Your browser is old and dusty. Try Google Chrome!

Details for slr1875

ORF slr1875
Accession NP_440998.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -72 -58 2.06454 0.179
NP_441061.1_2 Forward -106 -92 -2.55701 0.296
NP_441418.1_6 Reverse -234 -253 -13.9635 0.0792
NP_441418.1_6 Reverse -98 -117 -30.0898 0.256
NP_441453.1_4 Forward -389 -381 5.52596 0.127
NP_441453.1_4 Reverse -380 -388 3.85433 0.284
NP_441623.1_1 Forward -24 -6 -5.48739 0.29
NP_442151.1_1 Forward -271 -252 7.17762 0.286
NP_441818.1_1 Reverse -69 -80 11.4645 0.177
NP_440226.1_1 Reverse -380 -399 3.04771 0.241
NP_440150.1_2 Forward -387 -368 18.2882 0.133
NP_440150.1_6 Reverse -65 -84 6.09597 0.229
NP_441976.1_1 Forward -227 -208 15.7324 0.129
NP_442655.1_2 Forward -294 -275 1.0811 0.288
NP_442752.1_4 Forward -77 -70 10.5605 0.1
NP_442752.1_4 Forward -143 -136 5.25066 0.256
NP_439997.1_5 Forward -33 -14 13.7265 0.249
NP_441225.1_4 Forward -111 -92 -12.1936 0.284
NP_441934.1_8 Reverse -101 -120 10.6192 0.292
NP_441499.1_1 Reverse -4 -23 12.5858 0.237
NP_442062.1_8 Reverse -380 -390 6.37155 0.127
NP_440916.1_1 Reverse -153 -167 11.0127 0.206
NP_439918.1_2 Reverse -362 -381 5.40766 0.156
NP_442110.1_7 Reverse -92 -106 2.85119 0.222
NP_440856.1_7 Reverse -86 -105 -4.52377 0.222
NP_441083.1_5 Forward -101 -91 5.78156 0.104
NP_441434.1_7 Forward -387 -373 4.91614 0.225
NP_441571.1_8 Reverse -28 -47 -3.44213 0.294
NP_441444.1_5 Reverse -376 -395 19.6656 0.235
NP_442889.1_8 Forward -385 -371 3.44058 0.278
NP_442570.1_3 Reverse -359 -378 -8.45701 0.286
NP_441716.1_1 Reverse -58 -72 13.9626 0.0689
NP_441716.1_1 Forward -83 -69 4.91614 0.246
NP_442111.1_3 Reverse -25 -38 14.3856 0.23
NP_440747.1_10 Reverse -163 -175 -11.8591 0.161
NP_440747.1_10 Forward -327 -315 -12.1541 0.227
NP_441130.1_10 Forward -391 -377 6.29277 0.194
NP_442973.1_5 Reverse -157 -176 11.2092 0.251
NP_441486.1_1 Reverse -377 -391 -0.885388 0.164
NP_441486.1_1 Forward -116 -102 -5.70361 0.254
NP_442848.1_1 Forward -181 -167 1.08123 0.25
NP_441012.1_4 Forward -111 -98 12.0157 0.249
NP_443018.1_3 Forward -388 -381 10.6589 0.0967
NP_443018.1_3 Reverse -65 -72 8.39725 0.147
NP_443018.1_3 Reverse -381 -388 4.16902 0.278
NP_441634.1_8 Forward -109 -95 7.76774 0.114
NP_441634.1_8 Forward -320 -306 6.6861 0.114
NP_440376.1_1 Reverse -98 -107 1.57302 0.246
NP_440376.1_1 Reverse -360 -369 1.47469 0.251
NP_441588.1_4 Forward -99 -89 6.17489 0.206
NP_441588.1_4 Forward -387 -377 5.97822 0.221
NP_443065.1_9 Reverse -199 -218 11.8975 0.231
NP_442687.1_7 Reverse -379 -389 10.9931 0.0994
