 Forward -175 -166 17.896 0.00297
NP_441766.1_2 Reverse -166 -175 9.4395 0.0285
NP_440416.1_9 Reverse -159 -178 -14.4552 0.176
NP_440416.1_9 Forward -182 -163 -16.2252 0.21
NP_443052.1_8 Forward -185 -166 -6.1954 0.141
NP_443052.1_8 Reverse -178 -197 -9.24366 0.187
NP_443052.1_9 Reverse -288 -307 0.491109 0.197
NP_443052.1_9 Reverse -285 -304 -0.0988766 0.204
NP_443052.1_9 Reverse -279 -298 -1.37718 0.227
NP_441940.1_3 Forward -297 -278 12.4875 0.265
NP_442154.1_1 Forward -306 -288 1.19912 0.0962
NP_442154.1_1 Forward -297 -279 -3.02911 0.125
NP_442564.1_10 Reverse -135 -149 8.06273 0.296
NP_440261.1_5 Reverse -167 -180 -1.16069 0.0662
NP_440261.1_5 Forward -174 -161 -3.22564 0.12
NP_440988.1_10 Reverse -281 -295 8.86815 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTCAATCAATAGATCAACTTCCGGGTCCGTCGGATCAGTCACCGTCACATGGTTATATAACCCCAGGGCCGCCCCCAAACAATCAAAGCCTGGGCCAATATTGGCGGTGGTGGCGGGCACAGAAACGGTAAAGCTGACCATGGCAAATAGCAGGGAAAATGGGGATTAATGCTCTGGCATTATCGGGCTTGGTCTGGGCCAGAGGCAATAGTGGCTTGACCCAGAGGCGATCGCTTGGCGGATACGATTGATTTTTGCCAAGGCGAAAATAGTTTACTTAGACCATGGCTACCTGAATGAATGATTGGGCAGTAATGGAATTAATGGGAGTAAAATATCCATCTATTCATCTGGTTTATTAACATTTACCTATATTTATTTGGGAGTTAAAGCCTAGCCA

CDS

ATGAAATCCACTGGAGAAACACTGAACATAGAAGAAAAAGTTTTTGCGATTGCGGATCAATTTGATCACCAAGGAAAAATTGTCCAGATCAAACCCTTTGGCAACGGCAATATTAATGACACTTTTTTGGTGGATCTAGACGGTCAAACGCAAACTAGTTTTATTTTGCAAAGGATTAACCATCAAGTATTTAAAAATCCAGCGGCAGTGATGGGCAATATGGTCAGGGTAACTACCCATATTAAGCAAAAATTACAACGGCAACCCCTGGAACGCCCTTGGTTAATGCCAGAAGTAATTTTGACTAAAAATAATCAAGATCATTGGGATTCGGGCACTGGAGAATTTTGGCGGGCGATTAGCTTCATTGCCGGTTCGGAATCCTTTGATATTCTGACAGACCCAGCCCAGGCCAAGGAAGTGGGCACAGCCCTAGGCATTTTCCATCAACTGTTGAGCGACCTTTCCCCCAGCCAATTAGTCGATACTCTGCCTGGATTTCACCATACTCCCATTTATCTCCAGCAGTATCAGCGGGCCCTGGCCCAGAATCCGAAGCTAACAGGATCATTAGGCCCAGAAATTAACCATTGCCAAAGGGTCATTAAAACTTGGCTTGATCAGTGTGGAGTATTGGAAACAGCTAAAGCGCAGGGACAATTACCCCTCCGGTTAATGCATGGTGATCCCAAAGTGAATAATATTTTGTTTGATCGCCAATCGGGAAAAGCAGTCAGCGTGATTGATTTGGATACCACTAAACCAGGTTTAATCCATTACGATTTGGGGGATTGTTTGCGTTCCGGTTGCAATCTGTTGGGAGAAGAAACGGAAAACTGGTCAGCAGTGGAATTTGATCTAGATCTTTGCCGGGCTATTCTTGAGGGCTATTTACCCCAATGTCAGCATTTTCTCACCGCCGCTGATTATGATTATTTGTGCCCCGCCATTGTCCTGATTAGCTTTGAATTGGGACTACGGTTTTTTACCGATTACCTTAACGGCGATCGTTATTTCAAAGTTAAATACCCGGAGCACAATCTAATCAGAGCTTTGGTGCAATTCCAGTTAGCTAGCCATATCCAAAGCCAAGAAGATGCCATTCGTCGGATGATCGAGGATATCAGAGGTTAA

Protein

MKSTGETLNIEEKVFAIADQFDHQGKIVQIKPFGNGNINDTFLVDLDGQTQTSFILQRINHQVFKNPAAVMGNMVRVTTHIKQKLQRQPLERPWLMPEVILTKNNQDHWDSGTGEFWRAISFIAGSESFDILTDPAQAKEVGTALGIFHQLLSDLSPSQLVDTLPGFHHTPIYLQQYQRALAQNPKLTGSLGPEINHCQRVIKTWLDQCGVLETAKAQGQLPLRLMHGDPKVNNILFDRQSGKAVSVIDLDTTKPGLIHYDLGDCLRSGCNLLGEETENWSAVEFDLDLCRAILEGYLPQCQHFLTAADYDYLCPAIVLISFELGLRFFTDYLNGDRYFKVKYPEHNLIRALVQFQLASHIQSQEDAIRRMIEDIRG