NP_442485.1_3 Reverse -93 -112 3.14605 0.205
NP_442958.1_9 Reverse -14 -24 16.893 0.277
NP_441422.1_7 Forward -391 -374 -5.36936 0.247
NP_440533.1_9 Reverse -98 -117 2.75272 0.264
NP_440360.1_10 Forward -387 -373 3.73617 0.227
NP_440141.1_8 Reverse -342 -361 4.32602 0.291
NP_442496.1_5 Forward -285 -267 10.5406 0.217
NP_441256.1_1 Reverse -95 -114 0.58944 0.176
NP_441256.1_1 Forward -116 -97 -7.96535 0.239
NP_442937.1_5 Forward -180 -161 6.19431 0.286
NP_442321.1_4 Forward -28 -9 -3.63879 0.28
NP_442321.1_4 Forward -380 -361 -7.57203 0.284
NP_441958.1_5 Reverse -379 -389 -1.10161 0.23
NP_440993.1_3 Forward -111 -92 -2.26292 0.299
NP_441099.1_5 Forward -111 -92 9.53756 0.0328
NP_440475.1_1 Forward -209 -190 16.5175 0.102
NP_442438.1_10 Reverse -99 -113 -0.0987402 0.248
NP_442431.1_10 Forward -302 -284 2.57575 0.235
NP_441000.1_6 Forward -390 -376 -5.60527 0.285
NP_441550.1_8 Reverse -378 -388 6.0761 0.214
NP_441916.1_7 Forward -389 -379 6.76487 0.0841
NP_440206.1_4 Forward -334 -315 3.04693 0.282
NP_440206.1_4 Forward -117 -98 -0.39464 0.29
NP_441041.1_7 Reverse -55 -67 5.27969 0.265
NP_441725.1_5 Forward -276 -266 -1.29827 0.299
NP_439966.1_7 Reverse -378 -388 4.10949 0.289
NP_439966.1_9 Reverse -378 -387 0.884706 0.253
NP_442941.1_3 Reverse -69 -79 4.60159 0.14
NP_442281.1_1 Forward -394 -380 8.16044 0.0845
NP_442281.1_1 Forward -329 -315 1.76896 0.29
NP_440437.1_1 Reverse -62 -81 -5.40875 0.282
NP_441644.1_6 Reverse -315 -325 11.2876 0.0524
NP_441644.1_6 Forward -101 -91 8.53436 0.0982
NP_441644.1_6 Forward -389 -379 5.78111 0.176
NP_441644.1_6 Forward -324 -314 5.09279 0.21
NP_442215.1_2 Reverse -371 -387 -5.05468 0.244
NP_442029.1_6 Reverse -369 -388 8.06259 0.211
NP_440929.1_8 Forward -382 -373 3.53964 0.225
NP_442933.1_10 Forward -389 -380 4.71961 0.22
NP_441751.2_8 Forward -388 -374 -5.31028 0.202
NP_441751.2_8 Reverse -316 -330 -5.90027 0.244
NP_442554.1_8 Reverse -316 -326 5.5849 0.145
NP_442554.1_8 Forward -388 -378 5.09324 0.161
NP_442554.1_8 Forward -323 -313 4.0116 0.2
NP_442554.1_8 Forward -112 -102 1.94665 0.288
NP_441762.1_7 Forward -390 -378 3.77555 0.0676
NP_442142.1_4 Forward -327 -314 11.7201 0.0535
NP_442142.1_4 Reverse -377 -390 5.0336 0.204
NP_442142.1_4 Reverse -312 -325 3.55864 0.251
NP_442142.1_4 Forward -116 -103 2.37867 0.294
NP_440919.1_1 Forward -282 -263 -1.47551 0.221
NP_440919.1_7 Forward -356 -338 7.28266 0.228
NP_441899.1_3 Forward -334 -315 17.404 0.058
NP_442406.1_9 Reverse -360 -379 1.47442 0.274
NP_441715.1_4 Reverse -49 -59 5.19158 0.224
NP_440183.1_9 Forward -111 -92 -11.3086 0.25
NP_441468.1_1 Forward -388 -381 3.97235 0.277
NP_441015.1_10 Forward -296 -277 -5.40875 0.223
NP_441339.1_4 Forward -130 -111 -5.9004 0.286
NP_441826.1_2 Reverse -374 -388 2.5562 0.125
NP_441826.1_2 Forward -324 -310 -0.688726 0.22
NP_441251.1_8 Reverse -194 -207 13.0487 0.254
NP_442808.1_1 Reverse -274 -284 2.24121 0.274
NP_442808.1_1 Forward -390 -380 1.25791 0.289
NP_442050.1_1 Reverse -91 -110 7.96426 0.256
NP_441114.1_3 Reverse -116 -125 7.37455 0.239
NP_440558.1_2 Forward -327 -308 0.786102 0.185
NP_440558.1_2 Reverse -100 -119 -4.52377 0.246
NP_441878.1_6 Forward -325 -315 0.766681 0.134
NP_441878.1_6 Reverse -314 -324 0.57002 0.14
NP_441557.1_5 Reverse -380 -389 -0.885252 0.26
NP_441445.1_1 Reverse -83 -102 13.1758 0.0613
NP_441445.1_1 Reverse -95 -114 -0.197208 0.286
NP_441445.1_1 Reverse -306 -325 -0.4922 0.294
NP_441739.1_2 Forward -369 -353 3.69611 0.261
NP_441574.1_1 Reverse -92 -111 -1.96717 0.222
NP_441574.1_1 Forward -300 -281 -2.65548 0.228
NP_440547.1_1 Forward -394 -375 7.66846 0.284
NP_440151.1_5 Reverse -314 -333 8.16093 0.222
NP_441633.1_3 Forward -59 -46 0.412608 0.124
NP_441633.1_3 Forward -212 -199 -5.78224 0.236
NP_442590.1_9 Forward -114 -95 3.93269 0.28
NP_442590.1_10 Reverse -92 -111 3.14605 0.295
NP_442590.1_10 Reverse -308 -327 2.94938 0.299
NP_442998.1_5 Forward -246 -236 14.533 0.149
NP_442998.1_5 Forward -164 -154 9.22315 0.248
NP_442998.1_10 Forward -387 -380 6.23397 0.157
NP_440899.1_2 Forward -382 -363 5.89851 0.273
NP_440299.1_1 Forward -179 -166 6.21356 0.149
NP_441799.1_4 Forward -106 -87 -7.17871 0.297
NP_442528.1_6 Forward -81 -62 13.8641 0.211
NP_441007.1_10 Forward -296 -283 1.10092 0.209
NP_441435.1_6 Reverse -43 -62 2.16274 0.259
NP_440256.1_1 Reverse -377 -396 2.65439 0.0619
NP_440256.1_1 Forward -327 -308 -10.3253 0.299
NP_441559.1_8 Forward -62 -48 -5.21195 0.254
NP_441179.1_9 Forward -115 -105 9.81266 0.28
NP_442866.1_9 Reverse -63 -82 8.25926 0.211
NP_442386.1_9 Forward -390 -381 10.8157 0.116
NP_442386.1_9 Forward -26 -17 5.0142 0.27
NP_442386.1_9 Reverse -97 -106 4.81753 0.282
NP_442386.1_9 Reverse -379 -388 4.52254 0.297
NP_440570.1_5 Forward -304 -285 -2.0655 0.277
NP_441340.1_5 Reverse -381 -388 11.3472 0.0526
NP_441271.1_5 Reverse -318 -337 10.5209 0.248
NP_441297.1_8 Forward -214 -196 15.7513 0.152
NP_442240.1_2 Forward -174 -155 -20.3551 0.295
NP_440161.1_3 Reverse -378 -397 11.1109 0.221
NP_440586.1_8 Reverse -65 -72 7.21693 0.27
NP_440586.1_8 Reverse -316 -323 5.8403 0.283
NP_440586.1_8 Reverse -105 -112 5.8403 0.283
NP_440586.1_8 Forward -388 -381 5.74197 0.283
NP_439937.1_8 Reverse -96 -115 -4.81876 0.286
NP_439937.1_9 Forward -58 -41 -3.50175 0.157
NP_440439.1_1 Reverse -377 -390 -1.75067 0.281
NP_442488.1_4 Reverse -199 -218 8.75091 0.298
NP_440139.1_1 Reverse -374 -393 1.96529 0.242
NP_442114.1_2 Reverse -213 -232 1.0811 0.262
NP_442262.1_10 Forward -388 -381 12.0355 0.062
NP_442262.1_10 Reverse -65 -72 10.7572 0.124
NP_440163.1_10 Reverse -312 -322 13.5497 0.122
NP_440163.1_10 Reverse -101 -111 9.61647 0.229
NP_440344.1_10 Reverse -41 -58 -10.4826 0.182
NP_441965.1_10 Reverse -312 -328 3.30346 0.266
NP_441965.1_10 Forward -80 -64 2.02515 0.292
NP_440297.1_9 Reverse -105 -115 -0.216628 0.282
NP_440297.1_9 Forward -323 -313 -0.41329 0.283
NP_440297.1_9 Forward -112 -102 -0.41329 0.283
NP_440894.1_10 Forward -62 -43 13.0775 0.12
NP_440937.1_5 Forward -130 -111 8.45592 0.286
NP_440999.1_9 Forward -61 -47 -1.18038 0.229
NP_440888.1_2 Forward -389 -375 5.1122 0.293
NP_442892.1_9 Forward -131 -117 11.4053 0.296
NP_441917.1_2 Reverse -312 -330 6.31233 0.288
NP_442845.1_2 Reverse -374 -388 7.27608 0.195
NP_441469.1_8 Reverse -379 -388 5.11294 0.289
NP_443064.1_6 Reverse -68 -78 12.5669 0.0796
NP_443064.1_6 Reverse -330 -340 9.3673 0.226
NP_440998.1_2 Forward -164 -145 22.5172 0.0411
NP_440998.1_3 Forward -336 -317 21.7306 0.0112
NP_440998.1_6 Forward -361 -342 16.7149 0.295
NP_440998.1_10 Forward -140 -121 23.6972 0.00278
NP_441462.1_2 Reverse -380 -390 -1.00328 0.274
NP_443062.1_1 Reverse -315 -333 10.0085 0.122
NP_443062.1_6 Forward -394 -375 1.0811 0.28
NP_440519.1_8 Reverse -55 -71 7.2367 0.205
NP_442204.1_5 Reverse -88 -107 8.25926 0.122
NP_440516.1_8 Reverse -380 -389 -0.393597 0.255
NP_440516.1_8 Reverse -92 -101 -0.393597 0.255
NP_442428.1_5 Forward -388 -381 4.36568 0.271
NP_441443.1_1 Forward -247 -228 -1.18052 0.241
NP_441267.1_1 Reverse -108 -127 10.7175 0.14
NP_442120.1_10 Reverse -92 -111 -16.0285 0.296
NP_441835.1_2 Reverse -225 -244 9.14423 0.228
NP_440673.1_2 Reverse -94 -113 10.4871 0.207
NP_440673.1_2 Reverse -104 -123 7.95079 0.286
NP_441052.1_2 Forward -324 -314 4.0116 0.168
NP_442219.1_9 Reverse -59 -68 2.35967 0.28
NP_440436.1_4 Reverse -381 -390 4.42421 0.265
NP_441884.1_8 Reverse -379 -398 -6.78538 0.238
NP_441733.1_10 Reverse -377 -390 9.85238 0.106
NP_441004.1_1 Reverse -92 -111 -13.5702 0.259
NP_441004.1_1 Reverse -368 -387 -14.6519 0.269
NP_442366.1_5 Forward -146 -136 11.1893 0.207
NP_442139.1_7 Reverse -87 -106 8.65258 0.253
NP_440129.1_10 Reverse -335 -349 4.71948 0.185
NP_443054.1_2 Forward -391 -377 11.3077 0.0761
NP_443054.1_2 Forward -69 -55 -0.393733 0.294
NP_442856.1_7 Forward -107 -88 8.35759 0.106
NP_442856.1_7 Forward -246 -227 -2.55715 0.236
NP_440389.1_5 Reverse -159 -178 13.0901 0.261
NP_442843.1_1 Reverse -381 -400 -9.047 0.264
NP_442843.1_1 Reverse -343 -362 -11.8003 0.293
NP_440474.1_8 Forward -388 -374 11.4053 0.109
NP_440431.1_3 Reverse -249 -268 -4.81876 0.18
NP_441003.1_9 Forward -333 -314 5.99764 0.255
NP_441078.1_4 Forward -324 -315 -1.6719 0.266
NP_441078.1_4 Reverse -315 -324 -1.77023 0.266
NP_442729.1_5 Reverse -314 -324 7.84651 0.261
NP_442388.1_4 Reverse -284 -303 11.0117 0.245
NP_441432.1_8 Forward -124 -115 2.75299 0.287
NP_441732.1_2 Reverse -162 -178 -6.82463 0.0533
NP_441131.1_5 Forward -124 -105 6.58763 0.251
NP_440131.1_4 Forward -114 -95 7.96426 0.243
NP_440199.1_10 Reverse -312 -322 15.6147 0.0861
NP_440199.1_10 Reverse -101 -111 12.0747 0.138
NP_440199.1_10 Reverse -377 -387 6.66654 0.287
NP_440713.1_4 Forward -111 -92 6.98095 0.184
NP_440713.1_4 Forward -300 -281 6.39097 0.19
NP_442489.1_7 Forward -389 -380 -1.47524 0.203
NP_442489.1_7 Forward -324 -315 -1.47524 0.203
NP_442489.1_7 Reverse -315 -324 -1.77023 0.247
NP_441706.1_8 Forward -137 -118 11.7008 0.213
NP_441659.2_8 Reverse -315 -325 5.78156 0.0979
NP_441659.2_8 Reverse -282 -292 -0.0199663 0.282
NP_440442.1_3 Reverse -97 -111 14.4542 0.287
NP_442346.1_5 Reverse -314 -324 13.353 0.0261
NP_442346.1_5 Forward -325 -315 4.60159 0.281
NP_442346.1_5 Reverse -103 -113 4.40493 0.29
NP_440545.1_5 Reverse -88 -105 10.2653 0.21
NP_440025.1_1 Forward -181 -162 7.7676 0.238
NP_441923.1_6 Reverse -17 -31 10.9143 0.25
NP_440459.1_2 Reverse -306 -323 7.90532 0.276
NP_440459.1_2 Reverse -95 -112 7.80699 0.278
NP_440010.1_4 Forward -111 -92 4.32522 0.22
NP_440847.1_3 Forward -397 -383 10.9137 0.279
NP_442603.1_7 Reverse -58 -72 7.47213 0.205
NP_442603.1_7 Reverse -92 -106 6.58715 0.236
NP_440170.1_2 Reverse -160 -179 10.3242 0.224
NP_442073.1_6 Forward -110 -91 -2.45882 0.286
NP_442140.1_3 Forward -388 -378 14.4347 0.0486
NP_441609.1_1 Forward -181 -162 -0.197208 0.23
NP_440875.1_2 Reverse -310 -329 9.43923 0.189
NP_440875.1_9 Forward -387 -377 17.4244 0.0126
NP_441813.1_5 Forward -391 -381 3.51995 0.167
NP_440567.1_1 Forward -388 -374 1.08123 0.219
NP_440821.1_4 Reverse -378 -388 -0.806614 0.296
NP_441239.1_9 Forward -391 -379 12.527 0.0463
NP_441239.1_9 Forward -115 -103 6.72548 0.178
NP_441239.1_9 Reverse -378 -390 5.34885 0.223
NP_441239.1_9 Forward -326 -314 3.87389 0.272
NP_441892.1_1 Reverse -125 -142 -4.18939 0.256
NP_441017.1_6 Reverse -264 -278 11.9953 0.232
NP_440949.1_5 Reverse -190 -209 17.7974 0.221
NP_440354.1_7 Reverse -374 -392 12.9988 0.206
NP_442138.1_1 Forward -115 -96 6.98015 0.24
NP_442052.1_7 Forward -298 -284 17.1092 0.153
NP_440546.1_4 Reverse -380 -390 12.8578 0.0572
NP_440546.1_4 Forward -389 -379 9.46426 0.136
NP_440546.1_4 Reverse -315 -325 9.27034 0.146
NP_440546.1_6 Reverse -41 -60 10.5209 0.245
NP_440462.1_6 Forward -391 -381 2.04498 0.294
NP_442340.1_3 Forward -111 -92 1.76941 0.144
NP_440402.1_1 Forward -217 -198 3.83436 0.269
NP_441084.1_6 Forward -326 -312 12.1559 0.169
NP_440696.1_3 Forward -123 -105 -0.7675 0.249
NP_440696.1_3 Reverse -94 -112 -3.52077 0.287
NP_439994.1_3 Reverse -57 -76 10.9749 0.197
NP_442053.1_1 Forward -175 -166 3.83464 0.285
NP_440013.1_2 Reverse -373 -387 11.996 0.298
NP_441011.1_8 Reverse -381 -390 5.01461 0.289
NP_442533.1_6 Forward -324 -315 6.98123 0.0992
NP_442533.1_6 Reverse -315 -324 6.68623 0.105
NP_442533.1_6 Reverse -380 -389 5.70292 0.132
NP_442533.1_6 Forward -107 -98 4.81794 0.172
NP_442533.1_6 Forward -389 -380 3.53964 0.21
NP_442541.1_10 Reverse -114 -128 2.75226 0.254
NP_442541.1_10 Forward -113 -99 2.26061 0.263
NP_442232.1_3 Reverse -372 -391 -13.0786 0.282
NP_442322.1_4 Reverse -273 -290 -9.59824 0.295
NP_441482.1_7 Reverse -160 -174 -12.1934 0.29
NP_441028.1_6 Forward -15 -5 4.89613 0.275
NP_439965.1_1 Forward -76 -57 -9.44032 0.288
NP_441106.1_1 Forward -390 -381 4.52295 0.219
NP_441106.1_1 Forward -325 -316 2.16301 0.297
NP_440670.1_8 Forward -277 -268 10.9145 0.0386
NP_440670.1_8 Reverse -234 -243 3.24465 0.29
NP_440828.1_4 Forward -114 -95 -8.26108 0.296
NP_442213.1_5 Reverse -87 -106 -2.16383 0.293
NP_440907.2_8 Forward -388 -378 5.97777 0.182
NP_439967.1_1 Forward -258 -240 12.1139 0.236
NP_442615.1_1 Reverse -371 -389 0.707465 0.0979
NP_440387.1_1 Reverse -166 -182 -5.25134 0.222
NP_440855.1_5 Forward -109 -90 4.71854 0.285
NP_441193.1_1 Reverse -148 -167 12.3883 0.229
NP_440114.1_10 Forward -389 -375 10.6193 0.142
NP_440114.1_10 Forward -277 -263 9.93102 0.159
NP_440114.1_10 Reverse -380 -394 5.70279 0.296
NP_441817.1_10 Reverse -375 -394 18.6823 0.166
NP_441272.1_4 Reverse -371 -390 7.37428 0.189
NP_440293.1_9 Reverse -321 -335 12.987 0.216
NP_440766.1_4 Reverse -376 -390 2.2612 0.191
NP_440766.1_5 Forward -165 -153 8.03776 0.286
NP_442743.1_5 Forward -112 -93 8.45592 0.148
NP_442743.1_7 Forward -299 -281 19.1929 0.245
NP_441311.1_4 Forward -157 -140 12.8219 0.298
NP_442930.1_1 Forward -36 -26 10.1076 0.278
NP_440457.1_1 Reverse -376 -388 0.333971 0.25
NP_441801.1_4 Forward -28 -18 2.63497 0.29
NP_440942.1_3 Reverse -316 -335 2.3594 0.298
NP_441984.1_3 Forward -335 -317 5.62401 0.279
NP_441436.1_8 Forward -176 -157 17.699 0.215
NP_441436.1_8 Reverse -314 -333 11.4058 0.261
NP_442514.1_5 Forward -259 -240 -9.63771 0.297
NP_440448.1_5 Reverse -147 -166 10.1275 0.261
NP_440554.1_4 Reverse -381 -391 4.0116 0.205
NP_441885.1_5 Reverse -380 -390 -1.29827 0.259
NP_442341.1_7 Reverse -233 -247 4.62115 0.185
NP_442341.1_7 Forward -68 -54 2.16287 0.267
NP_442341.1_7 Forward -58 -44 1.96621 0.274
NP_442341.1_9 Reverse -371 -385 4.62054 0.296
NP_441756.1_5 Forward -105 -86 1.27776 0.217
NP_441842.1_1 Reverse -70 -83 11.4251 0.254
NP_441842.1_3 Reverse -77 -95 16.5388 0.193
NP_440275.1_3 Reverse -378 -388 5.5849 0.14
NP_440091.1_1 Reverse -376 -388 2.49725 0.194
NP_442354.1_4 Forward -81 -63 16.7354 0.181
NP_441389.1_5 Reverse -8 -27 10.3242 0.286
NP_441105.1_3 Reverse -369 -388 2.45773 0.103
NP_440216.1_1 Forward -175 -161 -11.9968 0.236
NP_441226.1_7 Reverse -381 -388 12.4284 0.0404
NP_441226.1_7 Forward -106 -99 8.59356 0.197
NP_441766.1_2 Forward -101 -92 1.86802 0.271
NP_440416.1_9 Reverse -373 -392 -20.0601 0.281
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAACCAAATACACCGATGGCCGCTCCCAAATGCATATCCCCGCCAACTTACCTAAAGCTGTGGTGAACCAGATCCAGACCATGGCCATTCAAGCTTTTAAAGCTGTGGATGCGGCGGGCTTAGGACGATTGGACTTTTTCTATCAACCGACTACGGGGCAGATTGTCATCAACGAAATTAACACCCTGCCTGGTTTCACCGCCTTTAGTATGTATCCCGAACTGTGGCGAGCTTCTGGGGTAGAATTTCCTAGCTTAGTGGATCGATTATTACAGTTGGCATTGGACTACCATGGCCGTCCCGGTCACCAATAAGTGCTTGCTGGTGATCCATCGGAATCACCGATAATCTCCGCTGAAACGCTAAATTTTTCACTCCCAAGGCTTTATTCCCTATCCAT

CDS

ATGGCCCGTTTGTCCCAGGAATTGCAGGATTATTTCTTTAAGGAAGACCGTGGCCCGACGGTGAACCTGGCCCAGGTTTTGGCGATCGCCAAGGAGAAAATTTTTGGCATTGTTCTAGTAATTCTTTCCCTCCCTTCGGCTTTACCGATCCCGGCCCCCGGTTATTCCACCCCCTTTGGCGTACTAATTTTTCTGGTGGCAATTCAATTGATGGCTGGTCGTCAGGAGCTCTGGTTACCCCTCTCCTGGCAAAGCAAAACCATTAAAACCAGCAAGGCCCAAGGCATTGTCAAAGCTGGTTTACCCTGGTTGAAAAGACTAGAGGCGATCGCCCACCCCCGCTTCCCCCTCGTTTGTCAAAGTCGCCTGGGCAAAATTCTCATGGGTATTACCGTTGGCTCCATGGCCATTTCCATGATGATTCCCATTCCTGGCACCAACACCCTGCCGGCCATGAGTATTTTCATCACTGGTTTTGGTCTCCAGGAGGATGATGGCTTAATTACCGGAGCAGGGATGATTTTTTCCGTTTTAATTGGCGTCCTGATGGTTTCTGTGATTTACGTTTTCTTCAACGGCGGTATTACCATCATTGACATTCTTAAAGATTGGCTCAAAGTCCAGTTTGGCGGGGCTTAA

Protein

MARLSQELQDYFFKEDRGPTVNLAQVLAIAKEKIFGIVLVILSLPSALPIPAPGYSTPFGVLIFLVAIQLMAGRQELWLPLSWQSKTIKTSKAQGIVKAGLPWLKRLEAIAHPRFPLVCQSRLGKILMGITVGSMAISMMIPIPGTNTLPAMSIFITGFGLQEDDGLITGAGMIFSVLIGVLMVSVIYVFFNGGITIIDILKDWLKVQFGGA